close

Вход

Log in using OpenID

2 Aylık yemek teknik şartnamesi

embedDownload
KoNyA nGirtpr vE ARA$TTRMA rnsrnnnsi
MALzEMET,I vnvrnx i'isinnnn nZnnnr i
ALIMI
rnrofi< gmrxavresl
s0zr,ngnnn stinnsl
01.06.201 4
- 31.07 .2014
KONYA ECiTiM VE ARA$TIRMA IHSTANESi
MALZf,MELi YEMEK Pi$iRME HiZMET ALIMI
TEKNiK $ARTNAMESi
I.GENEL TANIMLAR VE KISALTMALAR:
Konya Elitim ve Arastrrma Hastanesi'nin Malzemeli Yemek Pigirme Hizmet Ahmr
i;i ile ilgili
teknik $artnamedir.
Hastane
T.C. Salhk Bakanhpr Konya Elitim ve Araqttrma Hastanesi
:
Konya Elitim ve Aragtrrma Hastanesi personeli ve hizmet allml ddhilinde galtqan
Personel
girket personelleri, hastanede staj yapmak igin gelen stajyer 6[renciler ve diler personeli ifade eder.
: Konya Epitim ve Aragtrrmla H stanlsi'nde teghis ve tecl=avi-amacryla yatan kigile'ri
:
'Hasta
ifade eder.
Refakatgi
Yiiklenici :
Normal
: Yatan hastalara hastane idaresinin miisaadesiyle refakat eden kigilerdir.
igi yiiklenen firmadrr.
: Hasta, refakatgi ve yukartda tantmlanan personele sunulan ekmek, su, baharat
Yemek
drgrnda 3 kaptan olugan meni.idtir.
Normal Kahvalh: Hasta, refakatgi ve yukanda tanlmlanan personele ekmek ve gayl sut /bitki gayr
ve geker dtgrnda sunulan ve 3 geqit kahvaltrhk malzemeden olulan m6niidiir'
her
Diyet Yemeli : Hastalara ve personele trbbi zorunluluk veya tedavi gereli olarak verilecek
tiirlii yemek ve besin maddeleridir.
verilecek her
Diyet Kahvaltr : Hastalara ve personele tlbbi zorunluluk veya tedavi gereli olarak
liirlti kahvaluhk besin maddesidir '
iqgi: Yemek hizmetinin yiiriitiilmesi igin gahgacak kigileri ifade eder'
2. i$iN KONUSU ve siinnsi
Hastane vardiyah gahgma diizeni iginde
nca devamlth$r ve
verilen
ve servis sonrast
ui,n"tuk, malzeme dahil her
tesintisizfigi
i'
hizmetin ifasrrir'
"rus
g
hizmetlerin zamantnda ve eksiksiz olarak yerine
Hizmet Alrnlr
Piqirme
Yemek
;;;y;r; metotla, ve ilgili diler husuilarr kapsar. Malzemeli
0l .06.2014 ile 3l .07.2014 tarihleri arasrnda 2 ay olarak yapt lacakttr'
i$iN YAPILMA YERi:
Konya Epitim ve Aragtrrma Hastanesi binasr ve hastaneye balh birimler (Hastanemize_23^Km
Zafer Semt
Uzaklkta Sulunan Beyhekim Psikiyatri Klinipi i1 AMATEM Klinili ve 6 km mesafeli
PolikliniIi dahil)
3.
4.i$ YERiNIN YUKLENiciYE rESLiMi:
i5e
Sdzlegmenin imzalanmasrndan sonra Yiiklenicinin sozlegmede yaztlt stire .iginde.
U"q;y.Uii..ri igin idare tarafrndan verilecek olan her tiirlii demirbag, arag, gereg, makine, _cihaz'
edilerek
,"tr"r", mutfak, yemekhane, depo, kiler, biiro, klinik ofisleri, tesis, fiziki alanlar v'b kontrol ortak
bir
arastnda
taraf
hususta
iki
Bu
edilir.
teslim
u" ii" brglunr.; i9 biti.ind" aynen
;;;li;
"i;r'.
tutanak diizenlenir.
gartnamede
iurtenici mutfak, yemekhane ve servislerde hizmetin daha verimli yiiriitiilmesi iginyukiimliidiir'
etmekle
giin
temin
6nce
iri"nit"n tii. malzeme ve ekipmanlarr iie ballama tarihinden l0
geri
alabilecektir'
sonra
i9
bitiminden
ve
malzemeleri
Bu ekipman
5.TAHMiNi YEMEK(OCIIN) SAYILARI:
ciNsi
2
90.000
Adet
19,000
Adet
200.000
Adet
35.000
Adet
Normal Kahvalfi
Diyet Kahvaltr
Normal Yemek (O!le- aktam)
(iki) eyhk
Diy€t Yemegi (O!le-.aktam)
6.qALI$TTRTLACAK PERSONELiN SAYISI, TA$IMASI GEREKEN OZELLIKLER
VE QALI$MA $ARTLARI:
Unvanlan
Diyetisyen veya Gtda
Savrlart ve nitelikleri
(
I kigi ilgili fakiilte / Y.O. mezunu)
miihendisi(proje
sorumlusu)
iage sorumlusu(firma
depo sorumlusu)
I kigi
Bag a99r
I kisi
Afgr
9
kisi I kiqi kasap, I kisi tatlrcr, I kigi diyet
aqgtst
Algl yardtmctsl
$ef Garson
t t iEi (en az lise mezunu, Bonservisli
Yemekhane
sorumlusu
I kigi en az lise mezunu
Garson
).
52 kigi (ilkolretim. lise diplomall.
bonservrsll'0/emeKnaneler
ve
servislerinde)
Bulagrkgt
Meydanct
7 kiti (ilkttEretim diPlomalD
4 kisi (ilkdEretim diPlomalt)
TOPLAM
85 kigi
a
irtildigi tiim personelinin giirevlendirilmesr
nici tarafrndan yaprlacak ve her haftanrn ilk i9
bildirilecektir. Ayrrca Yiiklenici her tiirlii eleman
en gtkarma, i5e alma, rapor) idare ve mutfaktan
bel
sorumlu diyetisyene vaztlr olarak bildirme zorunlulu$undadtr'
gii.n tince habiir
Miiteahhit firma igten personel grkarmalartnda Beslenme ve Diyet Birir.nine I
eleman girig
habersiz
idareden
u"rmek ,orundu olup, ige girig grkrqlarr idarenin denetiminde olacakttr.
yup,l.ayu""ktrr. iEen grLarllan elemanrn yerine yeni eleman aynt giin bailatllacaktlr'
9,krq,
Kar
2 - Yiiklenici hastanemiz mutfalrnda vereceli hizmetin saflrk, hijyen, kalite bakrmrndan ve diizenli
olarak iglemesini saflamak tizere hastanemiz mutfalrnda gahgtrracagr personel arastnda bir adet
Diyetisyen veya Grda miihendisi bulundurmak zorundadrr. Qahgan elemanlann efitimi, hastale
diyetisyenleri ile firma diyetisyeni veya Grda mtihendisi tarafindan ortakla5a yaptlacaktrr. Yiiklenici
mutfak sorumlu diyetisyeninin gerekli gdrd0lii durumlarda ( elitim, igleyig, personel saytmr,
aksak|rk|argibikonu|ar|gdrii$mekiizere)tiimelemanlarrntoplanmas|nlsaglayacakttr.
hastanede gahgan personeli, hastanede bulunmasr gereken mesai saatleri iginde mutfik
sorumlusu diyetisyenin bilgisi drgrnda higbir gekilde hastane drqrnda
j
3- Firma
galt$trramaz.
i;e girig-grkrg kontrolii hastane sistemine ba$h olarak otomasyondan takjP
edilecektir. Gerek g6riildii[ii takdirde mutfaktan sorumlu diyetisyen tarafindan yoklama veya
4-Qahgan personelin
denetimleri yaprlacaktrr.
5- Yilklenici igin devamr siiresince iggilerin zarar gtirmelerini dnleyici her
tiirlii giivenlik iinlemlerint
almak zorundadrr. Yeterli giivenlik 6nleminin ahnmamasl sebebiyle dogabilecek kazalarda meydana
gelecek hasar ve zarann ddenmesinde yiiklenici sorumludur.
6- Qalgacak personel l8 yagrndan kilgtik olmayacaktrr. Yiiklenici adrna gahgan personel hakkrnda
oluiabiiecek sug durumunda yiiklenici sorumlu ol caktlr ve hastanenin zararlnt iargtlayacaktrr'
:
7- yiiklenici gahgtlracagt personelin temizli[ine 9ok dikkat edecek ve firma personeli idare ve has-tane
elbisesini giyeceklerdir. Buna gdre personellere yiiklenici firma
tarafindan sa[lanmast gereken klyafetlerin sayr ve miktarlan qu gekilde olacaktrr:
diyetisyenlerin tisp;t
ittigi ig
Miktan
Malzeme Adt
Iggilerin Nitelikleri
Diyetisyen veya Crda
m0hendisi (proje sorumlusu )
i9
Giimle[i
iage sorumlusu (firma depo
sorum lusu)
Terlik
I
Gdmleli
1
Sabo
I9
Aggrbagr, Ag9r, Aggr Yrd.
Bulagrkgr, Meydancr
Pantolon
I
Kep
I
Askrh i9 Onliilii
Kolgak
I
Sabo Terlik
I
i9 Gomleli
l
Qizne
Mugamba Onliik
I
Pantolon
I
I
I
Gtimlek
t
Pantolon
$efGarson
Papyon
Ayakkabt
Giimlek
Pantolon
Yelek
Papyon
Ayakkabr
19 GiimleSi
Garson
Qizme
Mugamba Onliik
Sabo
Terlik
I
I
I
g- Kryafetler ige baglarken hastane idaresi ve mutfak sorumlu diyetisyeninin belirledili renk ve
dnce gahpnlara t€slim edilecektir'
roi.tO" ottu.igurtr ile i;e baqlamadan bir giin
-L,.,t.aya
karqr mukavemetli, Kaymaz tabanh, terliklh
9l ny.H."U,t", su gegirmez, guU"r" u"
olmaltdrr'
ayakl'a. terletmey"n,-haualunmastna izin veren, iyi kaliteden imal edilmig
l0- Firma
t.,ni"figi
elemanlarr higbir gekilde
yrkanmasr firmaya
"r
giyilmeyecektir.
ii-iieitere
kirli, yrrtrk ve eski kryafet giymeyeceklerdir. I9. kryafetlerin
ait olacaktri. Belirlenmig /onaylanmrg kryafetler drgmda i9 elbisesi
aylrt< Z6 giin iidenmek iizcne net
4(diirt) Tl yol iicreti
verilecektir.
.
t-
igin yiiriitiilmesi igin gerekli personelin gtirevleri:
Diyetisyen veya Grda miihendisi en az ddrt yrllk fakiilte veya yiiksek okul mezunu olacakttr. Proje
soiumlusu s6zlegme maddelerinin kendi branqr ile ilgili krsmrnrn yiiriitiilmesinden (grda, kalori,
yemeklerin tat, lezzet ve besin deferleri, hijyen, numune ahmr vb,) ve kontroliinden Yiiklenici adrna
sorumludur. Yemeklerin hazlrlamasr aEamasrndan da[rtrmrna kadar mutfakta kalrr, yemek$r
denetiminde hazrrlanrr ve dalrtrlrr. Servislerde yemek dalrtrmrnt kontrol eder, ofislerde uygun
porsiyonlama esaslanna gdre yemek hazrrlama ve dagltlml denetler. Yaptrlr iglerle ilgili olarak mutfak
iorumlu diyetisyenine bilgi vermekle yiikiimliidUr. Proje sorumlusu, mutfaktaki her tiirlii tiretim ve
dalttrm safhasrnda siiren ti.im faaliyetlerden yiiklenici adrna sorumludur. Ytiklenici Diyetisyeni veya
Gr-da mtihendisi ve Grda teknikeri ile mutfak sorumlu diyetisyeni stirekli diyalog halinde
bulu
n
acak la rd t r.
Ba; A99r; Aggrhk (ustahk ve usra egitici) belgeli, aggrlar aqgrhk belgeli(ustaltk veya usta egitici) asgl
y"iAt-"il"ti-u99thk veya kalfahk belgeli olacaktrr. Aggrlar istenilen dallarda (tathcr, pastact, hamur
yemekler vb )dnceden 9a19mr9 ve en az I yrl aggrlik
fuleri, diyet yernikleri, et yemekleri, ziytinyalh
tic.u|esi oiacaktrr. Sunulacak yemeklerin ha''lama, pigirme, dalItrm hizmetlerini yapmakla
yiikiimltidiirler. igleyigle ilgili olarik mutfak sorumlu diyetisyenine bilgi vermekle yiikiimliidiir.
yerlerin
Meydanct: Mutfak, yemekhaneler, depolar, soyunma odalarr, WC, el yrkama lavabolarl vb
.
temizli[i, di.izeni vb iqlerden sorumludur.
ofislerin temizlik ve diizeni gibi
yemek
$ef Garson; Garsonlarrn krhk- kryafet, davranrg,
_servisi,
garsonlarrn gahgma listesini
konularda talimatlara uygun olarak garsonlarr serk ve idare eder ve
y0kiimliidiir
haztrlarlar. iEleyigle ilgili olarak mutfak sorumlu diyetisyenine bilgi ve.nekle
ra, refakatgi kartr olan
Garson ve servis hizmetleri elemanlarr;
ve igecepi zamantnda etsiksiz
yrk,;i;.r u" nobetgi personele sunulacak olan
dagrtrmrnr saglamak' ofislerde
;il;k;" yernetteiin servis kurallartna uygu
olan tiim edevat ve malzemeleri eksiksiz bulundurmak ve
vemeklerin daAltllmasl
-i^iitiau esnaslnda gerekli
-yoneticisine
bildirmek, yemek dagrtrmt bittikten. sonra artrklartn
Yiiklenici
;;tkiilt.;;
toplanmastileuygungtippogetleriylegopeatlm|'bulagrklarrnhijyenikkogullardaytkanmastie
Ayrtca
kujd,r,6u'n, .ugti*at, tim iqleri bittikten sonra ofisi temiz olarak hizmete hazrr blrakacakttr'
genel
tiirlii
her
gibi
btililmlerin
tezgeh
gOreu ala,kla., ilanlardaki yer, fayans, yrkama havuzlan,
iemizlik iSlerini verilen talimatlar dogrusunda yapmakla yiiktimlii elemanlardtr.
hasta
arralanlardakihert0rliibulagrkhizmetini(sryrrma'yrkama"dezenfekteetmp'
nleme vb) yer' fayans, ylkama havuzlarr, frrrn, davlumbaz' ocak' tezgah gibi
nel temizlik isleiini verilen talimatlar do[rultusunda yapmakla yiikiimlii
eleman lardtr.
Personel iqin aranan nitelikler ige yeni baglayanlar igin gegerli olacaktrr'
Personel dosyast igin gerekli belgeler:
her zaman dosyada
Firma caltstrracaft her personel igin bir dosya tumcak. aqalrdaki belirtilen belgeler
olacak ve
yaglarda
uygun
iggiter yag stnrrlamasr ile ilgili ydnetmeliklere
belirtilen
aiagrda
personele
ait
ir""if"" U"fg"f", tam olaral dosyaianacaktrr. Yiiklenici, gahgrracagr
belgelerden Jluqan sicil dosyalarrnr ytiriirltikteki mevzuata giire
;;;;i;i";J;.ilcaktrr.
tutacaktlr'
!
L ikametgdh senedi
2. Foto[raflr niifus ciizdanr fotokopisi, T.C. kimlik numaras/ vergi numarasl( ige baglama tarihinde
getirilecektir)
3. iq bagvuru formu fotokopisi
4.6prenim belgeleri, aggrhk (ustaltk ve usta egiticilik, kalfaltk) belgeleri ve bonservisler (ash ve
fotokopisi Muayene Komisyonuna ibraz edilecektir )
5. Sigorta kartr/sigorta girig bildirgesi fotokopisi
6. Sabrka kaydr: Cumhuriyet Savcrhltndan veya kaymakamltklardan sabtkaslz kaydr idareye ige
baglama giinii verilecektir(Firma adtna galtgan personel hakkrnda olabilecek sug durumunda firma
sorumlu olacaktrr).
7. Saplrk raporu
8.Hei personele ait portdr sonuglannr gOsterir salhk karnesi; Ytiklenici sdzlegmenin imzalanmastndan
sonraki 7 i9 giinii iginde, galrgtrraca[r tiim elemanlarr (ydneticiler ve sorumlular dahil) bizzat muayene
igin hastaneye giderek numune v-erecek ue portdr muayenelerini yaptrrarak, sallam olduklarrirr
belgeleyeceklerdir. Portiir taramasl igin yaprlacak tetkikler gunlardrr;
Gaita kiiltiirii, (Salmonella ve shigella ytiniinden, en az yrlda bir)
- Dtgkrnrn mikroskobik incelenmesi (Entamoeba histolyca kistleri, giardia lamblia kistleri ve helmint
-yumurtalarr ydniinden, en az 6 ayda bir)
Bolaz ve burun kiiltiirii (Staphylococcus aureus ytintinden, en az yrlda bir)
- Akciler grafisi (Tiiberkiiloz ytiniinden, en az yrlda bir)
-Bu retkiile;r yeni ipe baglayanlarda, ige giriq muayenesi ile birlikte, galrqanlarda ise periyodik port<ir
taramasr geklinde yaprlmasr ve sonuglarrna gdre portdrliilii tespit edilenlerin gegici igten
uzaklagtrrrimasr veya igyerinde yaptrgr isin gegici olarak deligtirilmesi de dahil olmak iizere hastahk
yayrlrmrnr engelleyecek tedbirler alrnmahdlr
yiittenici Firma her ttrlti bulagrcr hastallk, cilt hastahlr bulunmadrlrnr ilgili kuruluglardan alacaklart
saflrk kurulu raporu ile belgelemek ve Muayene Komisyonuna vermek zorundadtr'
Yiiklenici firma personelinin uymasl gereken kurallar:
giymek, erkek
L Yiiklenici elemanlarr kendisine verilen ozel giysiyi (tiniforma) temiz ve iitii lti qekilde
yerin
galigtrpr
diizen $e
elemanlar giinliik trraglr (sa9, sakal) olmat, iinallarr kesilmiq olmak ve
trruiiu"nu"tir"n gdstermek- zorundadrr. Uniformaslyla baEda$mayacak qekilde kolye, madalyon,
kiinye, rozet, kostek, halhal, bilezik v.b. takrlmayacaktrr.
bulunmayacakttr.
2. doien slresince gorevi drqrndaki iglerle ulraqmayacak, iq/hasta v.b. takiplerde
l.Hurrn" g<irevlileri, mesai arkadaqlarr, diper yiiklenici firmalartn elemanlart, hasta ve yakrnlarrga
kargr nezaket kurallan iginde hareket edeceklerdir.
personelin
+. i"t'qu.ut personel, idarece onaylanmrq yaka kartlannt -takmak zorundadrr' Bu kartlar
q"f,'q;;."utfii igerisinde yakalarrnda takrh olac ktrr. Yaka kartlannda personelin "adr - soyadr ve
giirevi" kolayca okunacak gekilde olacaktrri. Rgg,lu., rnutfak ue servis elemanlarrnrn elleri siirekli temiz olacak ve agtkta yara olmayacakttr.
A. Virtfrf. giriglerinde remiz ve kirli galoE, bone kutusu olacakttr. Qalgrrken(yemek haztrlanmast,
pigirihnesi ve dalrtrmr esnaslnda) personel hijyen kurai.lanna uyacak; sag bonesi' eldiven' yiiz
(salata, kcifte,
maskesi, kolluk k-ullanacaktrr. Mutfakta galrgan a99rlar, elle haztrlanarr yiyeceklerde
eldiveu,
sanna, pasta, btirek vb) ve pigmig yemeklerin da[rtrm agamastnda kesinlikle tek kullanrrnlrk
Yiiklenici
tiimii
malzemelerin
kullanrlacak
Bu
aqamada
bone,-kolluk ve maske kulianacaklardrr.
tarafindan kargllanacakttr.
herhangi bir gey yemek, sakrz gilnemek, tukiirmek ve gtdalara do$ru hapqtrmak,
iJ,.ti,
iglendili
".nu$nda
dkstirmek gibi davranrqlarJan tuitnriu"ut t,r. Kigisiiegyalar ve giysiler grda maddelerinin
alanlarda bulundurulmayacaktrr'
g. yiiklenici mensubu olup da mutfakta gorevli olmayan kigiler
elemanlar mutfala girmeyecektir.
ve iizerirrde i9 kryafeti olmayan
9. Mutfak p..rin"ti u. dig"r elamanlar 4207 Sayrh Tutiin ve Tiitiin Mamullerinin Zarlartqn
girigleri ve pencere
onlenmesine Dair Kanun gerelince hastane binasrnda ve kapah alanlarda kapl
6nleri dihil kesinlikle si gara igmeyeceklerdir.
10. Mutfak personeli muifak, yemekhane ve ofis iginde ziyaretgi kabul etmeyecektir.
I
l.
Mutfakta g<irevli tiim personel
T.yirKLENiciNix
i;i
bitmeden giirev yerinden ayrtlmayacakttr.
vtixtivrtir,tixr,nni vr
cEZAi HtiKUMLER
f-idare, i9 baglangrcrnda ve devaml strasrnda tiim personel, malzeme, ekipman, araba vb kontrolii
yapacaktrr. Yiiklenici igin yiiriitiilmesinde kalifiye( yapacapl ige uygun egitim almlg ) elemanlbr
gahgtrracaktrr.
:'
2-Yiiklenici firma iqe baglamadan dnce gartnamede belirtilen sayt ve nitelikteki personel dosyastnt
(iginde her bir personel igin gerekli olan diploma, aggrlk, ustahk ve usta dgreticilik, kalfalrk, bonservis
belgesi vb ) idareye bildirmek zorundadlr.
3-Q-a|gan ir.ron"lin her birinin dzli.ik dosyasr olacak sigorta primlerinin yatrp yatmadrgr vb konularla
idare bu dosyalafl her ay kontrol edilecektir.Bu bilgi ve belqele
verilecektir.
5- Bir sonraki giiniin iage tabelasrnda bulunan ttim yiyecek maddelerinin saat l5:00 de Muayene
komisyonu huzurunda haztr edilecektir.
6-yemek pigirilmesi ile ilgili olarak firma personelinin sosyal sigortalar Kurumu, Maliye, Belediye ve
diger meiciiere yaprlmasr gerekli beyan ve bildirimler ve bu husustaki Vergi, Resim ve Harg
mikellefiyet ve iorumluklar, buna ilaveten hata, noksan ve kusurlu iglemlerden dolayr hAsrl olacak
maddi ve manevi zarar ziyan ve tahakkuk edecek cezalann idare adrna tecilli edenlerde dihil, tazmini
ve ig kazasr ile ilgili sorumluluklarda firmaya ait olacaktlr. Firma_tarafindan karqrlanmayan cezai mali
sorumluluk idare iarafindan hak ediginden veya teminatrndan kesilir'
7-Yiiklenici, ilk iqe baqlayanlara hizmet igi epitim verecektir. Hizmet igi epitimin
ilki
s<izlegmenin
Ozellikle grda
bagladrlr ay olmak i-izeie 3 (tiE) ayda bi periyodik olarak tekarlanacaktrr.
i9i elitih
zehirlenmeleri, i99i sa$lllr u" ,9 [u-lurtn" karq,n io.uyucu dnlem aSnacak ve hizmet
verilecektir.
gtire
8- Yiiklenici igveren srfatryla gahgtrrdrpr tiim per;onelinin haklarrnr yiiriirliikteki 19 Kanununa.
ve
yaptrlm
miielryidelele
;iiz;;ietecekti;. Bununla ilgiti do[abilicek hei tiirlii hukuki sorumluluk,
uyartnca izne hak
[^rl,n,,'r1,utup yiiklenicidir] Yiikienici 4857 sayrll Kanunun 55 inci maddesi
[url""n iqiir".in izin haklarr igi aksatmayacak gekilde kullandrnlacak ve izin kullanan iqgiler fiilen
;;lt;;; t;;i sayrsrna dahil kabul edilece inden, izin kullanan iggilerin verine ba;ka isqi
getirilmeyecektir. Muayene yrlIrk iicretli izin,
haklarrnrn kullantlmastna iligkin olarak sdzle
Kanunun ilgili maddelerinde belirtilen hiikiimlere u
9-Hizmet alrmlarr kapsamtnda, yiiklenici biitiin
gekilde yiyip igmeleri, hastahklardan korunmalatt,
lnda yiiriirliikte olan ilgili mevzuat hiikiimlerlne
uymak zorundadtr.
i'O-Vti'f.f
."f
UU"yesinde gahgtrrdr!r iqgilerin yemek ihtiyaglartnt kargrlama sorumlululundadrr'
rasyonlaria b;.le;;n y"tun h^ttu ve ret-akatgi sayrlanna kendi personel 1VA.
"iH".iun. p".ron"li'ile
ryr iizerinden grkarrlacaktrr.Odeme ise yiiklenici firma personel saytst
kadar turnike ve rasyon toplamlarrndan diigiilerek yapllacaktlr'
l2-Yiiklenici idaren!n-n0!h414p--q.!gp4B
gekilde s0rekli olarak kurumda bulunduracaktrr'
$artnamesinde tanrmladrf, r
peisonelinden baqka kimse bulunmayacaktrr. Mutfakta g6revi olmayan firma
vb nedenle girmesi
,""r"ff"it mutfala girmeyecektir. Muifakta yaprlacak tadilat, bakrm --onartm
galoq ve bone ile girmeleri sallanacaktrr'
!.r"t"'n t i9lt". -uifuf so.umlusuna bildirildikten sonra
temin ettiEi teghizat ve ekipmantn sa,plam ve
ve
kendisinin
malzeme
edilen
i+- iaur. taraflndan teslim
y0kleniciye ait olacaktlr'. Hizmetin
giderilmesi
arlzalartntn
bulundurulmast,
i3- Mutfakta mutfak
.
falrqrr halde
yurJiurr.ti".r. idarenin koydu!u kurallara uyulmasr (dzellikle asansdrlerin itinal bir
vb
) gerekrnektedir YU-klenici her tiirlg demirbag malzerne, ekipman
zorundadtr'
korumak ve isin bitinrinde saplan ve galltlr vaziyette teslim etmek
'krltun,ln.,ur,
i;ir
Eekilde
sonuna kadar
i
Demirbaglarrn krrrlmasr, bozulmasr, ylpranmasl vb durumlarda ytiklenici firma aynr nitelik,
marka ve modelde malzemeyi temin edecektir. Aksi halde rayig bedel iizerinden tazminle miikelleftin
15- Her tiirlii arag-gerecin bakrm-onarrm idarenin kontroliinde ilgili demirbagrn yetkili servisige
yaptlnlacak, giderleri Yiiklenici tarafindan karprlanacaktrr. Mutfak ve yemekhanelerde kullanrl{n
idareye ait her ttirlii malzeme ve tesis (so[uk hava, et ve sebze depolan, buzdolaplan, mutfak ocaklair,
frrrn vb) ile mutfaga ait ti.im fiziksel alanlann, bakrm, onanmlarr her tiirlii sarf malzemesi (ampul,
musluk, conta, sifon, hortum vb.) sallanmasr Yiiklenici tarafindan yaprlacaktrr. Tiim giderler
:
yiikleniciye aittir
l6-Yijklenici mutfak ve yemekhanelerde hizmetin daha verimli yiiriiti.ilebilmesi bakrmrndan idarenln
onayrnr almak kaydlylayapmak istedigi kiigiik tadilatve tamirat masraflarrnr kendi kargrlayacaktrr. i
l7-Mutfak ve ofis rogar ve siizgeglerinde veya lavabolartnda meydarra gelen trkanrkltklarrn
giderilmesinden (en az iig ayda bir rogar bakrm ve gekim iginin yaprlmasrndan) yiiklenici firma
sorumlu olacaktrr.
l8-
Yemekten grkan yabancr madde igin tutulan tutanaklar Muayene komisyonu taraftndan
deferlendirilecek firmanrn hatah oldulu tespit edildili taktirde sdzleqme bedelinin % 0,01
lonbindebir; orantnda para cezast hak edigten kesilir.
i9-M"u"ut io[uk odalarrn bakrmr ve onarrmr ile rizmet satrn ahndrktan sonraki artzalan Yi.iklenici
tarafindan kargrlanacaktrr.
20- Ytikleniciye teslim edilmiq veya yuklenici tarafrndan temin edilecek olan kalibrasyon gereKiren
tiim cihazlali kalibrasyonlarr ve kontrolleri y0klenici tarafrndan yapttnlacaktrr. Gere[inde sunulmak
i.izere rapor halinde dosyalanacaktrr'
hizmetin daha iistiin bir seviyede verilmesi amacr ile ldarenin mutfalrna
yemek yaplm 1e dagrtrm igin kullanrlmak tizere malzeme ve ekipman yatrnmr yapabilecektir.
ygttenici tarafindan yapllacak malzeme ve ekipmanlartn siizlegmenin feshi ve / veya bitiminde yaprya
yiiklenici
zarar vermeyecek gelilie olanlan geri ahnabilecektir. Meydana gelebilecek zarar ve ziyan
2l- yti[lenici gerekti[inde
tarafindan tazmin edilebilecektir.
22-Yiiklenici firma hastane depo ve mutfalrnda sadece hastanede kullanacalr yemele ait malzemeyi
yeme!i hastane
depolamak ve pigirmekle yttitimltidtir. Yiiklenici hastane mutfagrnda pigirdipi
t
edemez
drgrndaki higbir kururn kurulug ve gahlslara satamaz, hibe
..
, . ve
-.
gekil
belirleyece$i
idarenin
z3'-Mutfak ve depolara girecek ve- grkacak her tiirlii malzeme tartrhp
(
finna da, digeri
saatlerde, rnutfak sorumlusunun bilgisi ddhilinde olacaktrr. Depolar gift kilit biri
malzeme girig 1tkt$t
t urOn" i.po"urunda olacaktrr ) ili a9rlp kapanacakttr. Firma bu sistemle
vaoabilecektir.
i4-H"rt"n"
idaresince onaylanmrq yemek listes
mutfak sorumlu di
r. Yemek listesinin
onbinde bir)'i ora
kesilecektir.
25- Yiiklenici idare tarafrndan bildirilen yerler drgrnda hi9 bir kimsenin makamtna yemek
g.itti,..y.."Ltir. Yemek salonlartna hastanede galrqan personel haricinde kimse alrnmayacak 1e
yemek verilmeyecektir.
26- Yiiklenici hastaneye
- verdipi her
ta.
gerg
Eir'
tiirlii
hasardan sorumludur. Hastanede, mutfakta, kat
ofisleri
lecek- her tiirlii kaza, yangtn, onarrm vs durumunda firma
ve
olay
en geg 15 giin iginde tadilatr bitirmek zorundadrr. Bu siirede firma herhangi
gekilde hizmetin devamlth[rnt hastane dlgrnda bir mutfakta yemeklqri
Firma bunun igin idareden ek bir iicret talep edemez. ortaya grkan aksaklrk
hazrrlatarak sallayacaktrr.
-giierilmezse
idare tadilatr Hizmet igleri Genel $artnarnesi hiiktimlerine gOre, iigiincii
l5 giin iqinde
kiqilere yaptrrrp bedelrni hak edigten kesecektir'
zi- y"."rte., kliniklerde diyei hastalara ve nonnal yemek alan hastalara tabldot servis tepsisi ile,
ise self-servis tepsilerde,
lrasta odalarrna kadar; hastane gahganlarrnrn yemek yedipi yemekhanelerde
nedeki birimlerde Muayene
potr"f"n tabaklarla selfservis sistemi ile
tek kullanrmhk tabldot) yemek
ile gerekli g6riilen biriml
kon'lryonunun kararr
verilecektir. Masalarda temiz tjrtiilir,
ekmek bulunduru lacaktrr.
baharathk,
iler,pegetelikler,yeterli miktarda
2E- Yiiklenici dr9 klinik ve yemekhanelere yemeli hijyenik Frtlara uygun olarak, dOktilme, srzrnh
olmaksrzrn tagrnmasrnl; srcak yemeklerin srcak, iofiuk yemeklerin soluk bir gekilde dalrtrlmasrlrr
sa$layacaktrr. Gerekli eleman, yol masrafi vb. giderlerden yiiklenici firma sorumludur. Hastanemize
ball Zafer Semt Poliklini!i, Psikiyatri ve Amatem klinikleri igin:
Zafer Semt Poliklinili, Psikiyatri klinipi ve Amatem-kahvaltr-dfle yemefi-akqam yeme$idiyet yerne[i verilecektir. Yukanda belirtilen dalrtrm yerlerine araba iginde rsr muhafazall kaplar{a
kapaI olarak nakli, hastalara dagrtrmr ve toplanmasl ve sonrasr iqler yiiklenici tarafindan yaprlacaktrr.i
29- Nobetgi personele bir riltin normal kahvaltr sayrlarak aynl gegitte (ekmek ve gay hariq 3 9e9iQ gece
kahvaltrsr
verilecektir.
:
30- Kahvaltr ve yemek saatleri idare tarafindan firmaya bildirilir. Gerektilinde hastane idaresi yemgk
saatlerinde deligiklik yapabilir. Servis saatleri: sabah 06.30- 07.30; dlle I 1.30- 13.30; akgam 17.30r18.30 Diyet ve ara dgiin yemekleri ve dalrtrm saatlerini klinik diyetisyenleri belirleyecektir. Dagthml
yaprlacak kahvaltrlrklar ve yemekler dalttrm saatinden Once haztr bulundurulacaktr.
31- Firma her birey igin yeterli sayrda ( bir 6$iin igin en az 50 gr )ve ekmeli tedarik etmelidir. Hastane
beslenme ve diyet birimi gerekli giirdiilii takdirde ekmek gramajtnr artrracak ve bunun igin firma 9k
Ucret talep etmeyecektir.
32- Sebze ve meyveler klor bazh sebze ve meyve dezenfektanr kullanrlarak gok iyi bir
qekilCe
yrkanacaktrr.
33- Krzartmada kullanrlan ya$ar her yemek igin ayrr ayrr ve bir kez kullanrlacakttr Kullanrlmrq yallar
ytiklenici tarafrndan atrk ya! toplayan firmalara verilecektir. Gerektili zaman idare taraftndan kontrill
edilecektir.
34- Kahvaltrhk ve yemeklerde kullanrlan her tiirlti grda maddesi veya iiriin, ambalajh olarak temin
edilecek; iirune ait ambalaj iizerindeki etiket bilgileri Tiirk Grda Kodeksi Etiketleme Tebliline uygun
I
ve Grda, Tartm ve Hayvancrhk Bakanlrlr iiretimlzin onayt bulunacaktlrgramajlarlna
uygull
35- Hazrrlanacak yerneklerde kullanrlacak malzemelerin geqit ve miktarlarr yemek
yazrlan miktar
olacaktrr. Yazrm hatasr veya yemefin yaprhgr ile baldaglagmayacak gekilde sehven
yemek
malzemesi
gramaj
tizerinden
haarlayacalt
ait
sorumlu diyetiiyenin o-y"..g"
oldu[unda
ku llanrlacaktrr. Firma buna gdre yemek
pigirilmesini saglayacaktrr
36- Grda maddeleri grdu wsaflarr bdltimi.inde belirtilen dzellikleri tagryaca[r gibi evsafi olmayan
iiriinler igin TSE velveya Grda Maddeleri Ttiztigiine uygunluk aranacakttr'
kaplarda olacak gekilde
SZ- Giinlgk gtkan yem;klerin her birinden tirnik alrnarak her bir yemek ayn
Y0klenici' sunuqa
ijzerine gun tarlh yaztlarak 72 saat, uygun yerde , + 4oc'de muhafaza edilecektir.
Firma grda
edecektir..
poget)
temin
kaplarrn(kilitli
nur,, y"i.t nu.unesi miktarr kadar stiril numune
e[itimintn
i9i
hizmet
personelin
ve
zehirlenmelerine kar$ln koruyucu dnlemleri almak, uygulamak
(besrn
durumda
bir
olasr
Herhangi
yetkili kigiler tarafindan yaprlmasrnr temin etmek zorundadtr.
zehirlenmesi, ishallerde l5 kigi ve iizeri sayrdaki
bakteriyolojik, kimyasal yiinden kontrol ettirilece
malzemelerden tirnek alrnarak mutfak sorumlu di
kargtlanacakttr. Herhangi bir glda zehirlenmest
Yiiklenicinin kusurlanndan kaynaklandr!r tespit
cektir.
alan kigiler oldulu takdirde, bu kigilerin her tiidii
raporu
zehirlenmesi
besin
tasdikli
Kurumda, hekim
ve ziyanrn bedeli Yiikllnici tarafrndan karg tlanacakttr. Zehirlenme vakastntn
,"J""i g;A*i ile kayrp'durumunda
ilgililer hakkrnda yasal iglemler bailatrlacagr gibi maldur olanlarrn
titrirt"-ronuglun.asr
her tiirlii maddi ve manevr tazirinat talepleri yasal gergeve igerisinde Yifklenici tarafindan
kargrlanacaktrr.
malzeme
38-Viiktenici depolarda apzt r9k, yerde ve diizensiz bir gekilde istiflenmig ve etiketsiz
bulundu.ruy""u[trr. Ayrrci grda maddeleri ile temizlik malzemelerini bir arada bulundurmayacaktlrr
39- Normal ve diyet yemeklerinin da[rtrldrit k
yemepin porsiyon miktarr ile aynl olacak ve her y
40- Yiiklenici Cumartesi, Pazar ile resmi ve dini
yemek, ara o$iin, diyet yemeli hazrrlanmasr ile
ncibetgi personelin yemekleri haztrlantp servis
belirledi!i esaslar dofrultusunda yaptlacakttr.
t0
41- Mutfaklarda her cihazrn kullanrm talimatr, gartel, vana, vb. igin ikazlar, uyartcr agtklarnalar ve igin
yiiriitii lmesindeki uygulama yontemleri (prosediir) yazrlmah ve gciriilebilecek yerlere astlmalrdrr.
42- Yiiklenici, qalrgma anrnda titregim olugturabilecek makinelerin zemine baglantrsrnt titrefini
rinleyecek gekilde olmasrnr saplayacaktrr.
i
43- Hizrnetin ifasrnda kullanrlan elektri( su ve do rlgaz sarfiryatr; Yiiklenici firma tarafindan takrrrlacak
stizme sayaglarla belirlenecek ve hastanenin ahg fiyatlarr iizerinden (KDV daliD Miiteahhidin ayltk htik
ediginden kesilecektir. Diler yerlerde kullanrlacak LFG, miiteahhit firma tarafrndan saflanacakt'r. .
44-'Mutfak igerisinde fullanllan taglma arabalan drg ortam4 drgarrda kullanrlan arabalar mutfi.k
igerisine kesinlikle tagrnmayacaktt.. S"bz", meyve ve kirli, klrrk, gatlak kasalar mutfak igine
girmeyecektir.
t
S6""k ve hagerelere kargr ilaglama; Yiiklenici biicek, sinek, hagereler ve kemirgenlerle (fare, keti
vb) ilgili her tiirlii onlemi almak zorundadrr. Halk Salhlr Alanrnda Hagerelere Kargr llaglama Usul ve
Esaslarr Hakkrnda Y6netmeliEe uygun olarak gergeklegtirilecektir. Ytiklenicinin Halk Sa[lt!t
Alanrnda Hagerelere Kargr ilag Uygulama izin Belgesine sahip olmast durumunda ilaglama yi.iklenici
tarafrndan; bu izin belgesine sahip olmamasr durumunda ise ahnan izin belgesine sahip olanlara
yaptr rrlacaktrr. Mutfakta, ayda bir kez usuliine uygun olarak ilaglama yaprlacakttr. Bu siire daha erken
ilaqlama ihtiyacr dolmasr halinde krsa ltr labilecek olup, bu konuda Muayene Komisyonu yetkili
+S-
olacaktrr.
46- Yiiklenici mutfakta yangrn ile tlgili yctnetmelikler gergevesinde mutfak, yemekhane, depolar ve
kendisine teslim edilen tiim galr$ma alanlannda gerekli dnlemleri almak zorundadtr. Bu gergevede
idare ile iqbirlili iginde olacaktrr. Bu 6nlemler dahilinde kullanrlan LPG tiiplerinde gaz kesiciler; LPG
gaz detektdrleri; Yangrn fiskiye sistemi; elektrikli aletlerin kablolarrntn uluslar arast ve ulusal
kriterlere uygun olmasr vs. pek 9ok konuda tam ve eksiksiz olarak uygun olmah ve siirekli
denetlenmelidir.
47- Kalite ve denetim uygulamalarr hastane kalite denetim birimi tarafrndan siirdiiriiliir. Yiiklenici
kalite biriminin prosediirleri do$rultusunda davranacaktlr.
48-idare yiyeceklerin ambara veya mutfaga ahnmasrndan, gdplerin ortadan kaldtrllmastna kadar ttiln
agamalarja yiikleniciyi denetlei do[ru iulmadrlr konuia-rda diizeltilmesi igin Ytikleniciyi uyar?r.
Yiiklenici uyarrldr$r konularda derhal sorunu gidermekle yiikiimliidiir.
49-yiikleni;i firma personeli, Hastanede gordiilu duydu!u, gahit oldu[u hadiselere ve hasta
mahremiyetine sadrk kalacak ve srr saklar olacaktrr. Bu hususta yalnrz hastane idaresini haberdar
edecektir.
SO-Teknik gartnamede belirtilen hususlann yerine getirilmemesi veya eksik i9 yaptlmast
durumunda eksik yapllan ii tutanakla tespit ;dilir. Tutanak mutfak sorumlusu ve muayene
komisyonunca yiiklenici yetkilisinin adr soyadr, unvanlart, tarih ve saat belirtilerqk
imzalanacaktrr. iiiklenici yetkilisinin cezai konuya iligkin agrklamasl mevcutsa kNaca tutanakta
belirtilebilir. Yiiklenici yetkilisinin imzadan imtina etmesi halinde bu durum tutanakta ytklenici
yetkilisinin imzadan imtina ettigi belirtilerek aynen iqleme konulacaktrr. Bu hususlarda hizmet
igleri genel Sartnamesinin ilgili hiikiimleri uygulanacak olup siizlegmeye aykrrrhklarla ilgili cezai
miieyyide olarak gartnamede belirtilen yaptlrlmlar uygulanacakhr.
8,MUTFAK VE YEMEKHANE HiZMETLERi YARDIMCI MALZEME iHTiYAC LiSTESi:
t
yiiklenici hastanemiz mutfalrnda vereceli hizmetin, saphk, hijyen, kalite bakrmrndan ve diy'et
mutfalrnrn dgzenli olarak iqlemesinin sallanmasrndan sorumludur. Hizmetin yiirlitiilmesi esnaslnda
seruis ue sonrasr hizmetler haStane Muayene komisyonun giizetimi ve kontroliinde olacaktrr'
Srizlesmeniu imzalanmasrnr rnliteakip gerek hastaneye ait, gerekse yiiklenici taraftndan sa[lanmasr
gereken denrirbag ve diler malzemeler i$e baqlamadan en geg l0( on) il giinii igerisinde; mligterekc'n
fontrol edilerek bir tutanakla igyerine teslim edilecektir. Yuklenici firma ise baslarken )'emek pisirnlg
. Hastane
arag-gereglgr
idaresinin ytikleniciye saflam ve gah$rr vaziyette teslim ettili demirbag ve makineler,
ihale sUresinin bitiminde eksiksiz, tam ve gahqrr vaziyette yUklenici tarafindan hastane idaresine teslitn
edilecektir. Aksi halde rayig bedel iizerinden tazminle mtikelleftir. Malzemelerin baktm-onartm
sorumlulugu ve bu yolda yaprlacak masraflar Yiiklenici Firma tarafrndan karsllanacakttr.
1l
Yiiklenici Firma hizmetin daha iistiin bir seviyede verilmesi amact ile mutfak, yemekhane ve
klinik ofislerinde kullanrlmak iizere agaSrda vasrflan ve teknik 6zellikleri belirtilmig olan cins ve
miktardaki demirbag malzemeyi ige baglama tarihinden l0 gtin Once teslim etmek
"Yaplm ve Dalrtrh. Hizmetleiiride- kullanrlmak iizere Y0klenici
I{asthnemiz Yemek
istenmekte olan bu malzemeler stizlegmenin sona ermesini mtiteakip geri alabilecektir.
S.NO
MALZEME ADI
EBAT (cm)
MiKTAR
BiRiM
9
AD.
90*3 0
8
AD.
HELVANE TENCERE
80*30
12
AD.
4.
HELVANE TENCERE
40*17
o
AD.
5.
QiFT METAL SAPLI TAVA
80*16
o
AD.
2
AD.
4
AD.
I
AD.
2
AD.
2
AD.
l6
o
AD.
12. CELIK MAKARNA SUZGECI
60*14
4
AD.
CELiK MAKARNA SUZGECi
45+ 12
2
AD.
80
AD
80
ADI
4
AD
l.
HELVANE TENCERE
I l0+3
)
HELVANE TENCERE
,|
6.
(KAPAKLI)
qiFT METAL SAPLI TAVA
(KAPAKLI)
7.
DOVME ALUMINYUM KIZARTMA
TAVASI
8.
BICAK BILEME MOTORU
9.
HASSAS TERAZi (CEKERI 5 KG,
HASSASIYET I GR.)
r0. ELETRONIK KANTAR
ll.
13.
QELiK MAKARNA SUZGECI
KAPAKLI FIRIN
14. TEPSiSi(KU LLAN ILACAK FIRINA
UYGUN EBATLARDA)
KAPAKLI FIRIN
15, TEPSIS(KULLANILACAK FIRINA
UYGUN EBATLARDA)
TEPSi TOPLAMA ARABASI
16.
(finn tepsi ebatlanna uygun )
5
80*16
5 KG.
5OO
KG
qEKERLI
80*
t8-10 KROM
QELIK- ls cM
DERINLiKTE
l8-10 KROM
QELiK- 5 CM
DERiNLiKTE
17. TENCERE FRiTOZ TELi
90*35
4
AD.
TAVA FRITOZ TELJ
80+16
3
AD.
18.
r
I
T
12
(SIK)
o30
6
AD.
20. TEL KEVGIR (SIK)
o25
6
AD.
21, TEL KEVGIR (SIK)
o20
o
AD.
.,1
TAKViYELi SUT SUZGECI
@16
5
AD.
23. TAKV|YELI SUT SUZGECi
422
5
AD.
24. TAKVffELi SUT SUZGECi
@30
5
AD.
25. CELiK KEPqE
NO:2
40
AD.
26. 9ELIK KEPqE
NO:3
60
AD.
7',f
QELIK KEPCE
NO:4
l0
AD.
28. QELIK KEPQE
NO:6
6
AD.
29. gELIK KEPQE
NO:8
6
AD. i
30. QELIK KEPQE
NO: 10
6
AD.
31.
CELiKKEVGiR
NO:2
40
AD.
32. QELiK KEVGiR
NO:3
60
AD, .
33. QELiK KEVGIR
NO:4
l0
AD.
34, QELiK KEVGiR
NO:6
6
AD.
35. QELIKKEVGIR
NO:
8
AD,
19. TEL KEVGIR
8
.
I
36. CELIK KEVGIR
NO: l0
l0
AD.
37. ALUIVIiNNJM SAPLI 9IRPMA TELi
100 cm
30
AD.
38. ALUMINYUM SAPLI gIRPMA TELI
80 cm
l)
AD.
39. ALUMINYUM SAPLI QIRPMA TELi
60 cm
6
AD. .
40.
ALUMiNYUM SAPLI 9IRPMA TELi
40 cm
6
AD.
41.
ALUMiNYUM SAPLI CIRPMA TELI
20 cm
6
AD.
t
!
13
42. SERViS
qATALI
t0
AD.
43. SERVIS
KA$I6[ (DUZ)
l0
AD
44. SERViS KA$IGI (DELIKLD
l5
AD.
45. SERVIS SPATULASI (DUZ)
40
AD
40
ADi
46. SERViS SPATULASI
(DELiKLi)
47.
MA$A (MAKARNA & SALATA)
40
AD.
4E.
MA$A (PASTA-BOREK)
40
AD.
l5
AD.
20
AD.
49. MA$A (SERVIS)
50.
qAY OTOMATI (ELEKTRiKLI)
23
LT.
51. PASLANMAZ SERVIS ARABASI
2 KATLI
20
AD.
YUK TASIMA ARABASI (PLATFORM
ARABA)
KAPAKLI GN KUVET (YEMEK
53.
DAGITIMI iqiN)
TABLA
t20460
tt
AD.
(t
300
AD
f,tr.
KURDANLIK
300
AD
56.
EKMEKLIK
300
AD
/.
58.
BULA$IK YIKAMA MAKINASI
(Dijital gdstergeli, cift motorlu)
BULA$IK YIKAMA MAKiNASI (girig
grkr$ tezgahh, Dij ital gtistergeli, cift
motorlu)
:'
YETERLi
MIKTARDA
54. MASA ORTUSU
f,
.
l5
1000 TB /h
ADr
AD.
2000 Tb/h
KONVEYORLU KURUTMALI
AD. .
59. THERMO BOX (YEMEK
NAKIL)
t0
60. SELFORM TEPSI 37-53
KAYMAZ
2000
AD.
61. PORSELEN JOKER KASE
O12cm
3500
AD.
62. PORSELEN DUZ TABAK
O19cm
3
500
AD.
O20cm
3500
AD.
63. PORSELEN
qUKUR TABAK
J
14
Krrrlmaz plastik
64. TABLDOT YEMEK TABAGI 5 GOZL'O
65.
selfservis
taba!t(yeni
TUZLUK BiBERLIK TAKIMI
66. CAM SURAHi(2lt)
67. QATAL
IE-IOKROMQELIK
1800
AD
300
AD.
300
AD
2000
AD
68.
KA$IK IE-IO KROM QELIK
2000
AD.
69.
BIqAK I8_IO KROM QELIK
2000
AD.
POLIETiLEN KESiM LEVHASI
70. (BEYAZ)
3
0*60*
5
t2
AD.
71. MASAT (YASSI)
30 cm
3
AD.
1.,
30 cm
3
AD.
NO:2
2
AD.
NO:3
2
AD.
/s. PASLANMAZ OYACAK
25
AD.
76, PASLANMAZ SOYACAK
25
AD.
77. PASLANMAZ KONSERVE AQACAGI
l0
AD.
MASAT(YUVARLAK)
PASLANMAZ SATIR (PLASTIK
73.
SAPLI)
PASLANMAZ SATIR (PLASTIK
74, SA PI
I\
1
BIqA6I (PLASTIK SAPLD
NO:5
5
AD.
79, ET BIQA6I (PLASTiK SAPLI)
NO:3
l0
AD,
BIQACI (PLASTiK SAPLI)
NO: I
r0
AD.
El. SEBZE BIqAGI (PLASTiK SAPLD
NO:3
40
AD.
E2. SEBZE BICAGI (PLASTiK SAPLI)
NO:2
20
AD.
NO:
20
AD.
40*40
7
AD,
NO:3
2
AD.
78. ET
E0. ET
83. SEBZE BICAGI
84. YEMEK
(PLASTiK SAPLI)
TA$IMA KABI (TABANSIZ)
85, ET DOvEcEGi (PiRiNQ)
r
I
1
15
86. SPATULA (PASLANMAZ)
NO:
I
t0
AD.
87. SPATULA (PASLANMAZ)
NO:
3
10
AD.
l0
AD.
89. SERViS KUREGi
20
AD.
90. PASLANMAZ ELEK
J
AD.
3
AD.
88. BOREK
BIQA6I
91. PASLANMAZ
KALBUR
92.
MUTFAK ROBOTU (DIYET
MUTFAGD
93.
qELIK RAF
AD.
YETERLi
MIKTARDA
YETERLI
MiKTARDA
94. qALI$MA TEZCAHI
95.
BO$ TEPSI TOPLAMA ARABASI
(selform tepsiler igin)
l5 raflr 60 adet
tepsi kapasiteli
t)
9E.
YEMEK DAGITIM ARABASI (elektrik
rsrtmah) diyet yemekleri igin
6
AD
YEMEK DAGITIM ARABASI (elektrik
l)
AD.
4
AD.
4
AD
20
AD.
rsrtmalr)
99. EV TiPi TENCERE
100
YEMEK DAGITIM UNiTESi
(BENMARI)
101 TEPSI
TASIMA ARABASI
102
PATATES SOYMA MAKINASI
kglh kapasiteli)
103
ET KIYMA MAKINESi
104
KAZAN TA$IMA ARABASI SARHO$
TEKERLEKLI
106 ROBOT
(2OO
AD
AD
6
AD
lt kapasiteli)
AD
SANAYI TiPi
AD
105 Mikser (25
AD.
l0? RASYON-IASE PROGRAMI
108
AD
YETERLI
MIKTARDA
96. PLASTIK PALET
97.
I
PROBTHERMOMETRE
4
AD,
l6
I
HiGROMETRE
5
r10 SU BARDAGI (CAM)
2OO
1ll
PANELVAN MiNiBUS(yemek tagrma
igin dizayn edilmig, 2008 model ve iistii)
tt2
STREC FiLM SARMA MAKINASI
GR'LIK
800
AD.
:
AD.
AD
l13 PLASTiK QOP KOVASI
il4
YER TEMiZLEME ROBOTU ($AzuLI)
ll5
TUPLU FIRIN
ll6
DISPENSER PECETELIK
3
AD
20
AD
AD
2
AD
300
AD
t
Yiiklenici firma igin gere[ine uygun, TSE vb. uluslar arasr kabul gdrmiig bir kuruluqtan
almm15 i..iretim standardr veya kalite belgesine haiz olacak makine ve ekipmanr getirecektir.
korunarak bulunduracaktrr'
g,GIDA MALZEMELERi Vf, HiZMETiN DENETiMi
Yemeklerde kullanrlacak malzemeler ytiklenici tarafindan sa!,lanacak, idarenin olugturacait
bir muayene komisyonu tarafindan teknik gartnamede yer alan evsaflara gtire denetlenerek uygin
olanlar ahnacak, uygun olmayan malzemeler geri gonderilerek yerine uygun malzeme aynl glin mesal
saati igerisinde temin edilecektir. Yemeklerde kullanrlacak malzemelerin tiimU hastane idaresinin
gdrevlendirece[i kigi veya kigilerin iginde oldulu bir komisyonca depolardan grkartrlacak ve mutfaga
teslim edifecektir. Hazrrlanan qiparig ve depo girig, grkrg formu diyetisyene verilecektir. Et meyve ve
sebze allmr bir giin onceden en geg saat 10.00 a kadar ahnacaktrr. Cuma giini.i en geg saat 11.00 da
cumartesi, pazar, pazartesinin erzakr gelecektir. Komisyonca kabul edilmeyen malzemeler hastane
deposunda bekletilmeyecektir.
Hizmet alanlalna idarece belirlenecek saatler drgrnda yiyecek malzemeleri giriq ve grkrqlasrr
yaprlmayacaktrr. Artan yemekler higbir gekilde ertesi gtin servise sunulmayacaktlr. Yiiklenici
tarafrndan haztlanan yemekler piqirilme ve sunulma srrasrnda diyetisyen tarafrndan denetlenecektir.
Yemekler kalite konrolii tille yemepi igin en geg 10.30 akqam igin 16.00 da yaprlacaktir.
Yemekler rat, renk, koku, gciriintii, srcakhk gibi nitelik ve nicelik bakrmrndan kalitesi servise uygun
olmadrlr takdirde en az egdeler veya iistii yemek o dliine yetigecek qekilde ytiklenici tarafindan temin
edilecektir.
Alrnan grda rnalzemelerinin soluk hava depolarrnda bekletilme siireleri apaprda
Malzeme
Et
Tavuk, hindi
Bahk
Pastiirize siit, yogurt, ayran
Peynir tuzsuz
belirtilmigtir
.r
sofuk hava deposu
3-4 giin
l-2
giin
I
I
giin
giin
I -2 giin
t
17
Peyn
3-4 giin
ir
Yumurta
l4 giin
Sebze-meyve
1
giin
-l C ila +4 C derecede, dondurulmug iiriinler -18 derecede, di[er grda
malzemeleri +4 kuru grdalar +15 C derecede muhafaza edilmelidir
Et, tavuk, balrk, hindi
i
l
Pigirme
Yemeklerin pigirilmesi Konya Egitim ve Ara$trrma Hastanesi mutfaglnda burada olmast sorun
olrmu gergeklegtirilecektir. Olapaniistti durumlarda yi.ikleniciye ait iqyerinde haztrlanrp getirilecek
kahvaftr ve yemekler veya hanr tatlrlar igin yOnetim onayr altnacak ve diyetisyen tarafindan
denetlenecektir.
Elle hazrrlanan kctfte, dolma vb. yemeklerde aqgrlar mutlaka eldiven kullanacaktrr'
Haztrlama, tiim pi$irme ve ta$rma hizmetlerinde kullanrlan malzemeler TSE standartlarrna
uygun paslanmaz gelikten iiretilmig olacaktrr. Oglen ve akgam yemekleri saatinden Once dagrtrma
hazrr olacak gekilde mutfakta pi$irilmig olacaktrr.
Tagrma ve
Dallttm
Pigirilen yemekler hastaDe yemekhane ve hastane idaresinin belirledi!i dalrtrm yerlerindeki
yemek ofislerine rsryr r.lzun siire muhafaza eden dokUlmeyi <inleyen ve lsl iireten kapah arabalarla gelik
kaplarla y0klenici personeli tarafrndan tagrnacaktrr. Yemekhanede yemek servisi selfron servis tepsiler
iizerinde porselen tabaklarla yaprlacaktrr servislerde ise tabldot yemek tabalr ile servis yaprlacaktr.
Krrrk ve Qatlak malzeme ku llan rlmayacaktrr. Yemekhanede kullanrlacak tepsilerin iizerine her tepsiye
konacak gekilde tepsi boyutunda kilrt konulacaktrr, gatal ka$rk brgak kalrtla servis edilecektir. Bu
aletler ve malzemeler yiiklenici tarafindan temin edilecektir.
Yemelin pigirilip hazrrlanmasr, ilgililere servis ve servis sonrasr hizmetlerde hijyenik gartlara
uyulmasr yiiklenici tarafindan sallantr. Bu konuda sorumluluk yiiklenicinindir.
intaniye sewisi, yolun bakrm, acil servis, hasta gdzlem odalarlndaki hastalara ve
gririilen hastalara ve personele yemek sunumu tek kullanrmhk gay kagr[r, bardak,
uygun
diyetisyence
geffaf gatal, kagtk, brgak ve kopiik tabaklarda yaprlacaktrr. Bu malzemeler yiiklenici firma
!
tarafindan kargllanacakttr'
personel
ve
gereken
hallerde
verilmesi
Hasta ve personel yemelinin normal yemek saatinin drgrnda
hastaya yemefin srcak olarak ulagmasl satlanacaktrr.
Temizlik
Yiiklenici kullandrlr tiim mekinlann temizlifinden sorumludur. Mutfak, yemekhane ve
ofisferin her turlti temizligi yiikleniciye aittir. Bu bciliimlerde ayda en az d6rt genel temizlik (fayans,
dolap, evye, davlumbaz vb.) yaprlacak, uygun temizlik iiriinleri, (ya[ gdzUcii, kireg goziicii vb.)
kullanrlacak lrer tiirlii temizlik malzemesi, salhk ve hijyen kurallartna uygun rizellikte olacakt[.
Yeterli sayrda remiz ve dijzgiin, kenarlarr dikigli veya overloklu temizlik bezleri, ternizlik iglerinde
kullanrlabilecek tiim arag geregler eksiksiz olacaktrr.
Yemek servislerinde sonra yemekhane, mutfak ve ofislerde olugan giipler biriktirilmeden
hastane idaresini belirledifii yere a$tzlart ba[lanarak ddktilecektir. Ytiklenici yemekhane, mutfak ve
ofislerde tuvalet ve lavabolara srvr sabunluk takacak, iginde siirekli dezenfektanlt stvt sabun ve
yanrnda dispanser havlu kilrt bulunduracakttr.
Temizlik hastane ydnetiminin belirledili program gergevesindo ve onaytnt alan TSE'ye uygun
malzemelerle yapllacakttr.
Yiiklenici yemek yaptml ve sonrasl temizlikte kullanllan her tiirlii temizlik malzemesini (
idarenin kabul edeceli gekilde ) kendisi temin edecektir. Yiiklenici kullandtpt mekanlartn ve
kaplarrn her ttirlii temizliIini hijyenik koqullara uygun olarak kendisi yapacaktrr'
18
1-Mutfak temizlifi:
Yer, duvar ve koridor temizliEi:
:
Giinliik Temizlik: Gi.inliik kullanrlan her tiirlii alet ve teghizat srcak, deterjanh su ile yrkanrp yerlerine
kaldrrrlacak, kullanrlan et kiittigii, tezgdh v.b. yerler ig bittikten hemen sonra temizlenecektir Et kiittigii
temizlendikten sonra dezenfektan maddelerle korunacak, yer ve koridorlar giinde ii9 kez srcak
deterjanlr sularla temizlenecektir. Qok kirli ve yallr bOlgeler alrr kir ve ya! g0ziicii maddelerle
tem izlenecektir. Sebzelerin ayrklanmasr ve temizlili gtip kovalartna yaprlacak, temizlenmig sebzelbr
pigirme agamasrna kadar gelik kaplarda tutulacakhr. Sebze yrkama evyelerinin, el yrkanan lavabolartn,
tuvalet, banyo ve soyunma odalartntn dezenfektan maddelerle temizlili yaprlacaktrr. Mutfala
giriglerde galoq kullanr
lacaktlr.
t
Avhk Temizlik: Davlumbazlartn alrr kir ve yag gdziicii maddelerle temizlisi, havalandrnpa
sistemlerinin temizlili, bdcek ve hagerelere kargr ilaglama mutfakta, ayda iki kez usuliine uygun olarak
ilaglama yaprlacaktrr. Bu si.ire daha erken ilaglama ihtiyacr dolmasr halinde krsaltr labilecek olup bu
konuda hastane idaresi yetkili olacaktrr.
2-Grda ve so!uk hava deposu:
Giinliik temizlik: Askr, tezgrih ve yerlerin temizli!i, depolartn tst ayarlartntn kontrol[i
Haftahk ternizlik: Duvarlar, kaprlar ve di[er yerlerin temizliIi,
Avhk temizlik: Kuru gtda depolanntn ilaglanmasr ve sonunda raf, dolap ve yerlerin temizli$i.
Grda deposunda ayda bir usultine uygun olarak ilaglama yaprlacaktrr. Bu siire daha erken ilaglama
ihtiyacr do[masr halinde krsaltrlabilecek olup bu konuda hastane idaresi yetkili olacakttr.
Piqirme sistemi:
Giinliik temizlik: Kuzine ve islimlerin igi bittikten sonra temizlili, et kryma makinesi, sebze do$ama
makineleri, tulumba makinesi ve diler makineler igi bittikten sonra temizlenip muhafazalarryla
kapatrlmasr. Frnnlann kullanrldrktan sonra aprr kir ve ya! gcizticiilerle temizli!i.
Ilaftahk temizlik: Sdz konusu alet ve makinelerin derinliline temizliIi yaprlacaktlr.
Ayhk temizfik: Havalandrrma sisteminin ve davlumbazlarnlemizlip,i yaptlacaktrr.
3-Yemekhane ve koridorlar:
Giinliik temizlik: Bankolarrn, bulaqrk hanelerin,
lavabolarrn
ve yerlerin temizlili
yaprlacaktrr.
Kirlenen masa tirtiileri temiziyle deligtirilecektir.
Haftahk temizlik: Masa ve sandalyelerin deterjanh su ile silinmesi. Su sogutuculannrn iglerinin ve
drgrnrn temizli[i, camlarrn silinmesi, siirahi, bardak, gatal, kagrk, yemek tabaklannrn dezenfektan
maddeleriyle temizlenip durulanacaktrr. Masa iistiindeki tuzluk, pegetelik v.b. malzemelerin temizli[i
yaprlacaktrr. Kirli veya temiz ayrrt etmeden tiim masa rirtiilerinin yrkanacaktrr.
Avhk temizlik: Duvarlartn ve yerlerin temizlenmesi ve gereken hallerde ilaglama yaptlmasr.
Yemekhane ve koridorlarda ayda bir usultine uygun olarak ilaglama yaprlacaktlr. Bu siire daha erken
ilaglama ihtiyacr do[masr halinde krsaltrlabilecek olup bu konuda hastane idaresi yetkili olacaktrr.
TO.GENEL
HUKUMLER
Bulundu$u birimlerde yemek yemesi idare tarafindan gerekli gdriilen personel sayrsr resnri
yazrlarla belirlenecek ve bu kiqilere bulunduklarr yerde servis edilecektir. Istihkakr olmayanlarln
yemek yemesi ile istihkakr olanlara da yemek kalmamasr gibi bir durum olugturulmayacaktrr. Bu
durum Yiiklenicinin ikazrnr gerektiren bir kusurdur.
Yiiklenici, hastane Diyetisyenlerin in *BiRiNCi KAP YEMEKLERiN ONBES GUNLUK
YEMEK LiSTELERiNDE VERiLME SIKLIGI' nda belirtilen kurallara uygun olarak hazrrladr[r
yemek listelerini aynen uygulayacaktrr. Yiiklenici y<inetimce onaylanan kahvaltr, yemek listesine gdre
belirtilen gartlarda temin edeceli grda maddelerinin, kahvaltr, yemek ve diyet yemekleri, ara Ogiinler
geklinde hazrrlanrnastnr sallar.
l9
BiRiNCi KAP YEMEKLERN ONBE$ GUNLUK YEMEK LiSTELERiNDE VERiLME SIKLICII
I. PARqA ETLI YEMEKLER
2 ADET
2.KEBAPLAR
4 ADET
3,KOFTELER
6ADET +
4.TAVUK, BALIK, CiGER YEMEKLERI
7 ADET
5.ETLi KURU BAKLACiL YEMEKLERi
4 ADET
6.ETLI SEBZE YEMEKLERi
7 ADET
Yernek esnasrnda kullanrlacak ekmek, krrmrzr pul biber, karabiber, natre, sumak. kiirdan, rslak
rnendil, tuz, karanfil, pegete vs. yiiklenici taraftndan ka rg rlanacakttr.
Yemekler kalite nefaset ve gramaj ydniinden doyurucu olacak ve gramajlar YEMEK
CRAMAJ LiSTELERiN'DE belirtilen gramajdan az olmayacakttr.
Hazrrlanan yemek, kahvaltr ve diyet yemekleri renk, krvam, koku ve tat baktmrndan istenen nitelikte
olacaktlr. Srcak yemekler srcak, soluk yemekler ise uygun rsrda servis yaptlacaktrr. Yiiklenici servts
sonrasr olugan kirli kaplar ve yemek artrklarrnrn toplanrp bulagrklartn ytkanma igini yapar ve arttklarr
sorumlu birimlerle koordinasyon sa$layrp; gdpiin akmastnl ve goriinmesini 6nleyecek po$etler iginde
giip toplama merkezine ulagtrnr; Ytlklenici curnartesi;-Pazar ile resmi tatiller ( millive dini bayamlllD dahil olmak iizere higbir sebeple yemek, kahvaltr, diyet yemeli hazrrlanmasr ve sunulmasr igini
aksatmaz. B6yle giinlerde de hasta ve refakatgiler ve n<ibetgi personelin yemeklerinin haztrlanrp
servisi ve servis sonrasr hizmetleri yaprlacaktrr. Ramazan aytnda orug tutanlar igin iftar ve sahur
yemegi verilecektir. iftariyelik olarak hurma(20gr) ilave edilecektir. Ramazan ayI boyunca iftar
yemekleri 4 kap yemek olarak verilecektir. Ramazan ayr boyunca sahurda 2 gegir yemek + kahvaltr
olarak verilecektir. Qegit eklenmesi ile ilgili yiiklenici ayrrca iJcret talebinde bulunanaz. Ramazan ayt
boyunca iftarda eknrek yerine pide verilecektir.
Yemek yenilen saatlerde kullanrlan sandalye ve masalar hemen temizlenecek. bir sonla
oturana temiz olarak servis ortamt saglanacaktlr.
Yuklenici mutfakta depolarrn nem orantnl cilgmek igin nemolger bulundurmak ve depolartn
giinliik nem ve srcaklrk takip gizelgesini diyetisyenin onaytna sunmak zorundadtr.
Yemekhanede igme suyu olarak poget suya ilave olarak tiiketilecek su Yiiklenici firma
tarafindan sallanacak su antma cihazlarrndan elde edilecek igme suyu olacakttr.
?
I
I.NORMAL KAHVALTI, YEMEK Vf, DiYET YEMEKLERi VE DiYET KAHVALTININ
$EKLi:
NORMAL VE DiYET KA}IVALTI iCERiGi
Hasta ve refakatgilerle ndbetgi personele her sabah bir tigtin kahvaltl verilir. Niibetgi personele gece kahvaltlsr
saat 24.00-{1.00 arasrda da[rtrlmalrdtI. Normal kahvaltr(gece ve sabah) siit/ meyve suyu/ gay, geker, domates,
salatahk ekmek dr5rnda 3 a1,n geqit olarak verilecektir. Regel -ya!, bal-yap, tahin- pekmez tek gegit olarak
saytlrr.
Kahvaltrda dalrtrlacak malzerneler % kg'lrk geffaf plastrk kdseler iginde, i.izeri streg film kaplanarak
servis edilir. Kahvaltl monijsiinde gay veya bitki gaylarr bulunduf,u g0nlerde ambalaj igeriiine plastik
20
t
karrgtrrrcr ilave edilir. Qay ve bitki gaylarrntn sewisinde kullanrlmak tizere her kigiye bir adet kiipiik
bardak servis edilir.
(Ekmekler tek tek poqetlenmi; olarak hasta ve personele servis edilecektir.)
Normal
Malzemenin
cinsi
Siyah Qay (po9et
Diyet
Malzemenin
cinsi
Siyah Qay (poget
Miktarr
2gr
cav)
aav)
200 ml
Siit,
25 gr
sti(UHT) paket
S.zg>4in-y . Zeflin
Paket
S.zeylin-y. Zeylin
1,6 sr
Ihlamur
1.6 sr
Ihlamur
siir (uHT)
light
200 ml
?5 or
Doset
Doset
Beyaz
Miktan
peynir
B.
40 gr
peyni(tuzlu,
40 gr
tuzsuz)
Daket
Kaqar peynir
40 gr
Kagar peynir
Eritme peynir
sr
20 sr
20 er
20 er
20 gr
Eritme peynir
15
Recel
20 er
Bal
Tahin -pekmez
20 sr
ReQel
Bal
Tahin -pekmez
Kakaolu
findrk
15
40 er
20
sr
sr
Tereyapr
kremasr
TerevaAr
60-70 gr
100 gr
l50gr
Yumuna
Yumurta
60-70 gr
DomatesHamur igi
$eker (po9et)
100 er
6sl
Kutu mevve suyu
Meyveler
200 ml
200- 500 gr
Salatahk
150
100- 150 gr
Domates
Salatahk
Hamur isi
100- 150 er
$eker (popet)
Kutu mevve suyu
Kutu meyve suyu
Taze mevve suyu
tath,
Biskiivi(
6sr
200 ml
200 ml
200 ml
40 gr
tuzlu)
Meweler
Ha$lanmrs patates
150 gr
100 sr
Ceviz
Kuru meyveler
Leblebi, frndrk
20 sr
30 er
Glutensiz,
50 gr
50 sr
proteinsiz
kurabiye
Yogurt
(
yanm
200 gr
vaAh) oaket
NORMAL 6Cr,n Vr AK$AM YEMEci
Her hastaya, refakatgisine ve personele iiple ve akgam 3 ayrl ge$it yemek verilecektir. Yemek
saatleri idare tarafrndan belirlenerek yiikleniciye dnceden bildirilecektir. Ekmek, su geqitlerin drgrnda
tutulacakttr. Olle ve akgam yemeklerinin gegitleri tiimiiyle ayrr olacakttr. Yemeklerle beraber tiim
yemek yiyenlere (hasta, personel, refakatgD paket bardak Su(200 ml), ekmek ve rslak mendil servis edilir.
Yiiklenici tarafrndan hazrrlanacak yemekler; her anlamda kaliteli, miktar itibariyle yeterli, gramaj listelerine
uygun, profesyonel bir teknikle hijyen koqullann4 grda maddeleri tiizi.igiine, umumi htfztssthha kanununa
ve
gayi srhhi muesseseler ydnetmeiigine uygun olm-ak
zorundadlr.
.
2l
Gerektilinde idare ihtiyag duyulan tahlilleri konuyla ilgili kurumda yaptrracaktrr. Bunlann giddri
yiiklenici tarafrndan kargrlanacaktrr. Diyet yemeli yemesi zorunlu hastane personelinin gercksinimleri
hastane beslenme ve diyet biiliimtintin vermig oldufiu listeler dolrultusunda yiiklenici tarafindan
karsrlanacaktrr.
:
Yemek
Tiirleri Ve Kullan acak Malzeme
Drna Eti (Kemiksiz)
120 gr
Patates 80gr
Solan
(Kuru)
7 gr
Salqa
l0 gr
Bahrrat
0,5 gr
Tuz
lgr
Yag
Ciftlik k€babr
Dans Eti
15 gr
(Kemiksiz)
120 gr
Bezelye(dondurulmui) l0gr
Patates 80 gr
Kuru Sotan 7 gr
Solga l0 gr
Tuz I gr
Ya[ l5 gr
Baharat
0,5 gr
20 gr
(Keniksiz)
120 gr
Havuq
Bezelyeli kebap
Dana Eti
Bezelye(dondurulmul) l20gr
Kuru Sogan 7 gr
Salga
Tuz
Yag
l0 gr
I gr
5 gr
Havug l0 gr
Domates l5 gr
Baharat 0.5 gr
Yegil Biber l0 gr
K6grt kebap
Dana Eti
(Keniksiz)
120 gI
Patates
Havug
Bezclye
Kuru sogan
20 gr
20 gr
20 gt
7 gr
Baharat
0,5 gr
YaB l0 gr
Tuz
Orman Kebebt
Dsna Eti (Kemiksiz')
I gr
120
gl
22
Prtrtes
Kuru Soten
Hrvug
80 gr
7 gr
15
gr
B.hrrat 0.5 gr
Tuz I gr
Y,]!, 20 gr
Anhro
tNva
Drn.
eti
Piring
120 gr
60 gr
Bezn ly{dondurulmut) 5 Sr
Hevug l0 gr
Yol
Eaharrt
?
gr
0.5 gr
Ter€Yagl 4 gr
$eh yeli G0ve9
D
r
Eti
(Keniksiz) t20gr
$ehriyc 50gr
Snr
YrE
l0 gr
Salga 6 gr
Bohlmt
0,5 gr
Tv lgr
Brhcevan kebrbr
Drnr Eti (Kemiksiz) 120 gl
Prtrt€s 80g
IIIYU(kl$n) 20g
B{zelye (doDdurulmug[tryrn) 20gf
Kuru Solen
log
Salga
l0 gr
Kabok (yurn)
Patlrcan(yratr)
50g
3sg
50g
Bahrrrt
0,5 gr
YaE
Tuz
?
t
lgr
Prthcrn Kebabl
Drno et(kemikriz)
Psthctn
120 Er
l50 gr
Kuru sotan
Domrte$
Yag
MrydrDoz
Tuz
Salga
l/l0odemet
lgr
YcEil Blber
g
log
Drna Eti (Kenlksiz)
Prtllcsn
Itomrtes
200 gI
30 gr
Bahsrrt
lrln
15 gr
25c{
,
0,5
Kebabr
lZ0 gr
Yrt 30g
YcAllblbcr
15g
Salga
Tuz
Brhrrat
tgr
0,5
g
Kuru Sogon
BUYOK PARCA ET YEMEKLERi:
P0rcli Rosto Et
Drm eti (kemiksiz)
Prtstes
Sahr
Un
150 er
tog
7gr
3gr
23
:
Sllt 20 gr
Tuz I gr
Yaf 60gr
Tereyrgr
2 gr
Kuru sogan 2 gr
Baharat
Terbiy€li ct hrtlamr
Dana Eti (Kemiksiz)
Pstates
0.5 gr
l{O or
100 gr
Yogurt (s[zm€)
Un
4gr
Tnz
lgr
Yag
5gr
l/l00 adet
3gr
Yumurta
Limon
Baharat
Havus
0,5 gr
Dana eti
Piring v€ya bulgur
YaE
TereyaEl
150 gr
50 Cr
20g
Kavurma
Bahrrat
6gr
8gr
0.5 gr
Ttz lgr
Qoban Kavurma veya Tavuk Kovurma (Dant Eti yerine 150 gr tavuk
eti)
Danr Eti (Kemiksiz)
I30 gr
Patat€s
100 gr
15 gr
Ysg
Kuru Sogan
log
Tuz lgr
Biber
Bsharat
15
gr
OSor
Domrtes
)a or
Dana Eti (Keniksiz)
l{nor
Et Sotc
Kuru Solan
l0 gr
Ycail Biber(yaz)
Domates (Yaz)
25gx
Baharat
0.5 gr
Tuz
Srl9a(yaz)
Sal98(kri)
Yag
15 Cr
lgr
l0 gr
Msntorh et sote
Dana eti(Kem iksiz)
Mantar
Kuru sofan
Yetilbiber
Domates
YaE
Baharst
100 gr
100 gr
l0 gr
log
20gr
5gr
0,5
g
Ttz lgr
KOFTELER:
Kuru Kdfte
Drna Eti (Kemiksiz)
Patrtes
Baharat
Yumurta
Kuru Solan
100 gr
100 gr
0.5 er
0,050 adet
l0 gr
24
Domates
50 gr
Sslstahk
30 gr
30 gr
YaE
Tttz
lzmir K0ftc
Drna Eti ( Keniksiz )
Patrtes
Domates
Yumurta
MaYdanoz
Biber
Kuru Solan
Salga
Brhrrtt
Y,E
Tuz
Frnn Kofte
Dano Eti (Kemiksiz)
Pstrt€s
Baharat
Yumurta
Kuru Sogsn
Salga
MaYdanoz
lgr
lnn
d
80 gr
25 er
0,050 adet
l/100 demet
l5 gr
l0 gr
6gr
0.5
l5
g
g
lgr
100 gr
80g
0.5 Cr
0,050 adet
l0 gr
6gl
I
/100 demet
Ttz lgr
YaE
Ciftlik Koft€
Dsns Eti (K€miksiz)
Patates
llavuq
Bezelye (dondurulmug)
Baharat
Y umu rta
Kuru Solan
Maydanoz
Salga
Terbiyeli K0fte
l5 gr
100 gr
35 gr
log
l0 gr
0.5 gr
0,050 adet
l0 gr
l/ 100 demet
l0 gr
Tuz
lor
YaE
Un
l0 gr
Dano Eti (Kemiksiz)
Un
Patates
Havug
Piring
Suzm€ Yogurt
Yumurta
Bahsrat
Kuru Solan
Meydanoz
Limon
2gt
100 gr
2gr
20 gr
8gr
l0 g.
l0 gr
0,08 adet
0.5 gr
l0 gr
l/100 demet
5gr
Tnz
YaE
Ptlreli Dalyon Koft€
Dana Eti (Kemiksiz)
Patst€s
Havuq
Bezelyc(doDdu ru lmug)
Kuru Solan
Salga
l0
Cr
100 gr
t0 gr
l0 gr
log
l0 gr
5gr
25
Brh.rat 0.5 s
Tottyrgl 3gr
s0r
Yunurtr
Mrydstroz
2og
l/8 adet
l/10 demet
Tlrz lg'
Yrg 5gr
Pureli Hrsrn
Prtr Kofre
D.n. Ed (KGnll6L)
l0O gr
P.tohr 80 gr
S0t 20 gr
ICSotrn l0 gr
Tclcyrtr 2 gr
Ifitrr peyllr 5 gr
B.Lr|t
Sshr
MrydrDoz
Tuz
Yrt
Yumurtr
BeE
Hamburgcr k0ftc
0.5 gr
5gr
l/100 demet
lgr
5
gr
0'050 adet
Iftvug 5 gr
ly{dodlrulDut) 5 gr
Ihnr
Ed
(Itunllcts) I00 gr
Prtetes t0 gr
Yrl
15
gr
Bohrnt 0,5 gr
Tuz lgt
t
:
io8.n 10 gr
Kf,PP l2gt
Kuru
Tu
Mryof,ez 9gr
Er(kornbon) 15 gr
Yunutr
Don.ta
Yq bibcr
P0rcli KrduDudu K0fte
Drnr Ett(Kcmlkdz)
PrtrtEs
0'050 adet
20 gr
15
gr
100 gr
E0
gr
Sot 20 gr
Yunurta l/6 ad€t
Un
8gr
B.hrret 0.5 gr
Krro.oEa! l0 gr
Mry&noz In00 denet
PhhC l0 gr
Tuz lgr
Yrg
60 gr
Tercy.F 3gr
Srhr|| k6fte
etl 100 gr
80 gr
B rrrt 0,5 gr
Dan!
Pstrtsr
TtE I gl
KuruSot!tr l0 gr
M.ydrnoz l/100 d€met
Salp
Y.E
Yunurta
Toprlrk l(6fte
Drno
etl
10 gr
15 gr
0.050 sdet
100 gr
26
log
g
Brh.Irt
Kofrc[k buEur
Yumurar
Tuz
lgr
Un
5gr
Krru ro!.f,
Mrydrnoz
Nolut
Ylt
S.l9l
lslln kdfte
0,050 adet
0.5
Dsns Etl (KcDlkrlz)
Prtlrcon
l0 8r
l/100 demet
log
7gr
log
100 gr
165 gr
log
Y.l 30g
I(Solau
llftydrnoz
Tuz
lgr
Salea
log
Doaatar
Slvrl blbcr
20s'
15g
B.h.rlt
Krymoh yumurtr
l/100 dcmct
g
0.5
Dr|u €d(Icnlkb)
Yunufts
Kun totrD
80g
DoEdtc
25s[
l
adet
lo
8r
Yrt 5gr
YcAllblber
lsg
Mrydanc
l/l0O demet
{or
Trz lgr
BrhrIrt 0,5 g
$lfi
Et d6n€r Grrnltorlu)
Hrar
et d0ncr
125
gr
RoIr Ylodcmct
MlYduoc l/10 deEet
Limon
30g
Patrtcs
100
g
Yr! 20g
TAVI'K VE BALIK YEMEKLERi:
Scbzeli Fmnda
Trvrk
T.vuI
but (spotlytl) 240 gr
Patstes 50 gr
15g
5gl
Yrg 15g
Donrtes
S.19.
Tuz lgr
Ycqllblbcr
B.hrI&t
Trvuk
tinltt l
Tevuk qlnltze(dordErulnut)
log
g
0,5
100
g
Don te(d[0t) 50g
S.htth($t0t) 30g
Yol
Prtrtc!
T.wI t
208c
100
ndrr
Trvrk et(llcto)
Donatas
150
tt
gr
2og
Ycq blbcr 15g
Tw lgr
1I
Baharat
Salga
Ya!
$ehriy€ gtveg(tavuk eali)
Tavuk
eti(bonlile)
$ehriYe
Srvr
Ya!
0,5 gr
3 gr
5 gr
100 gr
50 gr
l0 gr
Selga 5 gr
Tuz
Baharat
Frnn tavuk
I gr
0.5 gr
Tovuk but (spesiyal) 240 gI
Patates 50 gr
Yog 15 gr
Baharat 0,5 gr
Tuz I gr
Salga 5 gr
Tavuk sote
Tavuk
eti(fleto)
160
gr
Domates 20 gr
Yegilbiber l5 gr
Kuru sogan 7 gr
Salga
Baharat
Tuz
Tavuk haslamo
I gr
Tavuk but(spesiyaD 240 gI
Patates 50 gr
Havug 20 gr
Tuz
Tsvuk d0n€r(haar
5 gr
0.5 gr
I gr
Baharat 0,5 gr
Kuru soBan l0 gr
to
""n
ditimten4E)
-
--
Piring
a
50 gr
Arpr $ehriye 4 gr
Tereyatr 5 gr
Bsharat 0,5 gr
Yag
Tuz
Tavuk pirzola
Tavuk
pirzola
6 gr
I gr
170 gr
Domat€s 30 gr
Yegilbiber l0 gr
Sslaaslk 20 gr
Prtrt€s
80 gr
Baharat
0,5 gr
Yal
Tuz
Mantarl tovuk sote
Tavuk
eti(fleto)
l0 gr
I gr
100 gr
Mantar 100 gr
Kuru sotan l0 gr
Domstes l5 gr
Yegilbiber l0 gr
Baharat 0,5 gr
Yag
Tuz
5 gr
I gr
28
Br[k
krz.
rtmr
Alrbrhk (tenhlenm$)
Moydrtoz
Rolr
Yrt
MBtr
l70gr
l/10 d€met
WM
4O
gr
u![ log
I,iIon 30g
Behk
bululrno
B.[k
getltleri
(tslizlcrull)
Kurumfan
Ilrvug
I
70 gr
10gr
15 gr
Iinon 30 gr
Prt tca 50 gr
Trz lgl
yrl
Doheyrprt&
Soslu lcbzoll hlndl
E
gr
0.1 gr
Hlndi eti kemikriz 200
Bezolye
g
dondumlmug l0 gr
Hrvuf l0 gr
Prtatct
Yat
Brherat
Tuz
gr
l0 gr
0,5 gr
I gr
15
Donat€s 15 gr
Yctilbibcr l0 gr
Frrrn hltrdl
Hbdi eti kenilsiz
200 gr
B.h.rrt
0,5 gr
Y.l 20 gt
Prtrtd 100 gr
T[z I gr
Ctgcr sote
Drns cigor
Kuru sotgn
Ye!
150 gr
15 gr
l0 gr
Saln l0g
Toz I gr
'
Yctilbiber l0 gr
I
Dometea 20 gr
Bohrrrt 0,5 gr
Arnovut clterl
ctEerl
150 gr
Bshrlt
yrt
25 gr
40 gr
0,5 gr
Dourto
30gI
Yepilblbcr
20 gr
DaDs
Un
TU/z
ETLI KURUBAKLAGiL YEMEKLERI:
Etli kuru fsrulye
lgt
Kuru f$ulye 50gr
Dr!. ct{Ituaitliz) 30 gr
Salg. 12 gr
YrE
5 gr
Domrtca
15
sotrn
Bsbrrrt
Tuz
l0 gr
l0 gr
0,5 gt
I gt
Ycgllbiter
Kuru
gr
29
I
Etll nohut
Nohut
Dana eti(Kemiksiz)
50 gr
30 gr
Salga l0 gr
Yrg
5 gr
Domates l5 gr
Yetilbiber
t0 gr
Kuru sogon l0 gr
Baharat
Tuz
0,5 gr
I gr
ETLI SEBZE YEMEKLERi:
Etli taz€ fssulye
Taze Fasulye(dondurulmut) 120 gr
Fasulye 200 gr
Dons eti(Kem I ksiz) 40 gr
solan 7 gr
YaE 5 gr
Srlga l0 gr
Kuru
Domstes l5 gr
Bahrrat 0,5 gr
Tuz l gr
Kabak musakka
Kabak
Dana
160 gr
eti(kemiksiz) 30 gr
Domrtes l5 gr
Yeiilbiber l0 gr
solan
Kuru
Ya[
7 gr
20 gr
Salga l0 gr
Bahsrst 0,5 gr
Tuz
Sfizne
Pathcan musakka
yogurt
Prthcan
Danr €ti(kemiksiz)
I gr
80 gr
200 gr
30 gr
Domates l5 gr
Yegilbiber l0 gr
Ya!
30 gr
Kuru sogsn ? gr
Salga
l0 gr
Trtz I gr
Baharat
Kabsk dolma
Krbak
0,5 gr
200 gr
Drnaeti(kemiksiz) 35gr
Pirin9 l5 gr
sogrn 7 gr
Salga l0 gr
Kuru
Yat
Domates
Tuz
Baharat
Stlzmeyolurt
Etli bibcr dolma
Dolma
Dans
bibcr
cti(kemiksiz)
l0 gr
15
gr
I gr
0,5 gr
80 gr
120 gr
35 gr
Piring l5 gr
Kuru sogan 7 gr
Salga l0 gr
Domat€s 20 gr
30
a
a
Yat log
Tut lgr
Brherat
Mrydrnoz
lgr
l/100 demet
S0ar yolurt 80g
Krymrh BprDrk
bp.nal(dodurulout) l2O gr
Irpnrl(trzc) 2OOgr
DrDr ct(lenlbts) 2og
Pirlnq
.
Yrt 5gr
[email protected] 7gr
Tuz lgr
Brhrnt 0,5 g
S0ac yo8urt
Yumurtrlt upanrl
5gr
S.lfr l0 Sr
bp.n
Kdoodurulm ut)
LprmKtaze)
80
gr
gt
120
200 gl
I adet
YunIrta
-t
Sobr log
Yrl
Kuru soEtn
Tuz
5gr
7gt
lgr
g
Brh.ret
0,5
Pot||c!n
200 gr
Krrnlyrnk
Ihnr et(fcnildz) 50g
Mrydrnoz
ln(Dd€met
Yctilbiber
log
S!lgs
log
Krru so8rn 7gl
DoDrtcr 15g
Yrt 3os
B|h.rrt o'5 g
Trz lgt
EOi beaelyc
BczcD{doadurufnq)
Drrr ct(tcEilah)
Potrt
J
Hrvug
Domrt€8
Yegllbtber
Kuru so[tn
Y.E
Bo[|rrt
Tuz
g
100
40
gl
20g
log
15g
5o?
7gl
5gl
o'5
g
lgr
S.lfr l0gr
Prtrte8 oturtma
Patotcs
tt)gl
DrD. Gt(kemlhL) 40 gr
Krru sotpn 7gr
Donrtcs l5g
S.l9r log
Ye'tlbibGr
log
Yrt 25g
Tuz lgr
Bahrrst
Mrydttroz
0,5
g
l/100 d€met
Efli r0rl0
3l
Drnr ed(konilriz)
Tlac
Prthcrn
Iobo|(
frruly{dondrrulnut)
Pttttcs
DoErt
'10
gr
/O gr
40 gr
20 gr
40 gr
t
15
gr
Y€rilbibcr l0 8r
K[ru totatr 7 gr
Tuz
I gr
Yrl
5 gr
Srbr l0 er
Brh.!.t 0,5 gr
Etli banya
B.ny.(dotrdrrulrut)
g
l0O
Drr. €t$enifrb) 40 gt
Ilo[.&s 15g
log
Yetilblber
7gl
Kuru solrn
5or
YaE
Salga
Limon
Tuz
B.h.r.t
Etll
Kffu bomyr
Dam
log
5gr
lgr
0,5
Kuru bomyr
etdkenlkrb)
Kuru
lofrtr
g
15
gr
40 gr
20 gr
Yt! 5gr
Solga 15 gr
Tw lgr
Babsd
0,5 gr
7)
Kymrh krpurke
Lrhonr
l50gr
Dsr. qtGnltrh)
Krru rogri
r{) gr
7 gr
Srlgr
yrt
l0 gr
5gr
T|lz
B.f,.rst
Krymah krrnrbahor
K.
b.h|(dolddrrulnop)
l(.rnshhr(t z)
I gr
0,5 gr
gr
125
2AOgr
D.m et(keEilrb) 4og
Kuru ro[in 7gr
Soha
Y.t
S0zDc
&gl
Tv lgr
ycfuri
Mpydno
B.hrrt
Krymlh lrbrnr tsrEa
l0 gr
5gr
Lrb.trr
Dalr Gqlronilott)
Plrbf
S.lfo
[email protected]
Yl00 d€met
0,5
g
gr
150
gl
15g
40
log
los
Yrt los
Tuz lgr
B.trrrrt
Etll yapral srrma
Itrn| cd(IoDfitiz)
0,5
g
4og
Sduunyrpnk 30g
Plrirf 15g
Sehr
Kuru solpn
Donrtat
Y.g
log
l0 er
5gt
log
lgl
lUrydrno l/100 d€m€t
Br[rrrt o'5 g
Tw
S0zno
KtyErlt p|rrt.
yofon 60g
hrrla
Drnr
gr
150
ct(LdltE)
40gx
Plring
HwUg
5gr
l5 g
5gr
Yst
Srlga
tog
Hnon 2os
Tr,E"
Brh.rrt
lgl
o,s
g
PILAVLAR VE MAXARNALAR
$chrlyeli Plring Pllevt
Plrhf
60 gr
log
Tv lgr
$chdye
Yr! 6gr
Tcrcyrlr
l9P rv
PlrlDf
5gr
60g
33
ozumn
qrn FrstrF
Bohrrat
Kup
5
gr
5 gr
0.5 gr
Ya! 6g
Tuz l gr
Ter€yrtr
Gzbek Pilrvr
Pitug
Bczrly{dondurulnut)
ILvug
5 gr
50
gr
l0g
l0 gr
Yel 5 gr
Trz I gr
Teroya$ 7gr
Nohutlu Piring Plbvr
Pirtng
50 gr
Pirinc
7og
Nohrt l0 gr
Tcrcy.& 5gr
Tuz lgr
YrE 6gr
Pirltr9 Pflsvl
YaE
TEz
TereYsEr
Domatesli Piring pllsvt
Piring
6gr
lgr
5gr
60g
20cf
SchiYe 5gr
Yog 5gt
Donates
Tuz
lgr
Tenya$
7gt
Prtlrcrnb Plrtng pllrvt
Plring
@gr
Pa0rcan
30g
Yeg
Mrydanoz
Bufur Pllrvr
l/100 dem€t
Tuz
lgr
TcreyaF
7gr
@gr
Salf. 8gr
lCSoPn log
Tuz lgr
Eulgur
YaE
6gl
g
Drhrrrt
0,5
TeEyrEl
6gr
Sehzeli Bulgur PIlaYl
Bulgur
Domateg
Krru so$n
Yegilbiber
60g
15g
log
log
$lfr
8gr
Tuz
lgr
YrE
6gr
Ter€yr$
B.h.raa
Mercimefll Bulgur Pllrvt
log
6gl
0,5
g
Bu[ur 50g
Yeqll Mercinek
lcSogrn
log
l0
Cr
34
Sohr
Ttlrz
log
lgr
Yrg 6E
Tcrcy.S 6gr
Sodu
Mrkrrtr.
Dlr*tnr 55g
Sdfr 15g
Tw lgl
Yrg 5gr
Scbrcll
Mrllrrns
llf,rlr]trr
S.19.
558r
5gr
Tuz lgr
Yrl 5gl
B.hsr.t
0,5
Donat
15g
lQg
!
Yqlblbcr
Spqctti
M.Lrrrr
t
Mrtrrnr 50g
S.lfr 15g
Tltz
Y{
B.brrt
Peynl l Mrkrnr
lgl
5gr
0,5
It[.IrIr. 559
Bcyrz Pcynlr
Tuz
2og
lgr
YrI 5gl
hntr
Brirnt
Mrlrnr
o'5
g
Mrlrrnr 3sg
Yu[[rth 0,08 sd€t
s0t 3og
Kagrr Peynir 2og
Yrg 5gr
Ttlz lgr
Brh.rrt
Yotlrtlu
Un
D*.nr
0,5
g
5gr
MrIrrtra 55g
50g
S0rrG yolurt
S!nual
0,3
s
It[rydrrc ln00
Tuz lgr
Yrl
Baitrrt
Kynah Mrhrnr
Ililr
d€met
5gr
o,s
g
Mr||na ffigr
Ed
(I(.rt!b) 20g
Krru
rofn
Yrt
SrlF
Brh.r.t
Tuz
Pcyrirll crlttc
Erltte
Poynlr
Tcrcyetr
Yrl
Blirnt
5gr
5gr
5gr
0,5
g
tgr
60 gr
?ofg.
6gr
6gl
o'5 8r
35
Tuz
Cavlzll
ed
e
Ed*
Ccrvb
i9i
To!.y|F
I gr
50gr
7 gr
6 gr
6gr
I gr
Y.l
Tuz
B.hrrt 0,5 gr
Mrntl
Mrntr (dordurulDut)
80g
Mrnb(Luru)
@gr
S{lft 5gr
Ya! 4gr
Slnmnk 0,5 g
S04.
Thz
yoeurt
Brhrrat
lgr
80g
o'5
g
TcrcY.& 4gl
9ORBALAR
Yayh Qorba
S0zEe
Yolurt 35
Plrbf
Yuuurtr
Un
Sr
log
lA0 ad€t
log
Y.g 5gr
g
B rlrt
0.5
TcrcYrtt
2gr
Tw lgr
Ezo Gclltr Corba
D0t!a Qorbert
Mcrclnck 2og
Plrlnf 5gr
Un 5gt
Y.g 5gr
Tw, lgr
Bufur 5gr
Brbrrt o,5g
Krro totlr log
Sdgr log
Tercyelr 2gr
D.n. Ed ( l(.rlkk )
Un
YUD[rtr
l5
5gr
l/10 ad6t
Ilnon 3og
Yrt 5gr
Tuz lgr
Slt vctt yogura
Mcrclmck Corbr
Mcrclnck 20cg
Un l0 gr
Ylg 5gr
Llnon 30fF
Tuz
TGreYrgl
B.Llrt
Donoter 9orbr
20g
Un
SdF vcyr donrt
g
lgr
2gr
0,5
g
159
t
a
20 gr-50 gr
36
I
Y.t
Tuz
Sot
Krpr prynld
Fhriy€ 9orbt
$cl]iye
Sdf.
Y.l
LlDon
Tuz
Un
Mrydrnoz
Trrhenr Qorbe
Tartrnr
l0 gr
I gr
15 gr
5 gr
15g
l2g
7gr
30g
lgr
5gr
l/100 dm|et
15
gr
Seler 5g
Yr!
Tuz
K0yl0
forbr
Yr{il norclnck
5gr
I gr
E
?
gr
Plrbg 4 gr
Eritte 3,5 gr
Nuru
Yal 8gr
3 8r
$l9a l0 gr
rog.D
Un
Tuz
Brhrt
Scbze Qorbo
t
K|bak
Hrvry
Prrrn
(lq)
Prtlsn(Fz)
P.trt6
n
Yat
B.bmt
Kuru Sot
Tuz
Stt
Un
I'lrin9 C.od.
Plring
DoEst€e
Y|g
l0 gr
I gr
0,5 gr
l0 gr
l0 gr
l0 gr
l0 gr
l0 gr
5gr
t0 gr
0,5 gr
I gr
l0 gr
l0 gr
l5.gr
20 gr veys 5 gr sal96
5gr
MrydrEoz Ulo dsmet
Tuz I gr
Unon 30 gr
Ua 5gr
ButdNy
9o$r
Brldry l0 gr
SlnG Yofurt 30 gr
Un
5gr
Yal 5 gr
B.trnt 0,5 gr
Tuz l gr
Gcmlci gorbs
Yrrm!
Nolut
l0 gr
5gr
Krru frrulye 5 gr
Y.l
Yunurte
5 gr
0,04 adet
I
37
Bahant
0,5 gr
Tuz l gr
Un
S[zme
Yoturt
5gr
20 gr
Tereye$ 2gr
Anba$
gorba
lhto
20 gr
Yag
Un
l0 gr
10gr
Srlga
10 gr
Llmon
30 gr
Trvuk
Bahrnt 0,5 gr
Tuz I gr
Ycqll merclmekli gorba
Eritte
Yc'll merrlmel
YaE
Sslgs
Un
5
gr
20 gr
1o"
l0 gr
5gr
Tt,z lgr
Brhrrlt
Kr€mah mtntar gorba
Kremrh mantar tozu
0,5
g
15g
s0r
log
Un
l0 gr
Bebarat
0,5 gr
Klemru trvrk tozu
l5g
log
Yrt 5gl
Tuz lgr
Kremrh tavuk gorbs
Un
Tuz
s0t
Blhorrt
lgr
log
g
0,5
YrE
5gr
Mllf0y
100
BOREKLER:
Trht Boreti
Yumurta
Et (Kenlkrlz )
gr
l/10 adet
258f
B€zelyo(dondrrulnul)
I(Sotan log
Bahrrst 0.5 g
Ihvug 5gr
Tuz lgr
Yat 5gr
Peynirli milfoy boregi
Mllf0y hrmuru
Peynlr
100
20c'
Mrrgr?in
Yumurta
Susom
Peynlrli puf b0reli
Puf
Merclmekli
|
/
l0adet
lgr
b0r{(dondrrulnug) ll0gr
Yrg 20g
lol borcgi
Yufta
Yctil Mercimck
Kuru sotrn
Yumurlt
80g
20g
log
02adajt
38
sut
30 gr
Ysg
l0 gr
Tttz
Sigara Bdreli
Yulka
Peynir
MaYdanoz
Yumurta
Yrg
Sigara Bdreli(dondurulmug)
Sigara b0regi(dotrdurulmus)
Yag
Peynirli tepsi B0re[i
Peynirli gfl b0regi
Peynirli kol boregi
ll0gr
30 gr
gr
PeYnir
30 gr
l/6 adet
Yumurt{
YaE
15 gt
s0t
30 gr
Tuz
Baharat
lspanak[ Kol Bdreli
l/30 demet
lgr
0,5 gr
Susam
lgr
l0 gr
Yufta
Yumurta
s0t
Yag
T|uz
K.Sogan
Yogurt
80 gr
25 gr
| /6 ader
30 gr
15
gr
lgr
l0 Cr
l0 gr
80 gr
30 gr
I /6 adet
Yufks
Dana Eti (Kerniksiz )
Yumurto
YsE
15 gr
sllt
30 gr
Kuru Sogan
Maydanoz
Tttz
Bshorat
Yo!urt
Susam
Y
log
YoEurt
Ispanak(dondurulmug)
Patat€sli Kol Bor€Ei
Patat€sli gill Bdregi
Patrtesli tepsi boregi
l/20
30 gr^det
E0
Maydsnoz
g
80 gr
20 er
l/10 demet
Yulka
Kuru Sogan
Krymah t€psi BOregi
b0r€Ei
Krymah
Krynsh kol boregi
lgr
l0 gr
l/10 demet
lgr
Oior
l0 gr
lgr
gr
ufka
E0
Patates
50 gr
Yogurt
l0gr
l0 Cr
Sogan
Yumurta
Maydanoz
116
adet
l/30 demet
sut
30 g.
YaE
l5 gr
Tuz
lgr
ZEYTiNYAdLI SEBZE YEMEKLERi:
Menemen
Domates
Yegilbiber
39
Kuru sogan
Yumurtr
Maydanoz
YaE
l59
I adet
l/100 demet
5gr
Tttz lgr
Bahrrst 0,5 gr
Z€ytinyogh Taze FasulYe
Taze Fasulye(dondurulmu g)
Taze fssulye
Tuz
Salga
Z0ytin
Y
agl
150 gr
gl
200
lgr
log
lGSdan
l0 gr
Domates
Toz geker
20 gr
0,5 cr
Z€ytinyogh Patltcan-ksbak
Patlrcan-kobak
Domates
Z€ytinYagl
Salga
Ttuz
gl
125
30g
l0 gr
5gr
lgr
Kuru Sofan
Sivribib€r
20g
Sarlmsak
OSor
I0 gr
Trz lgr
$akguka
Patllcan
l50gr
Domat€s
YeSilbiber
30 gr
Sanmsak
Patrt€s
Yag
Maydanoz
Tttz
Baharat
2os
0,5 gr
60g
40g
l/100 demet
lgr
o'5
g
Z,eytinyegh Brrbrnys Pilski
K.BarbunYo
Palat€s
Havug
SalCa
Zf,Jairya6l
Tttz
Zeytinyagh Bibcr Dolma
50 Cr
20 gr
l0 gr
l0 gr
l5 gr
lgr
Limon
Maydanoz
30 gr
Bahrrat
Biber srlfasl
0,5 gt
Dolme Biber
Piring
Domates
Kuru Solan
9am FlstEr
Kug Uz0nr0
Limon
Zeytin Yagl
Baharot
Tuz
l/100 demet
2gr
100
gr
2o g,
l5gr
l0gr
2Er
20g
l0 gr
0.5 gr
lgr
Salga
Kar$rk Yrz KEertmasr( Sllzme Yogurtlu)
100 gr
40
Blbcr
50 gr
40 gr
Yoturt
Tuz
Prtl|c|n
t0 gr
t0 gr
I gr
togr
P.t tcs
HDcr
100 gr
50 gr
Ycail
Sllznc
Soclu
l(grylk Kuartne
Yr!
l{eb*
Yetil
Yal
40 gr
50 gr
80 gr
Domrtca
Krbot
Tuz I gr
Prtlcrn 80gr
Ksnt*
kry
fru ran$( !0zne Yoturdu)
P.arae. 100 gr
Ilevug 60 g
Tmo
Krnrhthar
150 gr
Krnrb.bo(doldurulnut) l00gr
Slzrcyo$tn 80 gr
yet
Yunurtr
Un
Ttlz
Zeytltryrur hmss
55 gr
0,08 ada
I gr
Prrrca 125 gr
z3ytiryrB l0 gr
Ilrvrg
20 gr
Stht
I gr
5gr
Tuz
Linon
Pirinc
Patftcrn-Bibcr K|zsrtmr ( 30zmc Yoturtlu)
15 gr
Patlrcan
Y.Bibcr
Donrtet
S0ac Yo8un
Yrt
20 gr
5
gr
150 gr
g
50
50 gr
t0 8r
30 gr
Tuz lgr
SAI.,ATAI,AR:
K!ryt|(
r.ht
(ktt)
Mrrul 60g
25c'
KrrDrarurDa 25g'
Mryd.n@. l/50 d€rnet
T,rytity'!& 7gr
Havug
Tw lgl
30g
Liuotr
Krnt*
srlrto(y8z)
Ilomrtcs
Sahtru(
Yetilblbcr
120
g
60 gI
20 gr
Maydrnoz l/50 demet
Zeytiiyrlr
5 gr
Limon 30 gr
Ttlrz lgr
Prart.3
rrbtrrl
Patrt€r
Yum|trtr
Tuz
150 gr
l/8 adet
!
lgt
4l
Bahrrot 0,5 g
Mrydrtr@ l/50 d€net
Zeyt|nyrlt log
Limon 30g
T,tr,ytls 5gr
Tsze
rolrn
log
Rus sdetrst
Bczely{dof,drrulx|r')
Hrvug
.
Piylz
30 Sr
30g
Pstrtcr 100 gr
Yo[urt 2gr
Mryon€z 30g
Turlu 3og
Tuz lgr
Kuru f$ulye 50 gr
Kuru mdrn l5 gr
Yumrrtr l/6 ad€t
7*yt|J
z,]ttlayag
7 gr
7 gl
Llnon 30 gr
Tuz I gr
Brhrr8t
Crqk
0,5 gr
S0zncyoturt ll0gr
SllrtNh|( 40 gr
Zcytinyrtr 3 gI
Tuz lg
Bsh.rrt 0,5 gr
Klse Yotur(trn y!Ur)
Kutu oyrr(trn y.Eh)
Turyu krntrk(30z
Tahln helva
Mefve suyu
MEYVELER:
Yogurt
Ayren
n0t)
200gr
200 ml
100 gr
80 gr
200 ml
Elnr
Arnut
Ozon
. $cft.ll
Erlk
Mandrllna
Port
lrl
Kryur
200
200
200
200
200
200
200
200
gr
gr
gr
gr
gr
gr
gr
gr
l(araa, 2N gl
gllek
Muz
200 gr
200 gr
200 gr
Krvun
l(rrpuz
500 gr
500 91
B{dey
15
Yerid[nya
Klvi
100 gr
TATI,IL^R:
Ature
gr
Nohut 7gr
Kuru Farulye 7 gr
$eker 50 gr
KOz[n
KuruKry$
Frnd*
6 gr
8gr
69r
I
C$tE 6gl
Nitrstr 3gr
lncir 8gr
Terln
Un helvssl
0,5
g
Un
50g
Un
35
SeIel 5os
TcrrFEl 2os
Ceviz 5gr
s0t 2og
$+kerpsre
$.ker 60g
Mrrgarin 208f
Pudra gekerl
Yumurta
KibartDr tozu
lrlnlt
Ftndtk l9i
lfuzrndlbi
s0t
$eker
Nlto3tl
Pudrs tckeri
Vanilyr
Puding
s[t
$ekel
Krkro
Vailyr
Nitostt
Yumurtr
Muzlu puding
s[t
Muzlu pudlng tozu
Antcp fistlr
Nbast!
Clleldi pudlng
Nitasta
Krlrolu puding
s[t
Krkaolu pudlDg tozu
Antep
fistll
Nbrstt
gr
180
459
7,5
s
5gr
0,5
g
180 gr
459
log
0,5
g
log
l/10 adet
lE0gr
t< or
o,sg
5er
180
259
5gr
gr
150
25s
0,5
g
5gr
sllt '150 gr
Fker 40g
Nitsstr
KrkNo
Vrnilya
IUrryirin
AnteP filhgr
lrmik Helvesr
l0 gr
4gr
g
ADteP firt{l 0,5 g
sllt
9ileklt puditrg tozu
Supcngle
log
l/6 &et
o'8 g
log
log
0,7 g
4gr
0,5 gr
lrmik 4og
$eker
TereYatt
qrm Flsttr
50 gr
20g
2,5
g
43
SOt
30 gr
0,5 gr
Sltt
180 gr
Vuilyr
0.5 gr
Antcp
fBttr
S0tlr9
I
gekcr 45 gr
Pirlng l0 gr
Nlgrstr l0 gr
Trrqm 0.5 gr
Frnn Slltlrg
Sot
Sekor
gr
180
45 gr
Ptring l0 gr
Nit$tr
l0 gr
Vanilya
0.5 gr
0.5 gr
Trrgln
Krb.k TrtlEr
Krbok
$eker
Ceviz
Revrni
lgi
SOt
Un
300 gr
50 gr
15
gr
4 gr
14 gr
$€ker 70 gr
lrmik 8gr
Yumurta
Yrg
Hlndbtan Cevizi
Ceviz igl
Krbrrtma tozu
Kcfk[l
s0r
$ker
Yumurtr
Nlgasta
Frndtk
Vonilya
Lokma Tathsl
Un
0.3 adet
lgr
0.5
g
5gr
0,06 gr
180 gr
45cf
l/10 adet
log
5gr
0.5
g
50g
$efcr 759
YaE
Ilnon
30g
lgr
MrYr 2gl
Hlndltt n cevizl
0,5
s
Tel Kedayrf
Tel KadaYtf
9eker
Cevlz
60 er
7og
l0 gr
Yrt log
LiDon lgr
Tereyagl
Krlbure Borfi Tatlu
{or
Un
$€ker
50g
Yogurt
20g
20g
YuDurtr
YsE
€evh lgi
Linon
Krbsrtma toz||
16 at
l/10 adet
log
lgr
0,E gr
44
Kemdpqtr
t tll
Kemrlprtr
$cker
25 gr
50 gr
Un
30 gr
65 gr
Ant p ftshEr I gr
Tulumb. Trthsl
$eter
Yrmrftt
l/3 sdet
LInon l gr
.-JS..99-q
Gourgyrprr&
Sot
gcker
Cwiz
KOMPOSTo VE HO$AFLARI
Kuru llz0m vc kuru kry$l hotsfl
igi
Konr [zam vcyo kuru kryEl
a
20 gr
150 gr
E0
gr
l0 gr
50g
ftker 40cr
Kangrk hogaf
Uan 2os
2og
KaYsl
Kuru erik
l0 gr
$eker
4os
ncyve
$oker
40 gr
Elma, ryv!,ktytstncrik komposto
Trzc
Vitre kompoeto
80
gr
Vfr{doedundout) 709
$ek€r 40 gr
"*
45
DiYETYEMEGi
5-8 geqide kadar diyet yemeli verilir.
Rejim [email protected]; 9ay, biskiivi, tanesiz komposto) diyet yemeli kapsamr drgrnda tutulacaktrr.
Hastane diyetisyenlerinin talimattna uygun olarak
(iicretlendirilmeyecek) Ayrrca her giin istenen sayrda normal yemegin tuzsuzu da yaptlacaktrr. Firma
tarafrndan hazlrlanacak diyet yemeklerinin hastane diyetisyenlerinin verdifi genel diyet talimatlanna uygun
olmasr zorunludur. Diyet Tedavisi uygulanan hastalara tedavilerine uygun gegit kadar kahvaltr ve <izel diyet
yemekleri sunulacakrr. Diyetli hastalarrn kahvaltr ve diyet yerneli listeleri her giin hastane diyetisyenlilince
hazrrlanrp, Yiiklenici firmaya bildirilecektir. Diyet yemekleri haricinde trbbi gereklilik halinde 6zel
yemekler veya yiyecekleri temin etmek yiiklenicinin yiikiimliiliigiindedir. Diyet yemek listesinde
bulunmayan iizel diyet istekleri klinik diyetisyenleri tarafrndan yiikleniciye bildirilecektir. Bildirimden
soffa en geg 2 saat iginde istem klinile ulagttrtlacaktrr.
Ara Oliin: Klinik sorumlu diyetisyen tarafindan uygun gdriilen rejim yemelinde ara dEiin
almasr gereken hastalafln ara ijgiinleri istenen saat ve miktarda ( en fazla 4 ara ii[tin olacak
qekilde )yiiklenici tarafrndan verilecektir.Diyetisyenin uygun gdrdii$ti gekilde hastalara ara
6[iinde l-4 arasr gegit verilir.Ara atgiin diyet yemelinin pargasr sayrhr, aynca
iicretlendirilmeyecektir'
:
ARA OG{JNDE (ARA KAHVALTI) VERILECEK YiYECEK QE$iTLEzu VE GRAMAJLARI
Siit ,yoEurt,ayran (light ,yarrm yagh ,tam yagh)
Muhallebi , pelte, komposto, limonata (gekerli
200 ml
200 ml
/tatlandrncr lt)
Peynir (tuzlu{uzsuz )
Yumurta
Meyve
Haglanmtq patates
Proteinsiz gijreld pelte ;
Gliitensiz qdreld gliitensiz ekmek
SdAus salata
Gevrek
Eritme peynir
Ekmek
40 gr
60-65gr / adet
l50sr
100-l50gr
50 gr
150 - 200 gr
I
5sr
En az 50gr
DiYET YEMEKLERi
Et haglama
Dana eti(kemiksiz)
Patates
Yag
100 gr
30gr
5gr
Havug
20 gr
Limon
5gr
Un
YoEurt
Yumurta
Coban kavurma
Dana eti(k€miksiz)
YaE
Baharat
5gr
t/50 adet
100 gr
5gr
0,5 gr
46
a
Domates
15
gr
Sotan
l0
Cr
Yegilbibcr
Et sote
Dona eti(k€miksiz)
YaE
l0 gr
100 gr
Btharat
0,5 Cr
Domrtes
15 Cr
Salga
So[an
Yetilbiber
l0 gr
Dana eti(kemiksiz)
Domat€s
Yegil Biber
80 gr
Ablnt kofte
Maydsnoz
Solan
Salga
Yu mu
rta
15
gr
l0 gr
l/50 demet
l0 gr
5or
ll20 adet
Frnn k0fte
Dana eti(kem iksiz)
Maydanoz
Salga
Yumurta
80 8r
l/50 demet
5gr
1/20 adet
Solan
l0 gr
Dana eti(kemiksiz)
Domates
60 gr
izmir k0fte
Y€til Biber
Maydanoz
Sogan
Salga
Yumurta
Frnn tsvuk
Tavuk but
15
gr
l0 gr
l/50 demet
log
l/20 adet
140 gr
Yrg
Salga
Tavuk hasloma
Tavuk but
Baharat
Maydanoz
Yag
140 gr
o,5gr
I /50 adet
Hrvug
l0 gr
Patates
20 gr
Solan
Tavuk sot€
Tavuk fl€to
Domrtes
Yegilbiber
So!an
100 gr
20 Er
l0 gr
Salga
5gr
lspanak (taz€)
Ispsnok (dondurulmut)
Z,€yain Ysgl
120
DiYET SEBZE YEMEKLERI:
lspanok
Kuru Sogsn
g!
l0 gr
Salga
Piring
47
S0dG
Prrra
YoIrrt 50 gr
Pran 150 gr
Hrvug
20 gr
z,yttnYd! 5gl
Llnon 5 gr
Piring
KunrSotP
S.lf.
Krrmbah!r
Krrarb.n r(ar4)
Kf,rrb.L(dordrrulurt)
z€YSn
5
g
l0 gr
5gr
20Ogf
150 er
YrB 5gr
Srhr 5gr
Kuru Sogrn
Havug
PrtlrcrD
Pathcrn
log
losr
150
gr
DoDlt t 20sg
ZGYtlrYr! 5gl
Kulu Soilrn
MrYdrnoz
Sshs
I0bak
loE
lFO domet
5gr
K'b|k lsOg
Donrteg zoc'
ZYttn Yal 5gl
Kuru SoEln log
Iabanr
Pidrf
59/.
Solgr
5gr
|,|inr
l50gr
Kutr Soflrn
log
log
DoErt'5 20g
Hevug
74ffiYs/!
Trr€ FrsulYe
Sdfs
5gr
5gr
TltG FrrdY.{trrc)
150
Tr'. frrots(dodlnhrt)
lz0
gr
g
Doortd 20g
ZeYttD
Yrt 5gl
[email protected]
log
S'lfr 5gr
BoDyt
B.rY. (t '3)
150 gr
B.EY. (dodrrutr0t) l2O El
Donr|tt zog
Srlgc
5gr
ZcYdn Yr! 5gr
Kuru Sofirn
B.'ClYe
log
Be*lYc(doudurulnq) t20 gl
Z.Ydt YtI 5gr
S.lf. 5gr
Pltttal 20gI
Hrvug log
Kuru rotPn
log
DTYET PILAV VE MAKABNALAR:
Pllav
4E
Ptring
gobriye
Mrk!rnt
Erltte
Yrt
Mrlrne
Yrl
Erlttc
Yr!
Bulgur plhvr
Bulur
Srlgr
60 8r
5 gr
5eI
55 gr
5 gr
60 gr
5
8I
50gr
5g1
Yrt 5g
Domrt€| l0gr
Blbcr 5 gr
DIYET9OREALAR:
$ehriye Qorbo
gehriye
S.lF
Y.g
IJnon
Un
Plrlng CorDr
Plring
S.br
Yrt
Lhon
Un
Yayla Qorba
Plring
S[zno Yolurt
Yrl
YuIurtr
I(Narc
Un
Mercinel Corbo
Utr
$orbr
DoEatcr forbo
15 gr
58r
5gr
30 gr
5gr
l5gr
5gr
59'
30 gr
5gr
log
30g
5gr
l/40 sdet
0,5
g
5gr
2og
5gr
Yrl 5gr
Un 5gt
LiDon 30 er
Merclnck
Sslgt
Un 15g
Y8t 5er
Donates
Srlgr
Un
Y!l
50g
5gr
log
5er
s0t 20g
DiYETSALATALAR:
Krnt* s.Ltr (lot)
ILrul 60g
IIrvug
259
Krrnrrllhrl. 2sg
Msydrnoz
ZcytlnYetr
Llnon
Krngtk ssLtr(Yez)
Domrtes
l/50 demet
5gl
30g
ll0gr
49
!
S.btrhk 5og
Yqflblbcr 15g
l/50 demet
Meydrrcz
Zcyti!yttr 5gr
Llnol
j
I
30 Sr
DTYET TATLI VE KOMFOSTOLAR:
Kuro odm
vG
k[ru lrYur ho'oft
EImr konposto
Ayvs kompo8to
Vitne f,omposto
Nltrrto pclte3i
MuhalSl
I(uru llz8a
vey.Iltr
AyYa 80 gr
$ker
40 gr
Vbtrddondurulnut)
$oker
70 gr
40 gr
Nterie
$olcr
20 gr
'|()
S0t
Ptuirg unu
glrer
Slldeg
gr
t50 gr
15
er
30 gr
Set 150 gr
$clcr 30gr
Plring l0g
Nlrstr
5gr
Slt
150
Soll.r|lll Euhrlhbi
Pll|ng
S.lkrrlnli
a
lry|ll 50 gr
$Icr 40 gr
Elnr t0 gr
$Gltcr '00 g
Peltc
unu
Soklrrln
2 ad€t
Nbrsta
20 gr
I adet
TlD.p.yvc
Sitrrto
80 gr
I adet
Elrno
175 gr
$trril
$Itrrtnli lonpmto
DIYET MEYYELER:
gr
l0 gr
ArDut
Ozln
l50 gr
t50 gr
Madrlloe 150 g
Portrlrl 200 g
Krwn
I(rrPuz
Xllrrz
9llsk
Kryl
Erlk
Yenld0Dy.
500 gr
500 gr
150 91
150 gr
150
g
l50gr
150 gr
M||z 200 gr
$eftrll 160 gr
Kivi
100
g
,
)U
r2.crDA MADDE vf, MALZEMELER|NiN TEKNiK OzELLiKLEni
vr vlsml,,c.ru:
xwirsiz plxa loP ori:
masalannda
ut,nacak etler, nronorayda, bant konveytirlii masalarda veya diiz parqalama
yaprlacak, etler kemiklerinden usuliine gore aynlacakttr'
kJrtas; t,er r.Ltan kasaplrk srfirrla.n ,rultin" uygun olarak kesilmiq, yiiziilniig, ba' ve ayaklart
organlart, idrar kesesi ve bunlarrn baplarr' yemek borusu
ayrrlmrg, i9
l.ful"n'',uyu
organlarr
gikartrlmrq, btibrek y
omurundan kesilmi5
ve pelvis boqlulu
ir'
incikler, boyun, karrn kaslarl, ddq ve kavram ktstmlartndan
Krymallk Etler
elde edilen etler.
0n kol, gerdan ve incik etlerden elde edilen etlerdir'
Kiirek iistii, diiq ve gerdandan elde edilen etler'
Bonfile, kontrofile, pirzola, rosto, nuar, yumuna' rang,
Kugbagr hk Etler
Haglamahk Etler
Krymetli Etler
soKum.
Kemiksiz dana
yallarr alrnmrg' kuyrulu 4 kuyruk
lopet
:
Erkek dana etinin kemiklerinden ayrrlmrq geklidir'
yaprlan mahallin duvarlart mermer veya fayans
Pargalama Yeri : Pargalama ve paketleme hizmetleri
oi*i,Jn. o,"".rurrn birbirreri ve zemin rr" utdq[]l$rl"",fffi:'il1,:'?,::"J"XI'fl"":ll"ui,iX;""u
ihazlar bulunmahdrr'
srcak, sofiuk su tesisatl lavabolart' brgaklar igin
ketleme bdliimii tsr kontrollii olup; rst derecesi 8-
r3'C
olmalrdrr. sosutucu iinitelerden veriren
so[ukhavani$:",JiJ",rff;|il;j*'n:::trjjfl'"
''
n 6 ayda bir portdr muayeneleri yapnrtlacak ve bu
isimleri kurumumuza bildirilecektir'
olmaltdrr'
Sertifikasl" ve 5179 Sayllr Kanun Hiikmiinde
Karamamenin 18. Maddesi gere[ince I1 09'2000 t
"Krrmrzr Et Uri.lnleri Uretim Tesislerinin Kurulug,
Yonetmelik" h0ktimlerine gdre diizenlenmig T C
Kontrol Genel Miidtirlii![' Qalrgma lzin Belgesi'
oter tasdikli suretlerinin ibrazr gartttr'
Taze Et. Hazrrlanmtg Et ve Haztrlanmrq Et Kartqtt
prlan hususlann muayenesi: Bu hususlann
imi esnasrnda grdadan kaynaklanan bir
Grda. Tartm ve
s.,dan,n Grda Maddeler'
dolabillcek ek zarar ve ziYandan
Er veya
-u"unia
51
Muayene ve Kabul $artlarr
Etler taze getirilecek; dondurulmug etler her ne suretle olursa olsurr kabul edilmeyecektir.
Etler ahnan hayvantn dzelliline gdre, etlerin rengi pembe ve ktrmlzt arasl olacakttr'
Kendine has et gtiriiniimiinde olacaktlr.
gif.rin
aqrrl ya! bulundu[u takdirde; bu yallar trisaj rglernine tabi tutulmuq olarak
u-!J ,'
aU JVtr.ii"de
url
Ll|cr
t"rfi, ,aii"""f.tl.. nu qekilie getirilmeyln etlerin bulunmasr durum tnda muayene komisyonunca
iglem yerine getirilerek malln muayene ve kabulii yaprlacakttr' veya
dtl., kurrtri.u" ,o[uk hava depolartna iicretsiz olarak en az 2 ton istiap hadli termos
ilgili
thermokingli araglarla teslim edilecektir.
Etlerdehi9birhastalrkbelirtisig0riilmeyecektir.
gibi) toprak' gamur ve yabancr .
Dana Lop Etleri kan, pislik (dr$kl, sindirim organr luhteviatr
karrn ve gOliis boglu[unda
pargalan,
,uja"t"it" ti.t"nn1ig olmayacaktir. Giivdeler-tizer rde deri
i9
'
nlikle bulunmayacaktrr' Dana etleri haglanarak
likte ve lezzetliolacak, etlerde kiiflii tat ve koku'
vb. higbir yabancr tat ve koku bulunmayacak; tat
aKllr.
omisyonu taraftndan yaprlacak inceleme
kdirde teselliim edilecektir'
ektir
il;;;;;;;;;
;;;;;;;";"n
istenebilir
allrhkh
-,, getirilecektir
^^r:-:r^^^r-+;v! korunm.ast amacrvla kef'enlenerek
etkiierdel
;"k,1
Ktvma hastane mutfagrnda
kryrlmrg krvLa kesinlikle kabul edilmeyecektir'
Yemek listesinin durumuna gdre but
et
srrasrna"a dr9
hazrrlanacakttr'
fikast" ve "Ktrmtzr Et Urtinleri Uretim Tesislerinin
' htikiimlerine gdre
Genel Miidiirlii[ii, Qaltqma
uglardan alnmrq ISO 22000
GrdaMaddeIeriTiizti!0ve'|.iirkGrdaKodeksineatrfyaptlanhususlartnmuayenesi:Buhususlartn
I tiiketimi esnastnda gtdadan kaynaklanan bir
anltEt veya Ctda ' Tartm ve
g'dan'n Glda Maddeleri
'on-utuniu
nde dopabilecek ek zarar ve ziyandant
JZ
$artlan
:
Muayene ve Kabul
olsun kabul edilmeyecektir.
I -Etier taze getirilecek; dondurulmug etler her ne suretle olursa
2-Etlerin rengi pembe ve ktrmtzt arast olacaktrr.
tabi tutulmug olarak
3-Etlerin dr9-yuzeyinde agrrr yap bulundulu takdirde; bu yallar trisaj i$lemine
komisyonunca :
ieslim eaitecittir. nu gefitae gitiritmeyen etlerin tulunmast durumunda muayene
$
ilgili iglem yerine getirilerek mahn muayene v€ kabulii
az2 ton istiap hadli termos veya
4_-Etlei kuruururnuz soguk hava tlepolarina iicretsiz olarak en
thermokingli araglarla teslim edilecektir.
5-Etlerde hicbir hastalrk belirtisi gdriilmeyecektir'
yaprlacakttr'
rl
rak tagtnacakttr. Etlerin ta$rndlgr
frigorifik aragta
.
yabancl maddeler bulunmayacakttr'
kdtti koku yayan maddeler, toz, pislik, gdp, saman- vb
+ I "C'yi ayarlanabilen rsr deli9imi otomatik kayrt
S-Eiin ,uq,nO',gt araglarda, soEututmui etteiin
cihazr (Tennograf) olmast gant aranacakttr'
yaprlacak inceleme
s-yiiLiln;"i t;unndan teslim edilen etler, muayene komisyonularafindan
kdirde kabul edilecektir'
kemik, tendon, fasia, krkrrdak, lenfyumrusu' sinir
tuz' lezzet ve 9e9ni verici maddeler ile kangtrnlrp
i sonucu elde edilen iir0n
-$e koku olmalr' Yabancr tat kiifkokusu
olmaltdr'
N
Eschericha coli (kobig)
i"r.-;r.i" cnli ot57: H7 (kob/s)
5
s!:lpylococus aur suJ \^wu' 6,
5
Salmonella (kob)
5
5
2
0
2
0
M
M
l*10,
l*10'
Bulunmamal
5+ l0'
5+10,
25 g'da bu lun mamall
kg.hk koli ambalajlarda teslim edilmelidir'
l.Uriin|erleku|lanrlankatkrmaddelerivebaharatlartnteminedildi[ifirmalarlniiretimizni?
b
2
3
4
o/^: L^'..^-i-.^r
bakteriYelVo
eleri: Anti
Y a|oftnt'.oh20-25 (et
as eoeoek ambalajlann i
ve toksin madde igermemelidir'
vermemeli
higbir gegirgenlik
k olmamahdrr.
mahdlr'
ddeler' igindeki mala
kalite sistem^belgesi ibraz edilecektir'
7-Tesis ve iiretilen mamullerle ilgili iSO 22000
..Grda-Sicil ve crda uretim Sertifikasr"
alrnrnrg
8_T.C. Grda Tarrm u" ttuyuun",tit eu-ti"l;,;;;
odeksi Yiinetmeli!inin 25' ve 26 maddesinde
ahdrr.
k 0creti firma tarafrndan karqrlanacakttr'
Grda Kodeksi Yti'netmeli!i hiikiimleri uygulanr'
{3
12-ihaleyi alan firma siparit edilen i.iriinii alacak kapasitede en az -l8oC'de gah9an deep freezeleri
hastane mutfaEtna teslim edecektir.
niNoi Bri:
Hindi eti; kemiksiz goBiis eti olarak ahnacakttr.
Hindi griliis etinin tizerinde derisi ve yabanct maddeler bulunmayacaktrr'
largali'nirr' hindilerin tiiy diplerinde tam veya yarr belirgin kan.lekesi
Golusler dondurulmug (qoklanmrE) hindi etinden pargalanmrq olmayacaktrr'
Parga hindilerin tizerinde sakatatlarl olmayacaktlr'
bulunmayacaktlr'
Parga hindi etlerinin iizerinde tiiy, toz, toprak vb. yabancr maddeler
vb. yaprlmrq ambalajlar
polietilen
Hindi etleri drgarrdan gdrfilmesini engell;meyecek nitelikte
olmayacakttr'
:
lecektir.
kesim tarihini, son kullanma tarihini, a[rrh[rnt
rihi ve kesim yerindeki veteriner hekim onaytnt
dtizenlenmig oldu$u rapor her mal altmtnda
tes|im eden firmantn adt ve
getirilecektir.(Bu raporda veteriner hekim onayt, gelen hindi eti miktarr,
faqesi yer
. . .-^-. ^^r.^.- gekilde
^^r.
p.li" fii"ai",r"rr soguk huua zinci.ini devam ettirecek termokingli araqlarda sogutucusu gahqrr
getrrilecektir.
ieslimat yapan termokingli aracrn i9 yiizeyi temiz ve hijyenik olacakttr'
(Eline eldiven
p"rsonelin"kryafet ve 96riiniim' hijyen kurallarrna uygun olacaktrr.
alacaktrr)'
!
i;;;;;il;
rr.)
ti durumlarda hindi etlerinin TSE gartlartna uygun numunesl
karrglanmak
idarenin belirleyece!i yer ve zamanlarda giderleri firma tarafrndan
iizere analize tabi tutulacaktlr.
firmanrn Tarrm Il
v"i.Jrri, firmayr temsil eden kigi mal tesliminde bulunacaktlr- Miiteahhit saklama
yeri ve parqalama
kombinasr'
(Kesim
Miidi.irlii[ii'nden gahSma ruhsatr almtg olmasr gerekir'
veri icin)
ieaaiit<ci firmanrn iSO belgesi olmahdrr'
DANA KARACiGERi:
Sallamvesallrklerindeneldeedilmigvetazeolacakt|r.Kendine6zgiirenk,koku
veelastikiyetteolerleritazegetirilecek;dondurulmugkaracilerlerhernesuretle
olursa olsun
kabu
talrkll, kdtii I
renkli, gevgemiq ciferler kabul
renkli( krrmrzrll$rnr kaYbetmig
olacakttr, bir krsmr kesilmig, P
tavuklarrndan haztrlanacakttr'
dair' ahnacak resmi kurumlarda
2-Kesim 6ncesi ve kesim srrasrnda hijyenik $artlara uyulduguna
gtirevli veteriner hekim raporu btitiin kontrollerde ibraz edlleceKtlr'
ibraz edeceklerdir
4.Muayenekomisyonunca;gerekg<irii|diigiindepargatAvuketlerininkimyasa|,mikrobiyolojikver
firmadan
ire ir!iri ieir'iri ui'tuo'"iuuidan ahnacak raporlar viiklenici
;d;il;;il;;.1liit";
istenecektir.
250 gr (+% 5)' gdpiisler 600 gr (+o/o 5) olacaktrr'
5-Parca tavuk etlerinin alrrltklarl spesiyal butlar
54
o/o 5 (yiizde beg) gegmeyecek, gegti$i takdirde reddedilecektir.
6-parga tavuk etlerinde su oranr
7-Parga tavuk etleri tizerinde tiiy olmayacaktlr.
g-iavuk parga etlerinde gtivded-e krnlmrq kemik bulunmayacak, eklem yerinden grkmt9 kemik saytst
ya[ tabai'd"n 9ok otruyu.ak, tiit dipleri kan lekesiz olacaktrr. Gdvde diizgiin gekilde, iyi dalrlmrg
kasrna sahip, etlilik durumu iyi geligmig
koyu renkli olm_aylcak_,
e-furgu tuuui.tt"ri sa$lrk1 ue bozulmamrg olacak, derisi anormal derecede
eya butlarda deride
morad;ar, ktrmtzr veya koyu renkli kan
olacaktrr'
,
pr
irorarmalar ve ette berelenmeler olmayacaitrr. Kokuqmuq,
,"iLi", lvi g"flt*"miq gok zayrf (kageitik), gevgek, yumug .
ve lezzette olacakttr'
;ou;;
iizerinde
.i
yegilimsi morarmtg
a olmavacaktrr' Etler
normal krvamrnda kendine has renk, koku
beliften
renk, koku ve goriiniig agrsrndan taze (bayatlamamrg) ve temiz oldu[unu
i6_i_c"1"""r
"reri,
rizellikie olacaktrr
ve
deri krsrmlarr, derinin pargalama teknipinin gerelinden fazla kesilmig
.
ii-i;"ri" i""f.
"lerinde Btitiin haiJekitavuk gdvditerinin herhingi bir yeiinde deri kesilmig, vrrtrlmft
;;.;iltti;i;;y"""ktrr.
in deri fazlasr olmaYacak.
veya inorganik bulaqma
ve yumurtalart, gOP toprak vb'
yabancr madde) gdriilmeyecektir'
sonra en gok 30 dk pigmig
l4-Biittin veya parga tavuK erlerl normal tencerede su kaynadtktan
'
ve yrl olacak) ve firma adl bulunacaktlr
ktan sonra, oluklu mukawa ambalajlarda..
setirilecektir.
-torirv"nu
i8-Tavuk etleri frigorifik araglarla getirilecektir'
l
g_Teslim edilen parqa tavuk
etreiiiirr"v-"-*
I
tarafrndan gartnameye uygun oldulu taktirde
igin
0-5 cm uzunlukta veya ayrl olarak duran deri
ir
TC. Gtda' Tarrm ve Hayvancrlrk Bakanhlr
Sicil ve Grda Uretim sertifikalarl ve akredite
oter tasdikli suretlerinin ibrazt qartttr'
ambalajlanmlg + 4 derece veya daha diigiik
.
ra gOvde ya!r. yemeklik tuz' lezzet ve QeSn'
pigirilmesi ve dilimlenmesi sonucu elde edilen
olmahdlr.
tat ve koku olmah Yabancr tat kiifkokusu
Duyusal Ozellikleri : Tat ve Koku: Kendine has
olmamaltdtr.
iiriiLn
Eschericha coli (kob/g)
Eslrerichia coli 0157: H7
25 s'da bulunmamalr
55
istege g0re 5-10
kg'hk koli ambalajlarda teslim
edilmelidir'
r
bulunmalldir'
izni
iiretim
firmalarln
edildi!i
temin
ve
baharatlartn
uriinlerle kullanrlan katkr maddeleri
olmamahdrr'
frli""'f"" rc"f., Maddeleri: Anti bakteriyel % 0,1 soya proteini% 4 den gok
olmalrdrr'
yaf
oranr)
o%100
(etin
oldufu
sahip
tavuk eti Ya! oranr :% 20-25
. . ..
Et oranr
maddeler, igindeki mala
boyar
kullanrlan
imalindL
ambalajlarrn
edecek
temas
ile
CiJa maaaeleri
higbir gegirgenlik vermemeli ve toksin madde igermemelidir'
iJrlt u". iit"iir* mamullerle ilgili iso 22000 kalite sistem belgesi ibraz edilecektir'
Sicil ve Grda Uretim Sertifikasr"
TC.-Grd" Tur,nr ue Hayvancrhk Bakanhfr'ndan ahnmrg "Grdi
bulunmalrdtr'
ksi YonetmeliEiinin 25' ve 26'maddesinde
hdtr'
creti fi rma tarafindan kargtlanacakttr'
rda Kodeksi Yttnetmeligi htikiimleri uygulanrr'
itede en az
-l
EoC'de gahgan deep freezeleri
SOFRALIK CANLI ALABALIK
grubunda olmaltdrr' Bahklar i9 organlarr
AlabaLklar grup ozelli[ine gdre iofrahk Alabahk
temizlenmig olarak 160-180
gr teslim altnacaktlr'
!
arlak, mukoz tabaka su gibi renksiz ve saydam'
elastiki olmahdrr'
renksiz' saydam ve berrak olmaltdtr'
ravdr ilel taze' kuvvetli' kendine 0zgii
ftan ballk oranr toplam olarak %5'igeqemez'
l
ride herhangi bir sebeple meydana gelmig renk
cakttr.
TS 4621' TS 4622'ye
ue tag'ma iglemleriTS 4542'TS 4543' TS 4620'
gore
ca, ilgili teknik $artname hilkiimlerine
rnda YaPrlacaktrr'
bu standarfta atlfyaprlan TS'lan esas allnacakttr'
koyun ve k€gi siitleri veya bu siitlerin kanqrmttrtlmast sonucu elde edilmig olmaltdtr'
e homojen bir yaprda olmalr' mikroorganizmalardan
rt Yada Yumu$ak olmamaltdtr'
inde olmahdtr
lmalrdrr'
drr.
tr.
olmalldtr.
56
Beyaz Peynir Ambalajlarrnln N itelikleri
ydnde etkilemeyen'.hi9bir
Beyaz p"ynirler hig kullanrlmam,g temiz passtz, peynir kalitesini olumsuz
en
az 0,50 kalay' tenekelerden
lZ34'e'y'un
ve
TS
olan
yapmayacak pekilde kapatrlmrq
*riil'r,ir,,
ttll#;:#ffiilir'"r'"r
yaprlan ambalajlar igerisinde ohnalrdrr.
t"ri"a;
l7':er kilo.luk tenek"l:t9"
9lYI1i1:
apagrdaki bitgiler okunakl olarak silinmevecek, bozulmavacak
gekilde yazrlmrg olmaltdtr.
ii.runin ticaret unvanr veya ktsa adr, adresi veya varsa tescilli markasr'
Beyaz peynire ait
Tiirk Standartlarl Enstitiistiniin
i$aret ve numarasl'
Malrn adr
Tipi
Sr n
rfr
En az net aElrhBl (salamura harig kg olarak)
Yaprm tarihi
Yaprm sert numarasl
MUdiirlii![' Grda Sicil.ve. Grda
ue Havuanc,l,k Bakanhlr, Koruma Kontrol^Genel
ISO 22000 belgesinin noter tasdikli
Uretim sertifikalan ve akredite otun trrutiit"raan ahnmrq
i;;;
i;.;;;,
ilgili laboratuarlarda
inceleft irme hakkrna sahiptir'
aktlr.
S 591 ve standartta atrf yaprlan
TS'lart esas
alrnacakttr.
SADE SUT UHT:
rganizmalar yok edilmig,
oC
srcaktr[a rsrtrtarak sporlu ve. sporsuz m ikroo
"c_t45
ve
ktvamdaki siitler
tat
ttutli dayanrkli' normal
homoienize olmu9, oaa sl"aft'grnaa UoIutt"yu
il;"uHi;r;;;140
olmahdtr.
Fiziksel,kimyasalvemikrobiyo|ojikiizellikleriagalrdabelirtilendeferlereuygunolma|rdtr.
(min)
7o yafsrz siit kuru maddesi : 8 00
%iut yag
Asitli[ (iaktik
: 3'00 ve Yukartst
asit
r./^;..-r,,1
Yogunluk
^H
*-
cinsinden) 016+0'01
:1.030+0,001
_'_'-Y'u-t'
:6.60 -6,'75
_
-L r-(.)m' P 200 kg/cm' (min % 92)
: max. l0/ml (sPCA' 3 t1" 19l9l
: max l0/ml (SPCA' 2 giin' 55'C)
HomojenizasYon : /)
ffi'"i;
i'"rr"'nf
ile '
Belgesine, Grda Sicil Sertifikasrna.' Grda
imalata
TSE
S I l-92)Uygunluk Belgesine'
rtifi kaslna sahiP olacaktlr'
;d" b"littilen lanlar esas alrnacaktrr'
ilgili TS 1192
gun siitlerin' yaprm tekniline uygun t<oEullardi
her
im yaglr tipinde olmalrdtr' Ambalajlartn
lmamaltdtr'
da en az l6 gram olmaltdtr'
gr siit
I
ght yo[urtlann 100 gramrnda maksimum '5
yaPr bulunmalrdrr.
57
titre edifebilir asitlik laktik asit cinsinden ktitlece % 0,60'den azve%o 1,50'dan fazla
-YoEurtta
olmamaltdu.
-iogrnOun bir gramrnda l0'dan gok koliform bakteri, I 00'den 9ok maya ve ktif olmamal, E. Coli
bulunmamaltdtr.
peroksidaz deneyi negatif sonug vermemelidir'
-Yo[urtta
Duyusal Muayenede Aranacak $artlar
O'i gtirtinilg; i'arlak, si.it renginde, serum ayrllmasr olmamtg, gatlak ve gaz kabarcrSr bulunmayan
temiz ve homojen olmaltdtr.
sonra koyu bir
ii.iuur; 1(uq,kLl tagrkla alnan kesitte dolgun krvamda diizgtin yaprda, karrgtrrrldrktan
akrcrhk' iazanan serumu hemen ayrrlmayan yaprda
"#:tth yaprda ve homojen ormahdrr' ,. .. i
alkoliimsii ve yanrk kokusu ihtiva etmemelidir'
ya '
, hafif acrmsr hafif ki'ifiimsii, hafif sabunumsu
en YoPurllar olmamaltdtr'
urulup, kapatrlmahdrr' Ambalaja iligkin y<inetmellanrlan kapaklar saglr!a zarar vermeyecek
YaPrlmrg olmaltdtr'
li, Jilinmeyecek, bozulmayacak gekilde
vaztlmaltdtr.
markast'
unvanl ve adresi veya ktsa adt ve adresi varsa tescilli
TS 1330 'un i$aret ve numarasl'
Malrn adr,
'ni#""t" ti"*i
Tioi.
imalat tarihi, (giin,
Seri/ kod
olarak)
numarasl,
Net aArrltEt,
iiil;il;;
aY
,
yaprldrgr'
sutlerden imal edilenlerde, homojenize siitten
iir.uiu t"utiy"
"dilen
son kullanma tarihi veya raf dmrii'
vg.k1att
bir
igi yerlerde yabancr koku yayan maddeler ile
z kalmayacak gekilde muhafaza edilmgli
Kontrol Genel Miidiidiigii' Grda Sicil ve Gtda
nmrq ISO 22000 belgesinin noter tasdikli
u
ilgili laboratuarda incelettirme hakkrna sahiptir'
acakttr'
S 1330 hiikiimlerine gbre iglem yaprlacaktrr'
daftlarrna uygun siitlerin' yaprm tekniEine uygun
liPi olmamahdrr'
tat ve koku igermemelidir'
lr.
'dan az olmaltdr'
olmamaltdtr'
bakteri I gr'unda 10'dan gok olmamah E' Coli
an, insan saglrgrna zarar vermeyen ve dtqandan
lr. Ambalaj Uzerinde a$agldakl bllgrler
58
Firmanrn ticari unvant ve adresi tescilli markasr
Malrn adt
Tipi
irnalat tarihi
Seri/ kod numarast
Net aglrhEl
Firmaca tavsiye edilen raf timrii
Glda Sicil.ve- Grda
f.C. C,au, Ta-r,m ue Hayvancrlk BakanlIr, Koruma Kontrol Genel Miidiirliipii,
belgesinin noter tasdikli
Uretim sertifikalarr ve airedite olan kuruliglardan alrnmrg ISO 22000
suretlerin in ibrazl Frttlr.
iiuru. uyau utiir kere teslimi yaprlan siizme
yolur
a incelettirme hakktna
"n
sahiptir. Yaprlan tahlillerin maddi bedeli y0klenici firm
nu gurtnut"a" y"r almayan hususlarda G MT ileTS'
eri esas altnacakttr'
plastik veya karton kaplar iginde
filt|ga zararh olmayan, bir kez kullanrlan
den az olmaYacakhr'
olacakttr.
Ayranlarda Siit Yag oranl en azVo 1'5 olacakir '
imal ve son kullanma tarihi'
ni,r""i".ti r."pr""nao u"yu t up"tttuttdu tutlu u"yu tu'suz oldu!u'
alr16!r agrk ve okunur
yaprmcl llrmanln uo,, uJ*'i uuttt tescilli markasr' TSE damgasr'
.zellikleri,
olar
Ayr
T.C
Ure
;
iizii[iine
uYgun olacakttr'
ve Grda
for-uma Kontrol Genel MUdiirliifii' Grda Sicil
tasdikli
ardan ahnmrq ISO 22000 belgesinin noter
suretlerinin ibr^zl
sarttlr'
anr
ilgili laboratuarda incelettirme hakkrna sahiptir'
lanacaktrr'
lannln ilgili maddeleri esas altnacakttr'
kumlu bir
e kokusu bulunmayan' stztnttlt' unlu'
27
goko/o
en
derecesi
arastnda' asitlik
gtistermeyen ve I
, mat, solgun bir gtiriiniim
Yallal olmaltdtr'
yagsrz
ir. Bu geqit tereyaplarrnda sutten geqen
31f1ap9!
:!,it3n maddeler,drqrnda higbir
-)--
vazr lmaltdtr.
ad, veya Tescilli markast, adresi
Standardrn igaret numarasl
iirma
Seri numarast
Malrn
adr
Qegidi
S rntfi
Net agrrhk ( gr)
imal tarihi
59
Grda Sicil ve Grda
T.C. Grda, Tarrm ve Hayvancrhk Bakanhpr, Koruma Kontrol Genel Miidtirliilu,
noter tasdikli
Uretim sertifikalan ve akredite olan kuruluqlardan alrnmrg ISO 22000 belgesinin
suretlerin in ibrazt garttlr.
KA$AR PEYNIRI:
v."", D.-.;rtpri. TS
I0
tR
veva TS I 019'a uvsun inek, koyun, kegi stitleri veya bu siitlerin karlglm-
lidir.
:
a Kontrol Genel
Miidiirlii[ii,
Grda Sicil ve Grda '
lr,.
!
uya veya gerekti[inde siit tozu' qe1ni1
syf]
Katkr Maideleri Ytinetmelili'nde kabul
llerle eritilmesi sonucu elde edilmig
I
*[ltlll;",r
geqnili eritme peyniri olarak imar edilebilir.
r"0" olarak veya gegitri maddereri ilavesi ire
Krem PeYnir
Nitelikleri
:
Pevnirlei l. srnrf tam yalh tipte olmahdrr'
;"#1,-,';;a,;tiri"i-pi,i"r."*^iii"rl
sert vela
,"migina"n ileri gelen delikler bulunmavan, fazla
r maddelerinden bagka herhangi
bir yabancr madde
kiitlece en gok %7 olmahdrr'
o/030 olrnaltdtr'
tlece en az
Krem PeYnir Ambalaj Nitelikleri:
za9'ytT:l"n ve peynir kalitesini bozmayan
Krem peyniri, hi9 kullanrlmamrg, insan sapll$rna
is gt ota'ur kiigik porsiyonlar halinde paketlenmig
ambalaj malzemeslno"n yup"rnlg oitutJti
okunakh olarak silinmeyecek' bozulmayacak
Ptgtrrrlrr'
e)
Malrn adr veYa geqidi
imalat seri / kod numarast
ihtiva ettigi 9e9ni rnaddesi
Cesidi, S rn rfi, TiPi.
6n az
let agtrlrlr (Cr. veya Kg olarak)
imalat tarihi (aY ve Yrl olarak)
60
hakkrna sahiptil'
Kurum; ayda en az bir kere, teslimi yaprlan peyniri ilgili laboratuarlarda incelettirme
incelemelerin mali yiikii yiiklenici firmaca karqtlanacakttr'
Belgesine, GrdaSicil
Uretici firma akredite olan kuruluglardan ISO t00l Kalite Giivence Sistem
Belgesine, TSE'
TSE
Uygunluk
Sertifikasrna,
Sertifikasrna, Grda ile Temasta B;lunan Materyal.sicil
olacakttr.
imalata yeterlilik Belgesine ve mamule ait Crda Uretim Sertifikasrna sahip
gu;urtnur"a.V"ralriayanhususlardaG.M.T.ileTS5glvebustandardaatrfyaprlanTS'larresas'
allnacaktrr.
ionprvxin,
ve en az
p"ynir TS 1335g'e uygun peynir alt suyunun teknigine g6re asitlendirilmesi
tat ve
renk,
has
kendine
edilen
elde
sonra
pasttirizasyon logullarrnda rsrl igiem uygulanmasrndan
io,
r
aromast olan mamul.
Lor Peynir Nitelikleri:
Titrasyon asitligi (Laksik asit) en fazla%.,0,50-0"15 olmaltdtr'
PH'sr 4,75 - 5,50 arastnda olmaltdtr'
5 olmalr.
Grda Uretimi Sertifikasr ve akredite olan kurulugl
suretlerinin ibraz gartttr.
silinmeyecek'
rn iizerinde agaprdaki bilgiler okunakh olarak
bozulm
Firman
lmaltdrr'
varsa tescilli markast'
Bu standarttln i$aret ve numarasl'
Mamuliin adr,
imalat tarihi,
Parti, Seri veya kod numaralartndan en az biri'
Net kiitlesi,
Firma taraflndan tav
KAHVALTTLIK
Lrtlmast
sonucu tekniline uygun
Pastorlze eo
peynirden
olarak peynir suyu uzakla$tlrllan taze
renkte, yumugak bir yaplda,
ekgime g0ri.ilmemelidir'
sun olmaltdtr' Agrk krem
tat ve koku' actlaqma'
-yabancr
teml
il$i##;ffJlt"
r"Yii'j}illill*'ffi tr;lili"
;:iH||:,i"J;'iffiffi;;ii;1;;tr*n-,
s
pixxixrnnrY.LGr
ilSl}
#'T,Jiii'.u,u
korlerde
t"'l::"i"'ll"J:o,i::X3:]
i,ii"*tli*l;
GyT"""'fj::-?,",J*'i'"'
IS9
;; ;ffi ;;i;;;;r;;''s
l Yr:':
s"il"; M"'"'v{s:rf
l?i!,lili'","ilil":'arda ve r20 adetrik
c,a"
r'
p
?q9
*1'I[":I?:J:::fl
i:'i,:
u" n.u.ur" uit crda rI etim Sertinkasrna sahip olacaktrr'
kremastntn 6zer.orarak seeirmie
kiiltiiit*f'Jf,].'-i;::e"::,':lj::i?i'J;
L?T"d;::X'JT,l'J:l':iJ':fiIil":'iff::'iff;:ffiff16;*iy*:'i::l*:*ayelnde
ytiksek r
:,:::;t"'::L?:i;:'ilu"#;;;il"'i"iiii"a"'"r'ip9rT."l:rk"'lklJ:1-d"::.:::i::l'j,T
olmahdrr.
belirtilen
ik 6zellikleri
n
at
S2
(TS l33l Madde 2 3 5'
6i
% asitlik (Laktik asit)
Su daArllml
5,50 + 0,5 (TS l33l Madde 2.3.3.)
En cok 2 (TS 133 I Madde 2.3.4.)
En cok 0,18 (TS 1331 Madde 2.3.8.)
En cok 2 (TS 133 I Madde 2.3.4.)
Koliform
Kiif-Maya
Neeatif / gr (TS 6910)
t0 / er (TS 1331 Madde 2.3.9.)
o%
su miktan
o/o
YaEsrz kuru madde
I
Piknik tereyallannrn rengi homojen yaprda, kendine has tabii sarrhkta temiz, hoga giden tath bir tat v€
kokuda olmalrdrr.
piknik tereya[larr l5 gr'hk ambalajlarda ve 120 adetlik teslim kolilerinin iginde bulunmahdrr. Mal
tesliminde so$uk zincirin bozulmamrg olmasrna dikkat edilmeli; raf dmrii 6 ay olmahdtr.
Kurum, ayda-en az bir kere teslimi yaptlan tereyaglnl ilgili laboratuarlarda incelettirme hakkrna
sahiptir. incelemelerin mali yiikii fi rmaca karqtlanacaktrr.
Ambalajlarrn iizerindeki iiriin etiketleri Tiirk Grda Kodeksinde tantmlanan bilgileri igermelidir.
Grda
Uretici hrma akredite olan kuruluglardan ahnmtp ISO 9001 Kalite Giivence Sistem Belgesine,
Belgesine,
TSE
Uygunluk
Sertifikasrna,
Sicil Sertifikasrna, Grda ile Temasta Bulunan Materyal Sicil
TSE imalata Yeterlilik Belgesine ve mamule ait Grda Uretim Sertifikasrna sahip olacaktrr.
Bu lartnamede yer almayan hu.suslarda G.M. T. ile ilgili TS'da belirtilen gartlar esas altnacakttr.
TURUNCGiL MEYVELERi: (Portakal. Mandalira. Limon)
l
Turunggii meyveleri biitiin, sallam, temiz olmalt bunlarda donmadan meydan
esuyunu kaybetmesi, mekanik tesirlerden olugan yaralanmalar
u. ..yi"
"tinin
meyvelerinin
Turunqgil
sikler yabancr tat vi koku, aqrrr nem bulunmamaltdrr'
olmahdtr.
iu.rnggit meyveleri
gdriiniig' geligme ve
ekstra veya birinci srnrf niteliklere sahip olmalldrr' $ekil'
6iellikte olmalt, iiri.iniin genel giiruniigiinii, dzelliklerini ambalaj igindeki
durumunu bozacak h igbir dziirii bulunmamahdlr'
190-220 gt, mandalinadag0-l l0 gr' limonda 120 gr olmahdrr'
Meyvelerin
bozuklufiJ, kaba, kahn kabuk bulunmamahdrr. Bir partide teslim
Meyvelerin
-olgunluk,
renk, orijin ve boy baklmlarrndan bir iimek
it, srnrf,
edilen turun
.*[filtrtnO*
9e9ide has
olmaltdrr.
me olarak teslim edi lebilir'Ambalajlar turunqgil
nitelikte yeni, temiz, kokusuz,
asa" kutu, sepet, file) yapllmrq olmahdrr'
standarda atlfyaptlan TS'lart esas altnacakttr'
ar vermeyecek
ELMA:
'
gdrtilebilir yabanct madde ve ilag artrkla.'
rr. Kurtlu, ezik, yarah, kiiflii, giirtikliik belirtilerine
niteliklerine sahip olmah Elmalar yetigtikleri
e meyve etl sa[lam olmahdrr' Aplrhklan 190-210
e
zarar vermeyecek nitelikte yeni, temiz' kuru'
elerden yaprlmtq olmal ldrr' Ambalaj larda iiriine
r,
u standarda atrfyaprlan TS'lan esas altnacaktlr'
a'
bulunmamaltdr
Bu sartnamede yer almayan hususlarda TS
l8l7
esas ahnacaktrr'
62
KiRAZ \rE Vi$NE:
Kiraz ve Vigneler; biitiin, tLZe gdriiniisli.i, sa[lam, srkr etli, temiz ve saplarr diigmemig olmalr bunlarda
gtizle gdriilebilir yabancr madde artrklarr, yabancr koku ve tat bulunmamaltdtr. Kiraz ve Vigneler
u"yu birinci srnrf 6zelliklerine sahip olmahdrr. Kiraz ve vignelerin iizerlerine gUne$ yanlkllgl
"krttu
gatlaklar, dolu lekeleri veya zararlar olmamahdrr. Partide teslim edilen kiraz ve vigneler renk, ;ekil, 1
gdriiniig ve olgunluk bakrmrndan bir omek olmahdrr. Ambalaj kiraz ve vigneleri iyi bir durumda
tutacak ve saghga zarar vermeyecek yeni, temiz, kuru, kokusuz, ahiap, mukavva veya diler uygun
maddeler igerisinde olmahdtr.
Ambalajlarrn iginde higbir yabancr madde bulunmamahdrr. Kiraz ve vigneler ambalajlara ddkme
.
olarak fikat srkr bir Eekilde yerlegtirilmeli ve ambalajlar silme doldurulmug
Bu sartnamede belirtilmeyen hususlarda TS 793 esas alnacaktrr.
olmaSdtr.
ERIK:
Erikler; biitiin, saglam, temiz olmalr, bunlarda giizle g6riilebilir yabancr madde kimyasal madde
gdstermeli,'
artrklari, anormal-drg nem, yabancr koku ve renk bakrmlartndan gegidin tipik iizelliklerini
Erikler
bulunmamahdrr'
kusurlarr
kabuk
etkileyen
,nryu.nin genel gririin0muni.i, dayanma <izelliIini
srnrll
boy,
erikler
edilen
partide
teslim
9e9it,
eksira ue ll srnrfozelliklerine sahip olmahdrr. Bir
olgunluk ve orijin bakrmlartndan bir <irnek olmalrdtr'
kokusuz'
eilUalallamada tullantlan malzeme salhpa zarar vermeyecek nitelikte, yeni, temiz'
- ..
ambalajlara
Erikler
,rr.uur,'u uu. olmaldrr. Ambalajla.n iginde higbir yabanct madde bulunmamaltdrr.
dOkme olarak konulabilir.
Bu gartnamede belirtilmeyen hususlarda TS 793
esas ahnacaktrr'
KAYTSI:
-K;y;;;;
kimyasal madde
biitiin, sa[lam, temiz olmah, bunlarda giizle goriilebilir yabancr madde,
artrklarr' anormal dr$ nem yabanr koku ve tat bulunmamfl'loiJit,u,".,",
gtistermeri, drt gdriinrimu ve
amalidrr. Meyve eti tamamen sallam olmahdtr'
larrndan bir Omek olmahdtr'
r. Ambalaj lamada kullantlan malzeme saghga
ah;ap, mukavva ve
diler uygun malzemelerden
midde bulunmamahdtr' Teslim edilen kayrsrlar
altnacakttr.
KARPUZ:
ijlebilir vabancr rnadde bulunmayan) yeterince
mundaki tipik ozelliklerinr giisternrelidir)
anormal dts nem bulunmamaltdtr'
ahdrr. Qegidine dzgii ve qekilde iyi geligmig
vansal ve bitkisel parazitlerle hastahklardan
n uzun olmamaltdtr'
'. Karpuzlar ambalajh veya d6kme olarak teslim
rrijin bakrmlanndan bir iirnek olmaltdtr'
BugartnamedeyeralmayanhususlardaTSll32vebuStandarttaatlfyapllanTS'lartesasaltnacakttr'
MUZ:
laqmtgr olacak, ham ve sert olmayacaktlr '
rr. Dr; kabukta kararma ve gillenme
aktrr'
elerinden kesilmig olarak salkrmlar halinde
getirilecektir.
dan zarar gdrmemi9, yrkanmamrg olmalr bunlarda
rmal dr; nem' yabanct koku ve tad bulunmamall
ahdrr' Qilekter tam geligmig olmalr' Taqtmaya ve
olgunlukta bulunmalrdlr'
63
I
Qilekler, ekstra srnrfin niteliklerini tagrmah, tistiin nitelikte olmalr, gekil ve renk bakrmrndan 9e9idi
tipik ozelliklerini gdstermeli. Olgunluk ve renk ve irilikge bir iimek ve gciriiniigleri ve parlak olmalt,
.
iizerlerinde toz, toprak bulunmamaltdtr.
yeri
timek
bir
gegit,
bakrmrndan
gilekler
ve
iiretim
partideki
srnrf,
boy,
olgunluk
Teslim edilen
olmahdrr.
Ambalajda kullanrlan malzemeler mukavva, plastik, ahgap vb. maddeler olabilir. Her 9e9it ambalaj
malzemesi ile ambalajlarda ddgenecek kalltlar yeni, temiz, insan salh$rna ve iiriine zararstz olmaltdtr.
]
Ambalajlarda tag, topiuk ub. yaban"r mad-deler Lulunmamalrdrr. Qileklir ambalaja herhangi bir
srralama yaprlmadan oldu[u gibi silme doldurulabilir.
Bu sartnamede belirtilmeyen hususlarda TS 185 esas allnacaktlr.
YENiDUNYA:
yenidiinya meyveleri; biitiin, saplam, temiz olmah, bunlarda gdzle goriilebilir yabancr madde,
kimyasaimadde artrkla., anormal drg nem, yabancr koku ve tat bulunmamaltdtr. Yenidiinya
gijd'iniimii ve
meyveleri, gekil, geligme ve renk baktmlartndan gegidin tipik 6zellikleriD gdstermeli; Dli
olmaldlr.
dayanma oielligiii eikileyecek kusurlarr bulunmamaldrr. Meyve eti tamamen sa[lam
renk
ve orijin
olgunluk,
srnrf,
olmah;9e9it,
Yenidiinya meyveleri en az I .s rnrf n ite liklerine sahip
bakrmlartndan bir timek olmahdlt
verTneyeceK
Ambalajlara dtikme olarak konulabilir. Ambalajlamada kullanrlan malzeme sa[lt!a zarar
yaptlmtg
nitelikti yeni, temiz, kuru, kokusuz, ahqap, mukawa ve diler uygun malzemelerden
olmahdrr..Ambalajlarrn iginde higbir yabanct madde bulunmamalrdrr'
rlar veya di[er bozulmalardan dolayr tiiketime
arttklan anormal dtE nem, yabanct koku, tat ve
kadar geligmig ohnaltdrr'
geye gtire 9e9idi tipik dzelliklerini gdstermelidir'
itd.k icin" uzanan deli$i olan geftaliler
bulunmamaltdrr.
sartya donmeye'
goriiniitii baktmtndan meyve kabu[unun yeqilzemin rengi' sart etli geftalilerde
kaybederek
donuklufunu
renk
u"yuritli ge{ialilerde ise alannaya bagla-mrg olmah ve krrmrzr iist
Renk
iginde higbir yabanct madde bulunmamahdlr' $art
alrnacaktrr.
KAVUN:
riilebilir yabancr madde bulunmayan, yeterlnce
ve renkte yabanct tat ve koku igermeyen, anormal
olmah zerlerinde gatlak ve bereler
bulunmamaltdtr'
r' Kavunlar slntfdzellipi olarak l srnrf niteliklerirti
Kavunlart
ta$|mal|dlteslimedi|ebilir.Partidekikavunlargegit'srnrfve
orijinbakluk,geligme,geki|,renkveaprr|rkgaolabildi[ince
bir ttrnek olmalrdrr.
;; ;;;;;.;;
y.r atmayan
alnacaktrr.
hususlarda TS 1073 ve bu standartta atrf yaprlan TS'ler esas
ARMUT:
Armutlar' sulu ve tatll olacakhr'
biy"r"a" t.of"" olgunlagmrg iyi cins ve lezzetli armutlardan solacak'
yenikli' ekgi' ezik' gokyumugak ve gok sen'
Buruk lezzette ve kuru olmayacakttr' Qiiriik' kurtlu, kurt
yaz ,
[i.ii"" q";".1, .lmayacaktir. Krg aylarrnda 2'li veya 3'lti kasalarda teslim edilir. Armutlar
avlartnda tekli kasalarda getirilecektir'
itznuzuw
Tazetlziimiyiciiiziim|erdenolacakttr,ezik,ekgi,tabiiha|ive.rengi.'
depigmig,giir0k,korukiiztimlerdenolmayacakttr'Uziimlersa|krr-rrhalinde
muntazam istiflenmig olacak teslim edilir'
oLliktrr. Urutf
64
PATATES:
Patatesler; butiin, sallam, temiz, srkr yaprlr kabu$u di.izgtin ve iyi olugmug ve filizlenmemiq olmahdrF.
Yabancl tat ve koku, anormal drg nem igerrremelidir. Gdriinu$lerini etkileyecek gatlaklar, kesikler,
kemirici izleri ve berelenmeler bulunmamahdlr. Kabufun normal soyulmasr ile kaybolmayan yegil
krstm bu lundurmamaltdtr. Patateslerde don zararlart bulunmamaltdtr. Tane aprrhklarl 150-200 gr
arasrnda olmalrdtr.
Ambalajlamada kullanrlacak malzemeler salhla zarar vermeyecek Sekilde temiz, sa[lam, kokusuz,
file, jiit, guval, torba vb. malzemelerden yaprlmrg olmalrdrr.Ambalaj lann dolu halde net alrrh!r 80
kg'r gegemez.Ambalajlarrn iginde higbir yabancr madde bulunmamaltdrr.
altnacaktrri
B-u Eartnamede y"r almayan hususlarda TS 1222vebu standarda atlfyapllan TS' lan esas
KURU SOCAN:
Kuru sofianlar; bi.itiin, saglam, temiz, don vurmamlg en azrndan iki dl; kabulu ve sapt kurumug olmalt'
tiiketimiengelleyecek gijiiikltik ve bozukluklar, gozle gdrglebilir yabancr madde, anormal dtq nem, .
yabancr tat ve koku bulunmamaltdtr. Solanlarrn saplart 4 cm'den ktsa olmaltdlr'
lo$anlar gegidin tipik dzelli[ini gOstermili, srkr ve sert siirmemiq filizlenmemig olmah, bog veya kaba
Tane
,upi,, unor*ul geliqmeden Oitirti gipkinlegmemig olmal, k6k p1iskiilleri kopartlmamtg olmaldtr.
aprrlarr 100-150 gr arastnda olmaltdtr.
tirnek olmaldtr. Solanlar
H-er ambalaj igindleki so$anlar 9e9it, srnrf, boy ve orijin bakrmtndan bir
,*Uuiuj lq"iirina" ury"-doklll"-oi"ruk teslim edilebilir. insan salhltna zarar veffneyen malzemelerdeit
gegmemelidir' Bu gartnamede yer almayan
v"p'iui"tU"fu.if "r igirindeki solanlann a[rrhIr 50 kg'r
'IS
796 esas altnacakttr.
hususlarda
TAZE SOEAN:
am,Iemiz ve taze gdriinii$te, tohuma kagmamtp,
e hastahk nedenleriyle olugan zararlarla" giibre,
az gdvde ve yeqil yaprak krsmr ezilmemig,
Taze so$anlar demet halinde teslim edilmeli ve
lmahdrr. Bu gartnamede yer almayan hususlar{a
TS 2121 esas ahnacakttr.
SALATALIK:
diri, actlaqmamtg ve temiz olmall' tizerinde aqtn nem
ialatalrklar; biitiin, saplam, taze gijriinii$lU,
latalrklar iyi geli;mi;, geqidin kendine ozgii
mamaltdtr' Ambalaj lamada kullantlan malzeme
rrn igerisinde toprak' yaprak vb yabancr maddeler
arda TS 1253 esas altnacakttr
DOLMALIK VE TAZE
Sib;er;
,""f a,l
!
BIBER:
yabancr koku' tat' anorUiitiin, saglam, temiz, iyi geliqmig, taze gdriiniiglu olmalr' bunlarda
iran, iyitegmemTg yararia. giin-e , yaniklan bulunmamahdrr. Saplarr I cm'den krsa
""r,
don
olmahdrr.
ve boy bakrmrndan bir ijrnek^olmalrdrr
i"rii, "air"" partideki dolmalrk ve taze biberler gegit, srnrf mertebe
bir tirnek olmaldrr' Dolmalk ve
;;;i";;;y'i;'i rzun biberler uzunluk ytiniinden mtmkiin
Biber|er I .srnrf niteliklerine sahip
taze biber|erde ye$il, sarl, klrmlzl gibi renk karrgrmr olmamaltdrr.
olmahdrr.
verneyen'
Oof*e olarak konulabilir. Ambalajlamada kullanrlan malzeme safh$a zarar
iiriinun ;iteligini koruyabilecek nitelikte olmahdrr'
Bu gartnameJe yer almayan hususlarda TS 1205 esas ahnacakttr
DOMATES:
engelleyecek bozukluk' 96zle
Do.ate,Ie,; bi'itiin, saglam, taze g6riiniigli'i temiz olmalr, bunlar ttiketimi
nri"f"il-u
g#l"bill, yuU-.'
ma-dde, anormul dtq nem, yabanct koku ve tat bulunmamaltdtr'
100 gr olmalrdlr. Domatesler
t)omatesler ekstra ve L srntt nrteliklere sahip olmalrdrr. Tanesi en az
ren niteliBine
y*"rii otguntugu eriqmig ve renk olugumunu klrmlzr veya turuncu diye adlandrrrlan
erignrig ohnaltdtr.
i"lii.
"a;f*
partideki domatesler 9e9it, tip, srnrf, boy ve oruijin bakrmtndan bir ijrnek
olmahdrr'
'
65
Ambalajlama, kullanrlacak malzeme insan sapltltna zarar vermeyecek nitelikte yeni, temiz, kuru,
kokusuz, ahgap, mukavva vb. malzemelerden yaprlmrg kasa, kutu veya sandrklar olabilir. Domatesler
ambalajlar igerisine kat kat ve diyapol gekilde istif edilmig olmaltdtr.
Bu qartnamede yer almayan hususlarda TS 794 esas alrnacakttr.
PATLICAN:
Patlrcanlar: biitiin, saglam, temiz, taze gortiniiglii, yeterince geliqmiq, eti liflenmemig veya odunsu
yaprda ve gekirdekleri agrn geligmig olmamah, srkr yaprl ve gegidine has renkte olmalldlr. Bunlarda
yabancr tat ve koku, anormal drg nem bulunmamahdrr.
Pat|canlar afrrltklartna gore orta boy ijzelliklerini tagrmah, uzunlulu l2 cm'den, alrrhklarr 150
gr'dan az olmamalrdrr. Pathcanlar l.srnrf niteliklerine sahip olmahdrr.
Pathcanlar ambalajh olmah, teslim edilen parti gegit, tiretim yeri, srnrf, boy bakrmlartndan, ayrtca
geligme ve renklenme dereceleri agrsrndan bir <irnek olmahdrr. Ambalailamada kullanrlacak malzeme
sallrga zarar vermeyecek ve iiriinii iyi bir gekilde muhafaza edecek niteliklere sahip olmahdtr.
Bu gartnamede yer almayan hususlarda TS 1255 ve bu standartta atlfyaprlan TS'larr esas altnacakttr.
PIRASA:
Prrasalar; biitiin, taze gtiriiniiglii, tohuma kagmamr', sallam, temiz anormal drq nemden artnmtg, baytct
koku ve tad igermeyen yapraklartntn u9 krstmlarr diizenli bir gekilde kesilmig olmalldtr'
prrasalar demet halinde ballanmrg olmahdrr. Demetlerdeki prrasalar 9e9it ve stnrfyantnda geligme ve
renk bakrmlarrndan bir iirnek olmahdrr.
Bu gartnamede yer almayan hususlarda TS 795 esas ahnacakttr.
HAVUQ:
Havuglar; biitiin, srkr yaprlr, kofla;mam19, gatallagmamlg, yan kdk oluqturmamlg, sa$lam, yenilemeye;
gibi kahntrlar
cek derecede curi.ime ve bozulmalarr bulunmayan, temiz, kum, toprak, ve organik madde
nem
bulunmadrq
igenreyen, odunlagmamrg, tohuma kalkmamrg olmah, yabanct tat ve koku, anormal
dzelliklerine
rnal,dri. Havuglar igzgiin satrh; taze gijrtiniislii, normal qekilli, gatlamamrg, gegidin tipik
sahip olmalr, berelenmeler ve yartklar don zararlarr bulunmamaltdtr'
Havuglar agirlrkla.na g6re ise | 00- I 50 gr arasrnda olmalldtr. Havuglar ekstra veya l-srnrf..
sahip olmaltdrr. Boy uzunluklarr l5 c r'yi gegmemelidir. Bir partide teslim edilen
niteliklerin!
havug|argegit,srnlf,boy'piyasayaarzgek|iveorijinbaktmlartndanbircirneko|ma|rdrr.
yeni, temiz, kokusuz, ah'ap,
An,,Uutultu.uau futiunri""u[ *up"r" sa!1!a zarar vermeyecek nitelikte
lralde
firukavv"a ve diger malzemelerden yaprLnrg olmahdrr. Havuglar ambalajlara dokme
irilebilir.
yaptlan TS'lart esas altnacakttr'
su.tnur"d" y"r almayan hususlarda TS I 193 ve bu standarda atrf
LAHANA:
gtiriime ve bozulma
lun"nutu.; biitiin, temiz, gdzle gtiriilebilir yabancl madde igermeyen saflam(
yerleqt
'Bu
_
gdriiImeyen)tazegtirtinugIii,yapraklarlgevgemig,aglImamIgvegigeklenmemigolmaItdtr.Lahanalarda
E"r"ffrr"l-, UocJt ve nastairtiann seb;p;ldugu zanarlar, don vuruklan anormal dr' nem, yabanct
gekilde kesilmig olmalrdrr.
tad ve koku bulunmamalrdrr. Sap en alt y;pragri biraz altrndan dtizgiin
tagrmalr,
Lahanalar I. stnlf niteliklerine sahip olmah, a[rrhk boylamasrnda orta srnrf iizelliklerini
gr
olmaldrr'
(rrmrzrlihanalarda
arasrnda
500-1000
aprrllk
istenen
2000-3000 gr arasrnda olmaldrr.
gekil
renk
ve
orijin,
parti,
srnrf,
9e9it,
Lahanalar d6kme olarak teslim edilebilir. Teslim edilen
olmahdrr'
drnek
bir
bakrmtndan
a; i".tnu."a" y.r almayan hususlarda TS | 075 ve bu standarda atrf yapr lan TS'la' esas altnacaktlr.
ISPANAK:
Ispanaklar; saglam, taze gdriintiglii, temiz olmalr, yabancr koku ve tad da ol
toprak, giibre,-ilag ve par;zit kahntrlart bulunmamaltdtr' Qigeklenme belirti
lann
Yikanmig ,.punuklut'n sularr iyice suzdiiriilmiit olmalr, koklii rspanaklarda
altrndan I cm'yi gegmemek iizere kesilmig olmalrdrr'
Ispanak
irpu""tru. i.sinrf"niteliklerine sahip olmahdrr. Ispanaklar yaprak halinde veya kdklii olabilir'
taze
renk
ve
normal'
vapraklan biittin halde gesidine ve toplama zamanlna gdre kendine dzgu,
'g"'."ri"
Uzerierinde gtiriiniiqtinti ve yenilebilmesini etkileyen panzitve hastalk zararll larr
l0
"f."hOrr.
ve don vurmuq olmimalrdrr. Yaprak halindeki rspanaklarda yaprak saprnrn boyu
f,ulunmamalr
cm'yi gegmemelidir.
66
Bir partideki teslim edilen rspanaklar gegit ve srnrf bakrmrndan bir omek olmahdrr. Ambalajlamada
kullanrlan malzeme iiriintiniin uygun gekilde korunmasrnr saplayacak ve insan salhprna zarar
vermeyecek gekilde yeni ve temiz tahta, mukavva veya di$er malzemelerden yaprlmrg olmahdrr.
Teslim edilen partide yaprak halende ve kdklti rspanaklar bir arada konulamaz. Ambalajlann briit
a[rrlrfr l0 Kg't gegemez. Ambalajlarrn iginde rspanalrn kopmug gigekleri ve sararmtq yapraklart,
:
,iuri u" ,uiurrltotlar ve baqka yabancr maddeGr bulunmimalrdtr'
Bu gartnamede yer almayan lrususlarda TS I130 ve bu standarda atrfyaprlan TS'larr esas alrnacakttr.
KARNIBAHAR
Karnrbaharlar, biitiin, taze goriiniilli.i, saglam, temiz, tiiketimi engelleyecek hayvansal parazitlerin ve
hastafrklarrn sebep olduklarr zarar izleri, belirgin don vurmast, bere ve giiriikler bulunmamahdrr.
Bunlarda yabanct tad ve koku ayrtca anormal drg nem bulunmamalldtr.
Kamrbaharlartn tag krstmlarr; iyi geligmig, yapraklarr diri, gok srkr dokulu, beyaz veya hafifkrem
renkli, krsaltrlmrg yapraklar diizgiin kesilmig taze gOr0niiglii olmalrdrr.
Bunlar gegit, srnrf, boy ve piyasaya arz qekilleri bakrmrndan bir drnek olmahdrr. Alrrhklarr | 000- '
1500 gr arastnda olmahdrr. Kamrbaharlar yapraksrz olarak veya krsalhlmrg yaprakh olarak teslim
edilebilir.
Bu tartnamede yer almayan hususlarda TS 1074 ve bu standarda atrfyaprlan TS'lart esas altnacakttr'
Cerekti gtirtitdiigiinde muayene komisyonu kamrbaharr dondurulmuq talep edecektir. Firma her
mevsim istendiginde dondurulmuq getirmek zorundadtr.
SEMiZOTU:
piyasada satrlan iyi cins ve taze semizotlarrnda olacaktrr. Sararmrg, porsiimij$, kartlagm_l$, tohuma
Demetler halinde'
kagmr9, ezik, gurik, krrr9mr9, gamurlu ve normalinden fazla rslak olmayacaktlr'
yabancr
cisimler
kOil".l.yenecek k'srmdan itibaren kesihniq olacaktrr. Demetler iginde
bulunmayacakttr.
SAKIZ KABAGI:
renginde, pdrsiimemig, temiz,
Sakrz kabaklarr; biitijn, saglam, taze gdriintiglii, gegidin kendine ozgti
gigekler-bulunmamaltdr'
yabancr tat ve koku igermemeli, agrrr dr9 nem ve
veya orta boy olmaltdtr' Tane
kabaklar ekstra veya l.srnrf niteliilerini ta5rmaldrr. Boylamada kiig1ik
alrrhklarr 180-200 gr arasrnda olmahdtr.
iist 4 srra halinde dizilmiq o.lmaldrr. Ambalajlamada iirtnti
haztrlanmlg kutu ve kasalar
koruyacak nitelilite ahgap, mukawa veya diler uygun malzemeden
[ul"[iu.
un.,Uutultr
kullanrlmalrdrr.
g; i"nnur"a"
ie bir ambalajda
atrf yaprlan TS'lart esas altnacakttr
V"r almayan hususlarda TS 1898 ve bu standarda
MARUL:
Marullar, biitiin, saflam, taze gdriiniislii' temiz ve k
bulagrkh, yapraklardan ayrklanmrg, kimyevi giibre
gigeklenme belirtisi gostermemlg, (tohuma
vakrn ve diizP,iin olarak kesilmig olmalrdrr.
srntf ni
madde bulun-mamalld rr. Marullar
srkr, derli, toPlu ol
I
ivi
eet
6ul
etkileYen zararlar
oluqmu
insan salltlrna zarar ve
g<ibeli iyi
malzemelerden yaptlmtg,
Marullar ambalajlata, aralarnda fazla boqluk kalm
yerlegtirilmelidir.
'su
s^.tn"r.d" y"r almayan
orger
r'
hususlarda TS 1lg4 ve bu standarda atrfyaprlan TS'larr esas allnacaktlr.
MAYDANOZ:
Mayda
olmalt,
ormam
iir"J"rina" p*urit
.-;
gormemi;, taze ve kdrpe goriintl$lii solmamrg' sa$lam ve temiz
rt ilag kairntrlarr ve atlrr nem bulunmamalt' yabancr koku ve tat
mig vi birlegik yapragrn biitiin yaprakgrklan tam olrnal' .
olugan zarailar bulunmamah' geqidine dzgii renkte
soiuktan
ve hastaltklarla
olmaltdtr.
67
i
Her demette en az 100 gr maydanoz bulunmaltdtr. Demetler en alt yaprakgrk ayrrm noktalarl bir
hizaya gelecek bigirnde sarrlmahdrrlar. Bu hizadan itibaren yaprak sapr uzunlu[u l0 cm'yi
gegmemelidir.
Bu gartnamede yer almayan hususlarda TS l8l6 ve bu standarda atrfyaptlan TS'lan esas altnacakhr.
KESTANE (HELVACI) KABAGI:
Kestane kabaEr; biittin, saElam, temiz, taze g<irtiniiglii, olgun, kabuk rengi kurguni beyaz, et rengi
sandan koyu twuncuya kadar degi$en tonlarda olmall yabancl tad ve koku igermemeli, gekil
bozukluklarr ve iizerinde higbir yabancr madde
Kestane kabaklarr dtikme olarak teslim edilebilirler. Uriin gegit ve srnrf bakrmrndan bir <irnek
olmahdrr. Bir parti igindeki en kiigiik ve en btiytik kestane kabaklan arasrndaki fark 5 kg.r
gegmemelidir. Tane a!rrhklarr 5-10 kg arasrnda olmahdrr.
Bu gartnamede yer almayan hususlarda TS 1897 ve bu standarda atrfyaprlan'IS'lart esas alrnacaktlr.
t
bul'rnmamaftdtr.
SARIMSAK:
Sarrmsaklar; biitiin, srkl, sallam, temiz, don ve giinegten zarar gdrmemig olmamalr, kiif izleri, drgtan
gdriilebilir filizlenme belirtileri, anormal dtg nem, g<izle giirUlebilen yabancr madde, yabancr koku ve
tat
bulunmamalrdlr.
.
Sarrmsaklar, geqidin kendine <izgi.i renginde, ba;lan diizgiin kesilmig, iyice temizlenmiq, kusursuz ve
disleri srkr olmaltdtr.
Teslimi yaprlan partideki sarrmsaklar gegit, srnrf ve boy bakrmlanndan bir <imek olmahdrr.
Sarrmsaklar d<ikme, demet ve hevenk olarak verilebilir. Demet ve hevenklerde sap firesi gtiz tiniinde
bulundurulacaktrr. Saplar gdvdeden en 9ok I cm uzunu!unda kesilerek fireden d0giilecektir
Ambalajlarnada kullanrlan malzemeler sapltpa zarar vermeyecek nitelikte yeni, temiz, kokusuz, ahqap,
mukavva veya diger uygun malzemelerden hazrrlanmtg sandrk, kutu, file ve torbalar olmaltdtr.
Ambalajlafln alrrhklarr 25 kg.r gegmemelidir. Bu gartnamede yer almayan hususlarda TS I 131 ve b1
standarda atrf yaprlan TS'larr esas altnacakttr.
TURP:
Turplar, biitiin, saglam, taze g6ri..iniiqlii, gegidin kendine tizgii renginde, porsiimemi$, temiz, yabancr tat
ve koku iqermemeli, aqrrr drg nem bulunmamahdrr. Turplar normal gekilli, gatlamamtq ve berelenmeler
ile yanklar ve don zararlart bulunmamaltdtr.
Tuiolar l.srnrfliteliklerini taqrrnalrdrr. Bir partide teslim edilen boy ve 9e9it dzellikleri bir cjrnek
olrnalrd rr.
Arnbalajlarda kullanrlacak malzeme saflr!a zarar venneyecek nitelikte yeni, temiz, kokusuz, ahqap,
mukavva veya diler malzemelerden yaprlmrg olmalrdrr. Turplar ambalajlarda dtikme
olarak
,
yerlegtirilebilir.
bu gartnamede yer almayan hususlarda G.M. T ile ilgili TS' inde belirtilen gartlar esas altnacakttr.
TAZE FASULYE:
Fasulyelerde; sebze kabupu biitiin, saflam, temiz ve gegide 6zgii renkte olmah, bunlarda kimyasal
madde artrklan, anormal drq nem, yabancr koku ve tat bulunmamaltdtr. igleri taze, dtizgiin gekilli,
sa!lam olmalr, b<icek ve hastalrk zararhlan tagtmamaltdrr. Fasulyeler, geqidin tipik iizelliklerini
tagrmal, elle kolayca krrrlacak durumda, taze, gevrek ve krlgrksrz olmah, dolu yarasl ve giiriik izleri
.
d6hil higbir lekesi bulunmamahdtr.
Teslim edilen panideki fasulyeler; gegit, srnrf ve orijin bakrmrndan bir tirnek olmalrdrr.
Ambalajlamada kullanllan malzeme yeni, temiz, kuru, kokusuz, ah$ap, mukavva veya di[er uygun
maddelirden hazrrlanmrg kasa, file ve guvaldan yaprlmrg olmalrdrr. Taze fasulyeler ambalaj igerisine
dtjkme olarak ve gevqek bir bigimde yerlegtirilmelidir.
Bu $artnamede yer almayan hususlarda TS 797 gartlar esas altnacaktlr.
Sebzeler istendilinde mevsiminde taze olarak da ahnabilecektir. Taze sebzede kigi bagl 2OOgram kabul
edilecektir.
YEMEKLIK KULTUR MANTARI:
yemeklik kii ltiir mantarlan TS 241 0 da tanrmlanan kriterlere haiz olma lrdrr, Kiiltiir Mantarlarr
en 9o(
5 kg'lrk plastik ambalajlar veya iiriine zarar vermeyecek ambalajlarda teslim edilecektir.
SALAMURA YAPRAK:
Salarnura yapraklar net l0 kg'hk teneke ambalajlar igerisinde teslim edilecektir. Yapraklarda yrrtrk,
bticek yenigiv.b. kusurlar bulunmayacaktrr. Yaprak biiytikliikleri bir ijrneklilik arz edecek, farkh
biiyiikliiklerde yapraklar bulunmayacaktrr.
68
Hamur tathlarr muayene komisyonu talep ettilinde hazrr getirtilecektir' Kiqi bagt 150 gr
esas
t
alrnacaktrr.
HAMURLU TATLILAR (KEMAL PA$A):
Kapall ambalajlar igerisinde satrlan btitiin hamur miistehzalarrntn ambalajlan iizerinde cinsi,gegidi,
hangi nev'l undan ve yaldan yaprldrlr varsa ilave edilen diler maddelerin isimler ve mamullerinin net
a!rr[pr, firmanrn tescil edilmig markasr, adresi, imal tarihi, son kullanma tarihi, seri nosu okunakh bir
gekilde yazr lacaktrr.
Tathlar acrlagmrg, ekqimiq, bayatlamrg ve kiif kokulu olmayacakttr.
Kendilerine has parlak krzarmrg sarr renkte ve diizgiin olacaktrr. Piqkin olacak, yanlk, hamur beyaz
gOri.iniiml ii olmayacaktrr.
$urup gekmiq haldeyken dalrhnayacaktrr.
Tathiarrn iQinde canh ve cansrz haqere, kurt, bocek, tag,krl gibi yabancl madde bulunmayacakttr. Son
kullanma tarihinden once bozulan ve numuneden farkh grkan iir0nler yiiklenici firma tarafrndan
nakliye iicreti kendine ait olmak kaydryla deligtirilecektir
Uretim yapan firmanrn TSE, ISO 9001 (veya 9002) belgelerine sahip olmasr gerekmektedir.
Rf,VANi TATLISI TOZU:
Hazrr toz revani; geker, un, yumurta tozu, mlslr nilastasr, irmik, tuz' emiilsifer (monodiglyceride E-471 Polyglycerol ester E-475) sodyumperfosfat (E-450), asit diizenleyici (sodyum
kaibonat E-500) stabiiai6r (mono kalsiyum fosfat E-341)'den elde edilmig haztr toz revani kartgtmt
olmaLdrr.
:
Haztrrevanitozkar|ilmIbeyazrenktetozhalindeolmalr,topaklanmaolmamah,goriiniir.
yabanct koku
gekilde bozuLnug, ktiflenmig, kurtlu ve bijcekliolmamahdrr. Kendine has kokuda olmalt,
madde
tat
bulunmamahdrr.Yabancr
bulunmamalrdrr. Kendine has tatta olmalt, ekf imi;, bozulmug
gozle
her
tiirlii
drgrnda'
maddeler
iv"u""., t"r, bticek kalntrsr v.b.) ile katrlmasrna miisaade edilen
g0r0lebilen yabancr madde bulunmamaltdtr'
o/o l0 m/m, hazrrlama tarifine gdre sulandtrrlan revanide tuz miktarl en Qok I 0
frutubet miktarr en 9ok
kanqtm i
miktarien az 5 grll olmaldrr. I kg toz revaniye 550 ccllt su katrlarak hazrrlanan
g;/i,
ilili"
olmahdtr.
n 9ok 102 adet/gram
Toplam mezofilik Aerobik bakteri saylst en
amaltdrr'
oNluii, r<oLifott Uakteri, E.coli, salmonella ve
ambalajr oMK koli
i; ffidrj;rioo s;'lk kapan iolyo
geklinde olacaktrr. Raf timrii en az I yrl olacaktlr'
TSE Kalite
i;retici firma TS EN iSO 9001 Kalite Gi.ivence Sistern Belgesine, Grda Sicil Sertifikasrna,
sahitr
Sertifikasrna
Uretim
ait
Grda
mamule
UVg,*f"f. ii"fg"rt"e, TSE imalata Uygunluk Belgesine ve
ENiS.O900l
TS
ise
delil
firma
'
olacaktrr. Ma1 teslim edecet ti.,naii1r"J iyiUanian firma) iiretici
protokoliinii ihale
yaptlml!
anla$ma
arasrnda
ile
irma
iiretici
belirten
eefesi t<ullanabitecelini
gok
S
(pet+aluminvur
agamasrnda ibraz edecektir.
pi$immvp HAzIR roz PUDiNG (qiKoLArALI, qiLEKLi,
MUZLTT):
lar Seklinde. olacaktlr'
Birim ambalajt; 3.000 gr.'lrk kapah folyo (pet + aliiminyrm,+ pe) ambalaj
.
olacaktrr. [9 ve dtq
ambalaj
mukavva
gekilde_oluklu
alacak
ambalajr
birirn
adlt
3
f
iV.
u'rUiuj';
llut
ambaiajlar; iiretici firmanrn orijinal ofset baskrlr ambalajr olacakttr'
Raf <imrii 2 (iki) yrl olacakttr'
n kullanma tarihi, raf dmrii, sahip oldulu kalite
inde bulunan maddelerin slrastna gdre aslart
tlt etiketi bulunacakttr.
Sistem Belgesine, Grda Sicil Sertifikasrna, TSE Kalite
ait Grda uretim Sertifikasrna sahip
Uygunluk Belgesine, TSE imalata Uygunluk Belgesine ve mamule
oiuiuh,t. Ur0n ekli numunesine gdre satrn altnacakttr'
Pi$iRMEYE HAZIR SAI{IZLI MUIIALLEBI TOZU:
+ pe) ambalajlar geklinde olacaktrr'
Birirn ambalajr;3.000 gr.'lrk kapalr folyo i(pet + aliiminyu.m
mukavva ambalaj olacaktrr.
gekilde
oluklu
Nut tiv" urnu"luj,; 3 adit birim imbalajr alacak
Raf Omrii 2 (iki) Yrl olacaktrr.
69
Birim ambalaj tizerinde; mamuliin iiretirn tarihi, son kullanma tarihi, raf 6mrii, sahip olduf,u kalite
hazrrlanrg gekli, igerisinde bulunan maddelerin strastna gore adlart
bilgilerini igeren iiretici firmantn orijinal ofset baskrlr etiketi
UrJtici firma TS EN iSO 9001 Kalite Gi.ivence Sistem Belgesine, Grda Sicil Sertifikasrna, Grda ile
belgesinin igareti, net
alrrll!r,
bulunacaktrr.
!
temasta bulunan Materyal Sicil Sertifikasrna, TSEK Kalite Uygunluk Belgesine, TSE Imalat Yeterlilik
belgesine ve mamule ait Grda Uretim Sertifikasrna sahip olacaktlr.
Uriin eklinumunesine gdre sattn altnacakttr.
KARI$IK VE KORNi$ON TTJRSU:
Kangrma giren her bir turgu kendine has, renk ve gdriiniigte; sebzesi yumuqamamrg, da[tlmamtq,
gtiriimemi! ve ktiflenmemig, salamura salyalagrnai'' olma1, yabanci madde
:
ka'grma giren turgularrn kendine has tat ve kokularrnda olma1, kiif, kokuqma vb. yabancr tat ve kokfi
bulunmamalt. Asetik asit miktarr %5'den fazla olmamaltdtr.
0/070 olmalt
Net alrrlr$rnda siizme a[rrh[r oranr en az
Her giqit iebzenin siizme alrrhlrna orant en az Vo3-en gok%25 olmahdrr'
bulunmamalt
eyen veya turqudan etkilenmeyen saphla zararh
'lkunukl, orarak silinmeyecek. bozulmayacak
gekilde basrlrr veya Yaztltr'
igaret ve
iirmanrn ticaret unvanr, adresi veya krsa adr adresi varsa tescilli markasr Bu standardtn
(salamura)
imalat
+zr+ gekiinde; imaiat seril kod numarasr Malrn adr (karrqrk turqu) Tipi
tarihi (ay ve yrl olarak)
Siizme a[rrh[r (kg veya gr olarak)
yrl olarak) Kullanrlan katkr maddelerinrn
nirmacalner]ten ion iuianma taiihi ve raf d,mrii ( giin, ay,
grubu ve kimyasal adt Asetik asit orant
turgu sirkesi harig .
i".Su iirf."li olacak ve karrgrk sebzeleri taze olacak, kurt bulunmayacak,
olarak safi alrnacakttr.
havug vs. olacakttr' Kornigon turqular
olacaktlr. Komigon turgular I numaradan b0yiik
;;;;;";; iii
-fi-i,l
tr. Numuneden farklr grkan turqular
yiiklenici firma
tarafindan deEistirilecektir'
ii;;;i;ifi;#,;
ve kabulde Muavene
Grda Uretim ve Grda Sicil Sertifikalannrn muayene
Komisyonuna ibraz edilmesi
GALETA
UNU:
gerekmektedir'
), tuz ( TS 933 )' ekmek mayasr
arak elde edilmi$ olacaktrr'
i
( TS 3522 )'
st€necektir'
lr.
gekil verildikten sonra lizerine serpilen geqni
u, gtirek otu' kepek, kavrulmug malt unu, diier
tahrl unlarr vb.) teknigine uygun olarak hazlrlanmrq olmahdtr'
net aErrllgr, iireticinin adr
fiyus. t""rUtJ urbalajlar igirisinde teslim edilecektir. Ambalaj iizerinde
tarihi ambalaj i'izerinde belirtilecektir'
adresi. tanrncr iSareti bulunacaktrr. imal ve son kullanma
w
ANTEP FISTIGI (CEKiLMi$ TOZ):
elde edilmiq I . Srnrf niteliklerine haiz olacakhr.
c"rirnris ,o, -,"p iistrklarr yeni sene mahsullerinden
madde ve benzeri taklit ve tah5i;
Kendine has renk, tat ve aromada olmalr, yabanct madde, boyar
ttlii b0cek veya bdcek kalrntrlarr bulunmamahdtr'
balajlamada kullanrlan malzeme yeni' temiz'
sa!h!a zarar vermeyen malzemelerden yapltml$
olmahdrr.
70
Ambalajlarrn iizerindeki iiriin etiketleri Tiirk Grda Kodeksinde tantmlanan bilgileri igermelidir.
Ambalaj a[rrhpr 250-500 gr olacakttr.
Uretici hrmaya ait, Grd4 Tarrm ve Hayvancrhk Bakanllrndan ahnmrg Grda Uretim ve Grda Sicil
Sertifikalarrnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir.
Bu gartnamede yer almayan hususlarda G.M. T. ile ilgili TS'larrndaki gartlar esas ahnacakttr.
YEMEKLiKAYqiCEKYAGI:
I
yemeklik aygige!i yapr; kendrne has renk, tat ve kokuda olmahdrr. Fiziksel ve kimyasal dzellikleri TS
886'da belirrilen niieliklere uygun olmahdrr. Kullanrlmasrna izin verilen katkr maddelerinin drgrnda
herhangi bir katkr maddesi veya yabancr madde igermemelidir. Aygigek ya!larr yemeklik ve
krzartm]alrk olarak iki ayrr gegit gelecektir. Krzartmahk aygigek yallaflnda, krzartmalarda kitpliryeyi
onleyici dimetil polisiloksan E-900 katkrsr bulunmaltdrr. Yemeklik ay9ige$i dolum hacmi 18.000
rnl,lik yeni, temt, paslanmamrq, lehimsiz olarak kapatrlmrq sa$h[a z.arur vermeyen ve nitelikleri TS
yaprlan ay9i9e!i yallart
2g l2' de belirtilen ieneke kutular igerisinde teslim edilmelidir. Kabulii
yallarrnda ISO ,
ambalaj iizerinde yer alan net alrrlik i.izerinden kabul i'lemi yaprlacaktrr. Aygige[i
9000 standardl aranacaktlr.
Kodeksinde
ait, Grda, Tanm ve Hayvancrhk Bakanhlrndan
Ambala.llunn iizerindeki iiriin etiketleri Tiirk Grda
Uretici
"firmaya
lidir'
da Sicil
Sertifi kalannrn mal teslimlerinde muayene komisyonuna ibraz
esas allnacakhr..
Bu gartnamede yer almayan hususlardi.TS 2812 ve bu standartta atrfyaprlan TS'larl
YEMEKLiK BiTKiSEL MARGARIN:
in
in
alrnmayan)
tanesi bir kolide olmak iizere toplam l5 kg'Lk
eri i.iriiniin duyusal, fiziki' kimyevi ve
a$ gegirmez kA!rt, alimiinyum folyo, plastik'
odeksinde tantmlanan bilgileri igermel idir'
rndan altnmrq Grda Uretim ve Grda Sicil
ibraz edilmesi gerekmektedir'
BuSartnamedeyera|mayanhususlardaTS28l2vebustandarttaat|fyapllanTS,lartesasa|tnacaktrr;
zEYTiNYAGI(Rivinnr;:
Ca. U".*f., tortusuz, kendilerine has normal
Z-O
art
olacakttr'
lezzetlerde, TS 341'e uygun ve yabancr kokulardan
invaEla'drr.
u.tlai,ndu belirtilen vasrf ve gartlara uygun kapalr
000 ml' lik yeni paslanmamrg, lehimsiz olarak
34' te belirtilen teneke kutular igerisinde teslim
zerinde yer alan iiriin bilgilerinde belirtilen net ,
tiirlil bitkisel slvr yaglarrn iizerinde; firmantn
(zeytinyaflrnrn ayrlca turii)' iiretlm ve son.di basllmah. Yemeklik zeytinyallannrn etiketi
er
TS igareti ve numarasl bulundurulacak ve
iizerinde bunlardan ba;ka Tiirk Mah ibaresi ile TS veya
olacakttr'
i":f.Ji"ta"f.f fazrlar standartlarda belirtilen puntolr rla yaztlmtq
7l
Teslim Sekli; Teneke iizerindeki net a!rrllk iizerinden olacakttr. Son kullanma tarihinden dnce bozulan
ve numuneden farkh grkan iiriinler miiteahhit firma tarafrndan de[igtirilecektir.
Piyasada sahlan iyi cins ya[lardan olacakttr.
Tortulu, bulanrk, renkleri bozulmug, lezzeti acrlagmrg ve kokusu a!rrlagmrg olmayacaktlr'
GMT'ne uygun olacaktrr.
-
KATUBiBER:
ve
:t
Karabiberler; kendine cizgii keskin tat ve kokuda olmahdrr. Bayatlarnrg, kiiflenmig, bozulmug
kahnhlarr,
veya
bdcek
qrplak
bocek
dlii
gdzle
bdcek,
canh
bakrldrlrnda
yabancr tat da olmamahdlr.
Lemirici hayvan yenikleri gdriilmemelidir. G6z agrkSlr 0.63 mm olan elekten enaz%o90't gegecek
0%12 olmahdlr'
gekilde ince gekilmig olmahdrr. Rutubet miktarr alrrhkga en gok
.
karabiberler 250 gr'hk ambalajlar halinde teslirn edilmelidir. Ambatajlamada kullanrlacak malzeme
hava ve rutubet gegirmeyen, yeni, temiz, kuru, saplam kokusuz ve insan salllptna zararstz
malzemelerden yaptlmrq olmalrdrr. Ambalajlarrn a$tzlarl srkrca kapatrlmrq olmalrdlr'
Ambalajlarrn tizerindeki iirUn etiketleri Tiirk Grda Kodeksinde tanrmlanan bilgileri igermelidir.
Uretici iirmaya ait, Grda, Tarrm ve Hayvancr6k Bakanlr[tndan altnmrq Grda Uretim ve Grda Sicil
Sertifikalarrnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir.
allnacaktlr.
Bu gartnamede yer almayan hususlarda TS 2l30 ve bu Standarda atrfyaprlan TS'larl esas
PUL BiBER VE TATLI KlRMIZI TOZ BiBER:
pul ve krrmrzr tath toz biberler; kendisine ozgii renk, tat ve aromada olmalt, k0flenmi9 yabancr tat ve
olmamah, grplak gdzle bakrldrlrnda igerisinde canh b6cek, <ilt b6cek veya bi5cek
lot u
"trn,;
r."ii"t'r.i, gitrii r'""*"tiair. grurtara boya, tigasta vb. maddeler kah;namrp olmaldrr' Pul biberlerde
kendinden glT.r.up y"
,utuu"t,r.,iitur, %024'i, yenekliktuz0/o6,yr yemeklik srvr bitkisel yap,%8'i
toz biberler I . srnrf niteliklerden ve
Lrlgrk pargalarr % I ,5,i gegmemelid ir. Pul biberler ve Krrmtzt tatl
ince veya orta boy gegidinde olmahdrr.
malzeme tiriini1
fut UiUlrt.. ZSO ir;lrk ambalajlarda teslim edilmetidir. Ambalajlamada kullantlacak
nitelikte yeni' temiz' kuru'
rutubetten koruyicak hava stzdtrma ve insan sa!1!rna zarar vermeyecek
yaprlmrg olmahdrr. .
maddelerden
uygun
i.oLu*r, tag,,,.ukawa polietilen lak,h teneke-veya di[er
1"r-), tuttitirAiberler j50 gr'1k ambalajlarda te;lim ;dilmelidir. Ambalajlamada kullanrlacak
zarar vermeyecek nitelikte yeni'
malzeme iiriinii rutubetten koruyacak hava srzdtrma ve insan sa!h$rna
yapllml$
t"rir, trrr, kokusuz, kAfrt, mukavva polietilen lak'lr teneke veya diger uygun maddelerden
olma lrd tr.
I rQermelrorr'
Ttir
m ve Grda Sicil
ve Hayvan
tedir'
e muayene
art esas ahnacaktrr'
g; i"n".;"d" v"r almayan hususlarda TS 3706 v
KURU NANE:
ki.iflenmig, bozulmug, yabanct tat
rlr. ""n"[r; kendine dzgti renk, tat ve aromada olmah, bayatlamr$,
61il b<icek veya
;; ;il;i;;; ;i;"matrdir. igerisinde canl bdcek butunmamatr, gdzte bakrtdrprnda
taqrmahdrr. iglerinde yabancr
Arrbalajlarr
Uretici flrm
Sertiflkalarl
iketleri
uoc"t tul,nt,ia' gtiriilmemelidir. Kuru naneler I .srnrf niteliklerini
madde bulunmamalrdrr.
malzeme
250 gr,lrk ambalajlar halinde teslim edilmelidir. Ambalajlamada kullanrlacak
bozmayacak'
i""" .r,"U""g"9irmeyen, yeni, temiz, kuru, sallam' kokusuz, malzemenin ozellipini
".
alrzlarr srktca kapattlmtg
insan sa$lr[rna zararsrz malzemelerden yaprlmrg olmahdrr. AmbalajlarrD
Ii;;;;^";
olmalrdrr.
etiket
ve
m
;il;;itt"
iizerindeki tiriin
Ui.ti"i h.tuyu uit, Gtda, Tartm
S"nintutunn,n mal teslimlerinde
g;i""t.."a"
V"r almayan hususlarda TS 3498
bilg-ileri igermelidir.
..
da Uretim ve Grda Sicil
r€kmektedir'
v
an TS'lart esas altnacakttr''
KiMYON:
Kimvon:kendineozguholtatvekokudaolmah,bozulmug,kiiflenrnigvekiifkokuluohnamaltve.yahayvan yenikteri.gdrrjlmeme.li,
;;;1;;;;i;;;;.ui,a,r. ig.ririno" cantr bdcek katrntrla, kernirici
kadar deEigebilir
gri,
kalverengine
sarrdan
Rengi
vb. maddeler katrlnrg o;namalrdrr.
i""u-
"iru."
Ir,"r"""i",
"rri*
"eya
katrlmamrf
l.srnrf ve ogritiilmii$ tipte olmahdrr. Kimyonlara higbir madde
72
olmalldrr. Bunlar delik agrkhlr 0.45 mm olan elekten en az%o90'r gegecek gekilde ince gekilmig
i
olmahdrr. Rutubet miktan alrrhkga en gok %10 olmahdrr. Kimyonlar ambalajll olarak
edilmelidir.
Arnbalajlamada kullanrlan malzeme temiz, sa!lam, kokusuz ve insan sa!lr[rna zararstz maddeler
olmalrdrr. Ambalaj lann afirrl$r 250 gr' r gegmemelidir.
Ambalajlarrn iizerindeki iirtin etiketleri Tiirk Grda Kodeksinde tantmlaran bilgileri igermelidir. UretiCi
firmaya ait, Crda, Tartm ve Hayvancthk Bakanhlrndan ahnmrg Glda Uretim ve Glda Sicil
Sertifikalarrnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir. Bu tartnamede
yer almayan hususlarda TS 2622 ve bt Standarda atrf yapllan TS'leri esas altnacakttr.
teslim
TARCIN-I(ARANFIL:
Targ,nlar; kendine dzgii taze tat ye kokuda, bayatlar rrg, ki.iflenmi9, bozulmug olmamaltdtr. Igerisindel
canir bocek bulunmamaL, gtizle bakrldr!urda dlii bdcek kalrntrlarr, kemirici hayvan yenikleri
gdrtilmemelidir. OgiitUlmtiS targtnlar, delik agrklrf,r 0. 2 mm 'lik elekten gegecek gekilde ince gekilmrS
olmalrdrr. Rutubet miktan a$trhkga Yo l2'yi gegmemelidir.
Karanfiller; kendine 6zgii taze tat-ve kokuda, bayatlamlg, kiiflenmig, bozulmug olmamahdrr. Igerisinde
canh b6cek bulunmamah, gozle bakrldtIrnda 0lii bdcek kalrntrlarr, kemirici hayvan yenikleri
goriilmemelidir.
firi.inlerl 250 gr'1k ambalajlarda teslim edilmelidir. Ambalajlarda kullantlan malzemeler, ilriinii iyi bir
6ez, k6!tt, polietilen veya bagka ;
Sekilde koruya-cak nitelikte, yeni, temiz, kuru, saplam, kokusuz;jiit,
uygun malzemeden yaprlmlg olmalrdrr.
a.ribulu.llu.rn tizerindeLi iiriin etiketleri Tiirk Grda Kodeksinde tanrmlanan bilgileri igermelidir.
ve Grda Sicil
Uretici frrmaya ait, Grda, Tarrm ve Hayvancr;k Bakanllrndan a1nmt9 Grda Uretim
gerekmektedir.
Sertifikala.nln mal teslimlerinde muayene komisyonuna ibraz edilmesi
TS'leri esas altnacakttr.
Bu g"rtnur"d" y"r almayan hususlarda TS 2291 iebu Standarda atrfyaprlan
KAKAO:
toprak, yabancr
kakao; Kendine dzgii koku ve renkte, akrcr olmayan toz halde olma1, igerisinde
yabanct
maddeler, bdcek
veya
maddesi
katkr
higbir
standarrlarca izin verilenleiin drgrnda
olmalrdtr'
dlgtiilmtig
I
srnrf
Kakao
zararlarr bulunmamalr, ekqime; yabanct tai ve koku olmamaldrr'
en gok 7o8
,lik
oz99
a[rr1k9a
miktarr
Rutubet
elek altrna gegmelidir.
;;li[;g'kl't' 0,3 mrn bir elekten
;;;;;'""
olmalrd tr.
tirtinii rutubetten
ioo gr,hk ambalajlarda teslim edilmeli ve ambalajlamada kullanrlan malzeme
gegirmeden yaptlmlg
tti.fti li.Ln..de1 taive koku deIigmelerinden koruyacak qekilde hava
r"t""
i'
olmahdtr.
eriufu.ifu.tn iizerindeki i.iriin etiketleri Tiirk Grda Kodeksinde
Uretici irmaya ait, Grda, Tarrm ve Hayvancrhk Bakanltltndan
melidir'
Grda Sicil
Sertifikalarrnrn mal teslimlerinde muayene komisyonuna ibraz
eugu|.tnu'"a"y"ralmayanhususlardaTS30T6vebustandardaatrfyaprIanTS,leriesasallnacaktlr.
VANiLiN:
veya topraklaqmtg!
Vanilinler; temiz kendine Ozgii koku ve renkte, tat da olmah kiiflenmig, katrlaqmrq
yabancr tat ve koku almtE olmamalrdrr. Bunlarda
Lulunmamalrdrr. Vanilinler 5 Gr'hk tiiketici amb
kul lanrlacak malzeme vanilinlerin rutubet almalarr
ve sa[hga zarar vermeyecek nitelikte yeni, temiz, k
malzemelerden
olmaltdtr.
Kodeks
ah
i
atrfyapr
ve
bu
Standarda
TS
4513
y", uttuyun hususlarda
Ambalajlann iizerindeki iiriin etrketleri Tiirk crda
rir*uju'uit, Gtda, Tartm ve Hayvanctltk Bakanlrfrndan
s.iitt utu.,n,n mal teslimlerinde muayene komisyonuna
i
bilgileri iqermelidir. uretici
m ve Grda Sicil
rekmektedir' Bu $artnamede
allnacaktlr'
KABARTMA TOZU (Hamur lgin)
Kabartmatozu;homolenyaptveg'tiruniigt",kendinehasrenkvekokudaolmah'muhtevastdtqtnda
Kabartma tozu imalinde
gorr" go*i"ulr"" yubanci mudde lhtiva etmemeli topraklanmamrg olmahdrr.
belirtilen saflrk OzelliIine uygun "
[uffunifon U,"v"ui maddeler Grda Katkr Maddeleri ydnetmeli!inde
oimut,d,r. Kimyevi 6zellikleri TS 9053'te belirtilen stntrlan aqmamahdrr'
Kabartma tozu l0 Gr'lrk kiigtik ambalajlar iginde teslim edilmelidir. Ambalajlamada kullanrlacak
malzeme temiz, rutubet ve hava gegirgenlili az olan, ka$rt kaph folyo ve polietilen gibi
malzemelerden yaprlmrg olmahdtr.
Ambalajlarrn lizerindeki iiriin etiketleri Tiirk Grda Kodeksinde tanrmlanan bilgileri igermelidir. Uretiii
2
firmaya ait, Grda, Tanm ve HayvancrLk Bakanlr$rndan alnmrg Grda Uretim ve Grda
Sertifikalarrnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir. Bu gartnamede
yer almayan hususlarda TS 9053 ve bu Standarda atrfyaprlan TS'leri esas ahnacaktrr.
TUZz
Tuzlar; beyaz renkte ve homojen olmah gdzle gtiriilen yabancr maddeler igermemelidir. Fiziksel ve
kimyasal 6zellikleri TS 933 'te belirtilen gartlara uygun olmahdrr. Tuzlar sofra tuzu (rafine) srnlfinda.
ve iyotlu sofra tuzu tipinde olmahdrr. Rutubet miktan en goko/o''i gegmemelidir. Tuzlar Grda
Maddeleri Tiiziigiine uygun nitelikte ?50 Gr'hk ambalajlar halinde teslim edilmelidir. Ambalaj
iizerinde; firmanrn ticari unvanr, adres ve tescilli markasr, maltn adt, maltn stntfi ve tipi, net aglrhgl
(gram olarak) ilgili standardrn igaret ve numarasr, iyot miktan, iyolize etmek igin kullanrlan kimyasal
riaddenin adr yazrlmahdrr. Ambalajlarrn iizerindeki tiriin etiketleri Ttirk Grda Kodeksinde tanrmlanal
bilgileri igermilidir. Uretici firmaya ait, Grda, Tarrm ve Halvancrhk Bakanlrprndan alrnmrg Crda
U."ti. ui Grda Sicil Sertifikalarrnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi
gerekmektedir. Bu gartnamede yer almayan hususlarda TS 933 ve bu Standarda atrfyaprlan TS'larr
Sicil
esas alrnacakttr.
cEviz ici:
ceviz igleri; sa[lam olmalr ve ijzellikle kiiflii, hastalrkl actlaqmtg, buruguk veya tamamen kurumu$
rengi bozulmug ve giiriik olmamalrdrr' Bunlar
yabancr koku ve tat bulunmamahdrr. Ceviz ig
ekstra veya Lsrnrf niteliklerine sahip olmahdr
kadar depiqiklik gtisterebilir' ceviz igleri biitiin ttunrii,
orma'drr. Her ambalaj igerisindeki ceviz
nek olmahdrr' Ceviz igleri 5 Kg'hk ambalajlar
acak malzeme yeni, temiz ve insan salrlrltna
enden 9ok toz, kabuk pargalan ve diler herhangi
etiketleri Tiirk Grda Kodeksinde
bir yabancr madde bulunmamahdrr. Ambalajlann iizerindeki iiriin
Bakanlrprndan
,untlnfunun bilgileri igermelidir. Uretici firmaya ait, Grda, Tarrm ve Hayvancrlk
ibraz
komisyonun_a
muayene
teslimlerinde
mal
Sicil
Sertifikalairnrn
C,A" U1"im ve Grda
"l,"n,,,i g"..t."ttedir. Bu gartnamede yer almayan hususlarda TS 1276 bu Standarda atrfyaptlan
,
'
"Jiir"ri
TS'larr esas altnacaktrr'
YER FISTIGI:
ier frstrtlar; saglam, temiz, olgunlagmrg, dolgun ince uzun ylvarlaltmst veya oval gekilli olmalt'
[*ii". n", *r[" kendi tat vJkokusunda buiunmama'drr. Eski ve yeni mahsul birbirine
lii ve bozuk mahsul bulunmamahdrr' Yer frstrklari
et miktarl afrrltkga en gok %7 olmalrdrr' Yer
m edilmelidir. Arrrbalajlamada ku llanrlacak
kuru, kokusuz malzemeden yaprlmrq
malzerne salh!a ve tirline zarar vermeyecek nitelikte temiz,.yeni,
Tiirk Grda Kodeksinde tantmlanan
torOu u" 9uu"utiu, olmaldrr. Ambalajlairn fizerindeki iirtin etiketleri
Liigir* iq;.;"fiair. Uretici firmaya ait, Grda, Tanm_ve Hayn,ancrlk BakanlSrndan altnmrg Crda
ii.Eti. n" C,au Sicil Sertifikala'nrn mal teslimlerinde muayene komisyonuna ibraz edilmesi.
geret<met<tedir.Bugartnamedeyera|mayanhususlardaTS3l0buStandardaatrfyaptlanTS'larresas
allnacakhr.
iCFlxlrx:
.
g6riime belirtileri
iq-frd,klur; normal geli'mi9, temiz, biitiin, saplam olma1, <izellikle kiiflenme ve
actlagmtq yabanct koku ve tat
bocek ve hastalrk zaiarlan canlr veya rilii bocek ve hayvansal zararllar,o/o
6'dan fazla olnamaltdtr'
Uriun,r,urut,a,r. i9 flndrklar kuru olmalr ve bunlardaki rutubet miktarr
alt ekstra veya l. srnrf niteliklerine sahip olmahdrr'
r. i9 findrklar grup srnrf ve boylama.baktmtndan
ajlamada kullanrlacak malzeme yent, temtz'
iielikte olmahdrr. Ambalajlann aprrhf,r 5 Kg'mt-
74
gegmemelidir. Ambalajlarrn iizerindeki i.iriin etiketleri Tiirk Grda Kodeksinde tanrmlanan -bilgileri
igermelidir. Uretici firmaya ait, Gtda, Tanm ve Hayvanclltk Bakanlt!rndan allnmtq Grda Uretim ve
Grda Sicil Sertifikalarrnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir. Bu
gannamede yer almayan hususlarda TS 3075 ve bu Standarda atrfyapllan TS'lart esas altnacakttr.
xus iizijPrU:
Kuq iiziimleri; saglam, temiz, yabancl tat ve koku almamrg olmalrdrr. Kendine ozgii renk, tat ve koku
of maf r. Rutubet m iktan %ol6'yr gegmemelidir. Ku9 iiziimleri ekstra veya I .srnrf 6zelliklerine sahip
yeni mahsul iiriin gekerlenmig tane Yo''i, dzi.irlii tane %4'ii, sap pargalarr %5'i gegmemelidir. Ku|
iizi.imleri 250gr'hk ambalajlarda teslim edilmelidir. Ambalajdaki iiriin gdriiniig, renk ve irilik
bakrmlanndan bir <imek olmalrdlr. Ambalajlamada kullanrlan malzeme sailtf,a zarar vermeyecek
nitelikte yeni, temiz, kuru, kokusuz maddeler olmahdrr. Ambalajlann iizerindeki iiriin etiketleri Tiirk
Grda KoJeksinde tanlmlanan bilgileri igermelidir. Uretici firmaya ait, Grda, Tarrm ve Hayvanctltk
Bakanhprndan ahnmrg Glda Uretim ve Grda Sicil Sertifikalannrn mal teslimlerinde muayene
komisyonuna ibraz edilmesi gerekmektedir.
Bu gartnamede yer almayan hususlarda TS 4062vebu standarda atlfyaptlan TS'larr esas allnacaktlr'
i
CEKIRDEKSiZ KURU iJZUM :
Kuru iiziimler; saglanl, biitiin, tentiz olmalr, bunlar la yabancr tat ve koku bu lunmamaltdtr..
edilmelidir. Arnbalajlamada yeni, temiz,
Qekirdeksiz kuru-uztimler 5 kg'lrk ambalajlar halinde teslim
kuru, kokusuz, igindeki mahn <izelliklerini bozmayan ve safh[a zarar vermeyen malzemeleri
kullanmahdrr. Ambalajlamada malzeme olarak guval ve torba kullanrlamaz. Ambalajlarrn iizerindeki
ici firmaya ait, Grda, Tanm
arrnrn mal teslimlerinde
mayan hususlarda TS 541
KURU KAYISI:
pifuradu rat,lun en iyi cinsten usuliine uygun kurutulan yeni sene iiriinti gekerpare kayrsrlardan
:
olacakttr.
normalden fazla
Ciiriik. kiiflti vs. fena kokulu, kul1 yenikli' taqh, toprakh, tozlu, gttplii, ezik, act'
iutubetli, rslak, ktzrgmrg ve kirli olmayacaktrr. '
Kendine has lezz.et ve lal:la olacakttr. Rengi agrk san olacakhr'
yeni!i bulunmayacaktrr' Taneler
Kayrsrlar gekirdeksiz olacak, taneler iizerinde 9il, benek, kuq
- y ,:-
YaPlfmlf
:,-^1:^:
r:--^
Kayrsrlarr'Amba|ajiizerindenetalrrlrgl,ijreticifiI.u...
tarihi okunaklr bir gekilde bulunacaktrr- Son kullanma
Adr, adre
kan kuru kayrsr ytiklenici firma tarafindan nakliye
tarihinder
ijcreti kendine ait olmak iizere deligtirilecektir'
uygun olacaktrr'
Burada bahsedilmeyen diler husrislar TS 485'e CMT' deki ;altlara
KURU ERiK:
drr. Kendine dzgii renk, tat ve koku olmah Rutubet
lerine sahip yeni mahsul iiri'in gekerlenmiq tane
ir. Ambalajdaki iiriin gtiriiniig, renk do[al
lrpa zarar vermeyecek nitelikte yeni, temiz, kuru,
Grda Kodeksinde
kokusuz maddeler olmalrdrr. Ambalajlafln iizerindeki iirtin etiketleri Tiirk
bilgileri igermelidir. Uretici firmaya ait, Grda' Tanm ve Hayvancrlk Bakanlrirndan
muayene komisyonuna ibraz
ut,n,nis C,au Utetim ve Grda Sicil Sertifikalairnrn nal teslimlerinde
edilmesi gerekmektedir.
g" s"r;";.a" y"r almayan hususlarda TS 4062 ve bu standarda atrfyaprlan TS'lan esas ahnacaktrr.
'
;;;;^;
KURU iNCiR:
Kuru incirler; biitiin,
sa
ve
hasarsrz,
dr9 nem, yabanct tat
bulunmamalr,
r bozulma gijstermeyen kimyasal maddeler' aqtfl
bocek ve hasarlan' canlt kurt ve akar '
btjcek,
'ilii
tlaksrz olmalldrr. Qrplak giizle gdriilebilir yabanct
maddelerbulunmama|tdtr.Kuruincir|erekstraveyal.srnrfniteliklerinesahipolmahdrr'Rutubet
'-iii, y"Ze,
Kuru incirler iyi niielikte olmal gegidin ve tipin 6zelliklerini tagrma5,
V, gegmemelidir.
"uolmayan
hafif lekeler ve toleranslar drqrnda dztrsgz, mevsimine giire renkge.bir
n.n"i *tiriiliiig
gore uygun yumugaktrkia ve yeni mahsul olmaltdtr. Kuru incirler l0
[;;;k.";;ll;,-ft;;;'n-,!uri,nin"
75
i
Kg'r gegmeyen ambalajlar igerisinde teslim edilebilirler. Ambalajlamada kullantlan malzeme, yeni, I
temiz, kuru, kokusuz, igindeki mahn 6zelliklerini bozmayan ve saplrpa zarar vermeyecek nitelikte
olmaltdrr. Ambalajlarrn tizerindeki iiriin etiketleri Tiirk Grda Kodeksinde tanrmlanan bilgileri
igermelidir. Uretiii firmaya ait. Grda. Tarrm ve Hayvancrlrk Bakanlrlrndan ahnmrq Grda Uretim ve
Grda Sicil Sertifikalarrnln mal teslirnlerinde muayene komisyonuna ibraz edilmesi gerekmektedir. Bu
altnacakttr.
$artnamede yer almayan hususlarda TS 54 | ve bu Standarda ahfyaprlan TS'lafl esas
sinxE:
o/o I den
Sirkede; toplam asit miktan asetik asit cinsinden 100 ml'de 4 gr. az etil alkol miktarr hacimce
i
gok olmamalrdrr. Sirkede kuru madde miktarr ( qeker drgrnda ) litrede 10 gr'dan ve kiil miktarr
gr'dan az olmamalrdrr. Sirkeye organik ve inorganik asitler (sirke ruhu dahil) salltla zararsrz da olsai
yabancr maddeler ve boya maddeleri katrlmarnrg olmahdrr. Sirke berrak gdrtiniigte kendine Ozgii tat.
I
renk ve kokuda olmah, Mikobiyal ve madensel bulanrklrk, krrrlma, siyahla;ma gdstermemeli iginde
sirke zararlarr bulunmamahdrr. Sirkeler kapal olarak 5 litrelik pet gigelerde igerisinde teslim
edilmelidir. Ambalajlann iizerindeki iiriin etiketleri Tiirk Crda Kodeksinde tanrmlanan bilgileri
igermelidir. Uretici hrmaya ait, Grda, Tartm ve Hayvancrhk Bakanh[rndan alrnmtg Gtda Uretim ve
Crda Sicil Sertifikalarrnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir. Bu
gartnamede yer almayan hususlarda TS l8E0 ve bu Standarda atrfyaprlan TS'larr esas altnacakttr.
tizawpnr*rczi:
Uziim pekmezi; taze veya kuru iiziim glrastntn yardrmcr maddelerle asitlili azaltrlarak veya
azalhlmaksrzrn durulduktan sonra agrk veya vakumda koyulagttrt lmast ve gere!inde katkr maddeleri
katrlarak elde edilmig olmalrdrr. Uziim pekmezi tath pekmez srntfinda ve stvl pekmez turiinde
olmahdrr. Uziirn pekmezi kendine tlzgii tat ve kokuda, homojen renk ve gtiruniigte olmahdlr. Normal
kogullarrnda 9o!alabilen mikroorganizma ve mikrobiyal kaynakh higbir toksik madde
buiunmamalrdli. Kimyasal koruyucu madde bulunmamah, fermantasyon testi pozitif (+)olmahdrr;
yapay boya maddeleri igermemelidir.
gtiziiniir, kah madde (refraktometrik) en az\o 65 olmahdrr
-Suda
Sakkaroz icermemelidir'
-
-PH'
r
en az 5,5 olmalrdrr.
pekrnezi 5
lt,lik teneke, cam veya plastik ambalajlarda teslim edilmelidir. Ambalaj
-Uziim
iizerindeki net miktar
teslimde esas allnacaktlr.
pekmezi
dzelli[ini bozmayacak nitelikte ve renkli teneke kutu, cam kap, plastikten
Ambalaj; uzum
yaprlmri'kaplarda veya insan .ugltg,nu -."r u"rmeyecek diler ambalajlar igerisinde olmahdrr.
Ambalajlar iizerine agafrdaki bilgiler okunakh olarak yaztlmtq olmahdrr'
Firmanrn ticari iinvant veya ktsa adt, adresi' varsa tescilli markasr,
- ilgilistandartrn isaret ve numarasr (TS 3792)
-
Malrn adt,
- rnrfr ve tipi,
- Seri numarast,
- Yapun tarihi (ay-Ytlolarak),
- Net agrrlrgr.
-Uretici flrmalya ait, Crda, Tarrm ve Hayvancrhk Bakanh[rndan alrnmlg Grda Uretim ve Grda Sicil
S
Sertifikalaflnin mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir'
Bu gartnamede yer almayan hususlarda TS 3':-92 ve bu standarda atlf yaprlan TS'lan esas altnacakttr.
TAHiN
Tahin; TS 3l I uygun susam tohumlaflnln tekniEine uygun olarak kabuklart ayflldtktan ve firrnda
kurutulup kavruiduktan sonra delirmende ezilmesi ile elde edilmig olmahdrr'
Tahin higbir yabancr madde igermemelidir.
Genel ozellikleri;
Kendine ozgii renk, tat ve kokuda olmahdlr.
- igindeki susam yall miktart en az 0/055 olmahdrr.
- Su miktan en gok %1,5 olmaltdtr.
-..._ Protein miktarr en az%o22 olma\dt '
Tuz miktarr en 9ok o/o0,1 olmalrdrr.
- Kiil miktart en cok
%0,3 olmahdlr.
-
76
Acrhk menfi olmaltdtr.
- Asit klorik asit
-_
cinsinden en gokok2 olmaltdtr.
selliloz miktart en gokVo2,4 olmalrdrr.
G.M. T'de yer alan antioksidan ve stabilizan maddeler katrlabilrr.
..._ Ham
-
Ambalaj; Tahin yeni ve igindeki mah iyi koruyabilecek halde ve Ozellikte olmak tizere G.M. T'de
miisade edilen insan sa!h$rna zararstz maddelerden yaprlmrq ve tahinin <izellilini bozmayacak
nitelikte teneke veya cam kaplar iginde ambalajlanmrq olmahdrr. Tahin 5 Kg'Lk ambalajlarda teslim
edilmelidir. Ambalaj Uzerinde belirtilen net miktar teslimde esas ahnacakttr.
A;a$rdaki bilgiler okunakh olarak yaztlmrq olmahdtr.
Firmanrn tescilli markasr veya ktsa adr, adresi,
igaret ve nunarast (TS 2589)
Malrn adr,
- Parti ve Seri numarast,
- Yaprm tarihi (ay-ytl olarak),
- Net aPtrlt[t.
-Uretici flimala ait, Grda, Tarrm ve Hayvancrhk Bakanhlrndan ahnmrq Gtda Uretim ve Grda Sicil
Sertifikalarrnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir.
Bu gartnamede yer almayan hususlarda TS 2589 ve bu Standarda atlfyapllan TS'lart esas altnacakttr.
-
ilgili standartln
TAHiN
HELVASI:
t
Tahin helvasr; beyaz, geker, su karrgrmrna sitrik asit, tartarik asit veya krem tartardan herhangi.
birisinin ilavesi ve gerekti!inde glikoz katrlarak pigirilen gciven suyu aldalagtrnhp beyazlaqttnlan
katl
geker gurubunu tahin igineleknigine uygun olarak karrgtrtltp yo!rulmasr sonucu elde edilmig;
geqnili
olabilir'
de
i<rvarir, miitenacis ince lifligdriini.iste olmaldrr' Sade, meyveli ve
Tahin helvasr imalatlnda stabilan ve emiilgatdr olarak kullanrlan katkr maddeleri Grda Katkr
Maddeleri Ydnetmeli!i'nde kabul edilen maddeler olmaltdtr'
Tahin helvasr, niqasta veya nigastah maddeler igirmemelidir'
Genel dzellikleri;
-Tahinhelvalarrkendinehasyapl,tat,lezzetverenkteolmalldlr'Hagereveha$erepargalarl'
surfeleri, biicek kahnttlart vb. maddeler bulunmamaltdtr'
- Tahin miktarr belirtilmelidir ve en azYo 52 olmalrdtr'
-.._ Ya[ nriktarr, susam yagl olarak%o25 olmaltdtr'
Protein en az
o%9
olmahdtr.
- Toplam geker miktarr (sakkaroz olarak) en gok %45 olmaltdtr'
- Rutubet miktarr en gok o/03 olmahdrr.
zellilini
Ambal
inde pak
zarar v
net aglrl
Am
- A9a!rdaki bilgiler okunaklr olarak ambalajlann
- Firm'anrn ticaret unvanl veya krsa adl, varsa tescilli markast, adresi,
- ilgili standardrn igaret ve numarasr(TS 2590)
-
-
pmayan insan
salhlrni
olmamahdrr'
Parti numarasl,
Mami.iliin adr.
Mamiiliin tiPi,
Muhteviyati katkr maddelerinin isimleri, igindeki gekerin nevi orant,
Net agrrlrg(gr olarak)
imal tarihi(aY ve Yrlolarak)
Firmaca tavsiye edilen son kullanma tarihi veya raf iimrii
Koutrol Genel Miidiirl0fii'
Uretici firmaya ait, T.C. Grda, Tanm ve Hayvancrlrk Bakanhfr, Koruma
22000 belgesinin
C,a, S;.if ve Grda.Uretim sertifikalarr ve akredite olan kuruluglardan ahnmrg ISO
gartttr.
noter tasdikli suretlerinin ibrazt
TS'lan esas ahnacaktrr.
Bu iartnamede yer almayan hususlarda TS 25g0 v : bu Standarda atrfyapllan
77
REQEL:
Regeller, elverigli olgunluktaki ve sa$am gilek ayva, kaylst, vigne ve giil meyvelerinden cinsine uygun
olarak ylkanrp, dilimlenip kabulu soyulmug veya gekirdekleri ayrklanmrq, dilimlenmig, dilimlendiktqn
sonra TS 861 ve bu standarda izin verilen ka&r maddeleri ile hazrrlanan ve rsr iglemiyle belirli bir
koyuluPa getirilmig
!
Adr gegen meyvelerden yaprlmrq olan regeller l. st ttf ve taze meyveden veya dondurulmug meyveden
elde edilmig olmaltdtr.
olmaltdtr.
Genel rizellikleri;
Regellerde yapay boya maddesi bulunmamahdrr.
- Normal depolama kogullarrnda geligebilen mikroorganizma bulunmamaltdtr.
- Gfil regeline yaprak (ta9) miktarr %10, diler regel ambalajlannda en az meyve altrlllt
-o/o35 olmahdrr.
-.._
oranr ise
Ambalaj kaplarrnrn doldurulma orant en az%o90 olmahdr.
meyvelerden yaprlmrg olmah, kusurlu meyve igermemelidir.
salhkh
- Regeller
gegen
meyvelerden yapr lmrq olan regeller 20 gr'hk ambalajlarda ve bir kolide 120 adet olacak
Adr
-gekilde
hazrrlanmrg kolilerde teslim edilmelidir.
kullanrlan malzemeler TS 1118 kod veya amaca uygun lak'la kaplanmrg levhalardan
Ambalajlarda
-yaprlmrg
plastik ambalajlarda olmahdrr.
-
Ambalajlar iizerine aqa!ldaki bilgiler okunakh olarak yazllmrq olmahdrr.
Firmanrn ticari iinvanl, varsa tescilli markasr,
Mahn adr,
- ilgili standardrn igaret ve numarasr
-kayrsr TS 4187, giil TS 5135)
(Qilek TS 4186, incir
5
136, vigne TS 395 8, ay'va TS 4l 8E,
Srnrfr, meyve oranr ve katkr maddelerinin adr,
- Net a[rrlrk (gr olarak )
- imalat tarihi (ay ve yrl olarak)
- Imal seri/kod numarast,
- Firmaca tavsiye edilen en son kullanma tarihi veya raf 6mrii (ay ve yrl olarak)
-Uretici firmaya ait, Grda, Tarrm ve Hayvancrltk Balanhlrndan ahnmrg Grda Uretim ve Grda Sicil
sertifikalarrnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir.
Bu gartnamede yer almayan hususlarda
i
ilgili TS'lart esas allnacaktlr.
BAL
Bal; 9i9ek veya salgr bah srnrfrnda ve siizme bal tipinde olmahdrr. 20 gr'hk ambalajlarda ve bir kolide
tZO.adet olacat< gekilde hazrrlanmrg kolilerde teslim edilmelidir. Kristallegmig, zararlr, iginde di[er
bticek yumurta ve yavrulart, canlt ve canstz an difer bdcekler ile bunlann pargalarr ve artlklarl'
parafin, nigasta, gliserin, kum, toprak gibi yabancr maddeler bulunmamaltdtr'
Genel dzellikleri;
miktart %o23 'ten gok olmamahdtr.
-Rutubet4 0 gegmemelidir.
-Asitlik
-Hidroksimetil furfurol 40 mg/ kg'dan fazla olmamahdrr.
olmamah, drgardan herhangi bir madde ve koruma maddeleri, boyalar, ticari glikoz, dekstirin
-Bozuk
katrlmamahdrr.
tat, aktctltk, renk ve gdriiniim srnrf ve tipine <izgii durumda olmamalrdrr'
-Koku,
Bal ambalajlarr insan saIlr!rna zararsrz, temiz, yeni ve bahn ozelliklerini bozmayacak niteliklerde
olmahdtr. Ambalajlar iizerine agagtdaki bilgiler okunaktr ve silinmeyecek gekilde yer almahdtr'
Firmanrn ticari iinvant, adt, varsa tescilli markasr,
MaLn adr,(bal)
- ilgili standartrn igaret ve numarasl
-
Srnrfr, tipi
Parti numarast,
Net agrrlrk (gr olarak )
imalat tarihi (ay ve yrl olarak)
Imal seri/kod numarasl,
78
:
Uretici firmaya ait, Grda , Tarrm ve Hayvancrlrk Bakanhprndan ahnmlg Grda Uretim ve Grda Sicil
Sertifikalarrnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir.
Bu gartnamede yer almayan hususlarda TS 3036 ve bu standartta atrfyaprlan standartlar esas
aLnacaktrr.
TAHIN-PEKMEZ(PiKNiK TiP):
TUrk Grda Kodeksine uygun olmahdrr. Adr gegen 0riin 20 gramhk ambalajlarda ve bir kolide yiiz adet
Ozellikleri;
i'
olacak gekilde hazrrlanmtg kolilerde teslim edilmelidir. Genel
i l, | 8 kod veya amaca uygun lakla kaplanmrg, levhalardan yaprlmrg, plastik ambalajlarda
-TSE
olmahdrr.
Ambalajlar iizerine agalrdaki bilgiler okunakh olarak yazrlmrq olmaltdrr.
Firmanrn ticari iinvant, adr, varsa tescilli markasr,
Mahn adr,
Parti numarast,
Net afrrhk (gr olarak )
Imalat tarihi (ay ve yrl olarak)
Imal seri/kod numarasl,
tavsiye edilen en son kullanma tarihi veya raf timrii(ay ve yrl olarak)
-Firmaca
Uretici firmaya ait, Ctda, Tarrm ve Hayvancthk Bakanlr$rndan ahnmrg Grda Uretim ve Grda Sicil
Sertifikalarrnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir.
Bu gartnamede yer almayan hususlarda TS'larl esas alrnacaktrr.
-
KAKAOLU FINDIK KREMASI:
En az%;l0 frndrk piiresi, en az Vo5 kakao, yagslz siit tozu, peynir altr suyu tozu igirmelidir. Tiirk Grda
Kodeksine uygun olmahdrr. Adr gegen iiriin 20 gramhk ambalajlarda 100'er adet olacak gekilde
kolilerde teslim edilmelidir.
Ambalajlar iizerine aqa$rdaki bilgiler okunakh olarak yazrlmrq olmahdrr.
Firmanrn ticari tinvant, adt, varsa tescilli markast,
MaLn adr,
Parti numarasr,
Net agrrhk (gr olarak )
lmalat tarihi (ay ve yrl olarak)
Imal seri/kod numarasrr
tavsiye edilen en son kullanma tarihi veya raf dmrii(ay ve yrl olarak)
-Firmaca
Uretici firmaya ait, Grda, Tarlm ve Hayvancrhk Bakanhlrndan ahnmrg Grda Uretim ve Grda Sicil
Sertifikalarrnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir.
Bu gartnamede yer almayan hususlarda TS'lart esas altnacakttr.
-
BARBUNYA:
Barbunyalar; sa$lam, biitiin ve iyi kurutulmug olmalrdlr. Bunlarda canlr biicek, gdzle gdrtilebilir
kimyasal rnadde arttklan, anonnal drg nem boyact tat ve koku, ktrtk ve bozuk tane bulunmamaltdrr.
Barbunyalar, bozuk, kiiflenmig, giirtimiig, lekelenmig, kendine tizgti renk, tat ve kokusunu yitirmig,
ctictiklemis, bdcek veya di[er zararltlar tarafindan glplak gdzle g6rtilebilecek kadar yenmig veya
delinmiq olmamahdrr.
Barbunyalafln tane renkleri diiz bej, zemin iizerine krmtngizgili ve yahut alacalt; Sekilleri yuvarlapa
yakrn oval ve taneler biiyiik olmalldlr.
Rutubet miktan en gok%ol4,5
Yabanct madde miktarr alrrhkga en gok% l,
Kalbur altr a[rrhkga en gok oZl,
Bozuk tane afrrhkga en gok o/o l,
- Krnk tane aftrhkga o%l olmaltdtr.
-Barbunyalar; sa$lr$a zarar vermeyecek nitelikte yeni, temiz, kuru, kokusuz 25 kg'lrk guvallar
igerisinde ambalajlanmrg olmaltdrr.
Ambalajlaln tizeiindeki ijriin etiketleri Tiirk Grda Kodeksinde tanrmlanan bilgileri igermelidir. Uretici
firmaya ait, Grda, Tartm ve Hayvancrhk Bakanhltndan ahnmt9 Grda Uretim ve Grda Sicil
Sertifikalarrnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir. Bu gartnamede
yer almayan hususlarda TS l4l ve bu standartta atlf yapllan standartlar esas alrnacakttr.
DOMATES SALCASI:
79
elde i
Domates salgasr; olgun, sallam tabii domateslerin tekniline uygun olarak iglenmesi sonucu
edilmig olmahdrr. Duble konsantre salga tipinde; suda g<iziilebilen, ,kuru madde miktarl %28-30
arasrnda olacak.
Kendine has kokuda olmah, yabanct koku bulunmamaltdlr. Kendine has tatta olmall, yanrk tat
bulunmamahdrr. Gtirtintigii kendine has yeknesak goriinii$te olmah; sal9a, imalinde kullanrlmasr
kabul edilen her tiirlij maddenin dr$rndaki maddeler ile kabuk, gekirdek ve bunlarrn pargacrklan gibi
yabancl maddeler bulunmamahdrr. Salgalar 5 Kg'hk ambalajlarda teslim edihnelidir. Salgalar tuzsuz
'
olacaktrr.
Kutular; mekanik tesirlerle bigimleri bozulmamtg, bombajsrz, slztnttstz ve kutu drqr passtz olmah,
*;/o9O 1rlul; siyah leke miktarr en gok 2 adet /gram, i
kenet hatasr of mamahdrr. Kutu dolu orant
"n
kutu kapasitesi T52664'e uygun olmaltdtr.
Domates salgasr hermetik olarak kapatrlabilen TS 1234'e uygun dzellikteki kalayh ve kalaysrz kromlu
lak'lr levhalardan yaprlmrS olan ve ebatlart TS 1924'e uygun teneke kutu, kavanoz igerisinde
konu lmug olrnalrdrr.
Ambalajlar iizerinde a;aIrdaki bilgiler yer almahdrr.
imalatgr firmanrn ticari unvant veya ktsa adt, adresi, varsa tescilli markasr,
- Malrn adr,
-
Tipi, geqidi,
TS 1466 'nrn igaret ve numarast
imalat tarihi (ay-ytl olarak)
Parti, seri veya kod numaralartndan en az birisi,
Net miktafl,
Firmaca tavsiye edilen raf <imrii veya son kullanma tarihi,
- Ciiziiniir kuru madde
Ambalajlaln tizerindeki iirun etiketleri Tiirk Grda Kodeksinde
tantmlanan bilgileri igermelidir.
Uretici hrmaya ait, Grda, Tarrm ve Hayvancrhk Bakanh[rndan ahnmrg Grda Uretim ve Grda Sicil
Sertifikalalnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir.
!
Bu gartnamede yer almayan hususlarda TS 1466 ve bu standartta atrfyapllan standartlar esas
alrnacaktrr.
KURU FASULYE:
Kuru fasulyeler; saglam, biittin ve iyi kurutulmuq olmahdrr. Bunlarda canh bdcek, gtizle goriilebilir
kimyasal madde artrklan, anormal drq nem, yabancr tat ve koku, ktrrk ve bozuk tane bulunmamalldtr'
Kuru fasulyeler, bozuk, ktiflenmig, giiriimti$, lekelenmig, kendine ozgi.i renk, tat ve kokusunu yitirmi$.
ctici.ikfemig veya d iler zararliar tarafrndan glplak gi1'zle gtirtilebilecek kadar yenmig veya delinmig
olmamahdtr.
Geligigtizel ahnacak 100 adet fasulyenin af,rrh!r 60g'dan agalr olmayacaktrr. Pigme siiresi;
rslatilmadan ve normal gartlarda 3,5 saati gegmeyecektir Kuru Fasulyeler yeni iiriin olmall, rutubet
miktarr alrrhkga en gok o/o14.5 olmaltdrr.
o/ol,
Yabancr madde miktarr alrrlrkgr en gok
- Kalbur altr alrrhkga en gok o% .,
- Bozuk tane a[rrhkga en gok o/o I
-- Krnk tane a[trltkga en 9ok %l ,
Diper gegitlerden taneler, a$rrhkga en 9ok %5 olmahdrr.
-Kuru Fasulyeler sa[h[a zarar vermeyecek nitelikte yeni, temiz, kuru,kokusuz 25 Kg'hk guvallar
.
igerisinde ambalajlanmrq olmahdrr.
Ambalajlarrn iizerindeki iiriin etiketleri Tiirk Grda Kodeksinde tantmlanan bilg-ileri igermelidir.
Uretici rtrmaya ait, Grda, Tanm ve Hayvancrltk Bakanhprndan alrnmr9 Grda Uretim ve Grda Sicil
Sertifikalarrnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir.
Bu gartnamede yer almayan hususlarda TS l4l ve bu standartta atlfyaptlan standartlar esas
alrnacaktrr.
KURUNOHUT:
Nohutlar; saglam, biitiin ve iyi kurutulmug olmahdrr. Bunlarda canh biicek, gdzle giiriilebilir kimyasal
madde artrklan, anormal dr9 nem, yabancriat ve koku, krrtk ve bozuk tane bulunmamahdr.. '
Nohutlar, bozuk tane, ktiflenmig, giiriimii$, lekelenmig, kendine ozgii renk, tat ve kokusunu yitirmig,
ciiciiklemig b<icek veya diler zararhlar tarafindan grplak gdzle giiriilebilecek kadar yenmiq veya
80
delinmig biitlln veya tolerans stntrtnt agan ktnk nohutlar ile geliqmesini tamamlayamamtq ham
nohutlar bulunmamaltdtr.
miktarr alrrhkga en gok0/o14,5,
i
-Rutubet
Yabancr madde miktarr alrrhkgr en gok V:02,
Kalbur altr aPrrlrkga en gok o/o3,
- Bozuk tane a[rrhkga en 9ok o/o3
- Krrrk tane altrlrkga en gok o43,
- Di$er gegitlerden kangma oranr, a[rrlkga en gok % I 0 olmahd rr
-Nohutlar, sa!h!a zarar vermeyecek nitelikte yeni, temiz, kuru, kokusuz 25 Kg'hk guvallar igerisinde
ambalajlanmrgolmahdrr.200gnohuttartrldr[rnda240adedigegmeyecektir.Gegtili taktirde 300
adedige9memek9ar|i|e%o|firelikabuledilecekdahafaz|asrreddedilecektir.Pigmesiiresi;
rslatrlmadan ve normal gartlarda 3,5 saati gegmeyecektir
Ambalajlarrn iizerindeki iiriin etiketleri Tiirk Grda Kodeksinde tantmlanan bilgileri igermelidir.
Uretici firmaya ait, Grda, Tartm ve Hayvancrhk Bakanhlrndan ahnmrg Crda Uretim ve Glda Sicil
Sertifikalarrnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir.
Bu $artnamede yer almayan hususlarda TS 142 ve bu standartta atlfyaprlan standartlar esas
alrnacaktrr.
[email protected]):
Baldo piringler; kirlenmiq, aclmrg, ktiflti, canh, cansrz, kurtlu ve bijcekli olmamalt ve aralarrnda btjcek
kalrntrlan bulunmamalrdrr. Piringler kendine has renk koku ve tat da olmah, yabancl koku ve tat
bulunmamahdrr. Rutubet miktarr 0% l5'ii gegmemelidir.
Baldo piringler, ekstra veya I srnrf niteliklerini tagryan uzun taneli (tane uzunluklart 6 mm ve daha
uzun olan piringler) olmalrdrr. Krrtk orant en 9ok% 5 olmaltdtr'
Baldo piringlerde yabancr madde, tag toprak, kum, kavuz, kepek, bdcek yenikli piringler piring
drgrndaki tohum ve taneler ile unlagmrg piring pargalarr ve embriyon gibi maddeler mtisaade edilen
slnrrlaln fizerinde bulunmamahdrr. Piringler gegit olarak pilavhk piring niteliklerini tagrmahdrr.
Lekeli, gigekli ve sararmrg piringler tebe$irlegmig piring, ham piring, mandrk,(krrmrzrgizgili) piring
.
olmamaltdrr.
Baldo piringler 25 Kg'hk ambalajlarda teslim edilmelidir. Ambalajlamada kullanrlan malzeme
saklama siiiesince piiinglerin iyi korunmasrnr sallayacak nitelikte j0t pamuk ipli[i ve diler uygun
malzemeden yaprlmrg guval ve torbalar kullanrlmahdrr. Kullanrlan her geqit malzeme sa$lam, temiz,
kuru ve insan sa$hlrna zararsrz olmalrdrr. Piringler I kg r pigirilip denenerek altnacakttr
Ambalajlarrn tizerindet<i iiriin edketleri Tiirk Grda Kodeksinde tantmlanan bilgileri igermelidir.
Uretici frrmaya ait, Grda, Tarrm ve Hayvancrhk Bakanhprndan ahnmrg Grda Uretim ve Grda Sicil
Sertifikalarrnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir.
Bu ;artnamede yer almayan hususlarda TS 2408 ve bu standartta atlf yapllan standartlar esas
alrnacaktrr.
ASURELiKBUGDAY:
Bugdaylar kendine dzgii renk, koku ve tat da olmalr, bunlarda yabaDcl tat ve koku tjzellikle ktztgma ve
kiif:kolusu bulunmamilrdrr. igerisinde bulday biti ve diper canh bdcekler gdrii lmemelid ir. Islak
olmamah ve rutubet miktart %14'i gegmemelidir'
Buldaylar igerisinde yabancr madde, bozuk tane, siirmeli, krrrk, sert veya yumuqak yaprh taneler
toleranslann i.izerinde bulunmamahdrr.
Bufdaylar 25 kg'hk arrbalajlar halinde teslim edilebilir. Ambalajlar iiriinii iyi bir durumdatutacak
nitJikie saglam, temiz, kuru, kokusuz ve insan sa[lr[rna zararstz torba ve guvallardan yapttmtg
olmaLdrr.
Ambalajla n iizerindeki iiriin etiketleri Tiirk Grda Kodeksinde tantmlanan bilgileri igermelidir.
Uretici frrmaya ait, Gtda, Tarrm ve Hayvancrhk Bakanhlrndan ahnmrq Grda Uretim ve Crda Sicil
Sertifikalarrnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir.
Bu $artnamede yer almayan hususlarda TS 2974 ve bu standartta attf yaprlan standartlar esas
alrnacaktrr.
BULGUR:
Bulgur taneleri: saElam, temiz, kendine dzgii renk, tat ve kokuda olmah, kuflenmi; ve ktiflenmeden
dolayr tadrnda ve k-okusunda bir defigiklik olmamalr, iginde hi9_bir yabanct madde bulunmamaltdtr
yumurtalarl ve
Buleurlarda canlr bricek ve carrstz lraqere ve parazitler veya bunlartn pargactklarl,
.
8l
bozuk taneler bulunmamalrdrr. Bulgurlar boyanmrq ve suni olarak alartrlmrq olmamah, iglerinde
sa!lrpa zararlt veya zararstz herhangi bir bagka madde bulunmamalldtr.
Bulgurlarda rutubet miktan %13'ii, kuru madde de kiil miktarr %1.75'i gegmemelidir. Bulgurlar
pilavlk bulgur tipinde olmah, g0z agrklrlr 1,5 mm olan elelin iizerinde kalmaltdtr. Bunlarda; aprrhkqa
ta$, kum ve 9t p miktan %0,01'i yabanct ot ve tohumlarr miktarr % I'i, gok iri taneler I'i, beyazh j
taneler %l'i, elek altr miktan 040,5'i gegmemelidir.
Bulgurlar; 25 Kg'hk ambalajlar halinde teslim edilmelidir. Ambalaj malzemesi bulguru iyi bir gekildg
koruyacak nitelikte; Grda maddeleri tiiziiliinde izin verilen, insan sa!h!rna zararstz, sa!lam, temiz,
yamaslz torba veya kutular olmaltdlr.
Ambalajlann i.izerindeki iiriin etiketleri Tiirk Grda Kodeksinde tanrmlanan bilgileri igermelidir.
Uretici finraya ait, Gtda, Tartm ve Hayvanctltk Bakanh[rndan altnmtg Grda Uretim ve Grda Sicil
Sertifikalarrnrn rnal teslirnlerinde muayene komisyonuna ibraz edilmesi gerekmektedir.
Bu $artnamede yer almayan hususlarda TS 2284 ve bu standartta atlf yapllan standartlar esas
alrnacaktrr.
KOFTELiK BULGUR @UGUT:
Kdftelik Bulgur taneleri; saflam, temiz, kendine dzgii renk, tat ve kokuda olmah, kiiflenmig ve
kiiflenmeden dolayr tadrnda ve kokusunda bir deligiklik olmamah, iginde hi9 bir yabancr madde
bulunmamalrdrr. K<iftelik Bulgurlarda canh bdcek ve canstz haqere ve parazitler veya bunlartn
pargacrklan, yumurtalan ve bozuk taneler bulunmamaltdtr. K<iftelik Bulgurlar boyanmtg ve suni
olarak alartrlmrg olmamall, iglerinde saflr$a z ararlt veya zararsrz herhangi bir bagka madde
bulunmamalrdrr.
Kdftelik Bufgurlarda rutubet miktan %13'ii, kuru madde de kiil miktarr %o2'yi gegmemelidir. Kttftelik
Bulgur tipinde (tip 5 ) olmah, gdz agrkhlr 0.5 mm olan elelin i.izerinde ve gdz agrkh$t 2 mm olan
elelin altrnda olmahdrr. Bunlarda; aprrhkga tag, kum ve gcip miktarr %0,01'i yabancr ot ve tohumlan.
miktan %l'i, gok iri taneler l'i, beyazh taneler o/ol'i, elek alh miktan %0,5'i gegmemelidir.
K<iftelik Bulgurlar;25 Kg'Lk ambalajlar halinde teslim edilmelidir. Ambalaj malzemesi bulguru iyi
bir gekilde koruyacak nitelikte; Grda maddeleri ttiziiliinde izin verilen, insan salh!rna zararsrz,
sa$lam, temiz, yamasrz torba veya kutular olmalrdrr.
Ambalajlarrn ijzerindeki iiriin etiketleri l'i.irk Grda (odeksinde tantmlanan bilgileri igermelidir.
Uretici firmaya ait, Grda, Tarrm ve Hayvancrlrk Bakanlr$rndan alrnmrE Grda Uretim ve Crda Sicil
Sertifikalarrnrn ma I teslim lerinde muayene komisyonuna ibraz editmesi gerekmektedir.
Bu gartnamede yer almayan hususlarda TS 2284 ve 6t standartta atrfyaprlan standartlar esas
alrnacaktlr.
iRMiK
o/o
irmikte kuru madde protein miktan en azYo10,9 olmahdrr. Kuru madde de kiil miktarr I 'den ve
ktiliin %lO,luk hidroklorik asit de g<iziinmeyen krsmr %0.15'den gok olmamahdrr. lrmik de rutubet
miktarr %14'ii a$mamahdrr. irmikler temiz kendine dzgii renk, koku, tat ve gdriintiste olmah; iginde
yabancr madde bulunmamahdrr. Boylamada ince innik gurubunda ve g0z agrktlr 125 mikron olan
il"gin ti.lind. kalan irmikler olmalrdrr. irmikler krzlgmr', acrmrg, ekgimig, kqflenmig, kokmuq veya '
herhangi bir qekilde bozulmug olmamah. iginde zararh bitki tohumlarr, biicek, kurt, kilf ve di!er
canh,cinsrt parazitler, bunlarrn kalrntr vb. kirlilikte bulunmamalr, boyanmamrg. sagltga zararstnda .
olsa kirnyasal maddeler ile iglem grirmemig olmahdrr. irmikler 500 gr'lrk ambalajlarda teslim
edilmelidir. Ambalajlar yeni ve igindeki mah iyi bir gekilde koruyabilecek tizellikte G.M. T 'de
miisaade edilen insan saphlrna zararslz saglam ve temiz maddelerden yaprlmrg olmahdrr. Irmik
helvasr icin 3 numara irmik kullanrlacakttr.
iizerindeki ijriin etiketleri Tiirk Grda Kodeksinde tanrmlanan bilgileri igermelidir.
Ambalajlarrn
-firmaya
ait, Grda, Tanm ve Hayvancrlrk Bakanlr[rndan ahnmtp Grda Uretim ve Grda Sicil
Uretici
Sertifikalarrntn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir'
Bu gartnamede yer almayan hususlarda TS 2283 ve bu standartta atlfyaptlan standartlar esas
alrnacaktrr.
NiSASTA:
Nigastalar; toz halinde, beyaz renkte ve homojen yaprda, kendine has tad ve kokuda, acrlaSmamrg;
0/016,
kendine has tjzellilini herhangi bir gekilde kaybetmi; olmamalrdrr. Rutubet bu[day nigastasrnda
mrsrr niSastasrnda % l8'den 9ok olmayacaktrr. Nigastalann fiziksel, Kimyasal ve Mikrobiyolojik
82
:
:
:
dzellikleri TS 2970'de belirtilen niteliklere sahip olmahdrr. iglerinde b<icek ve bdcek pargalan veya '
herhangi bir yabanct madde bulunmamalt, sararmtg olmamaltdtr.
Nigastalar, 1000 gr'hk ambalajlar halinde teslim edilmelidir. Ambalaj malzemesi olarak; nigastalarm
<izelliIini bozmayacak y6da ni$astadan etkilenmeyeoek ttzellikteki kagrt, karton, bez, plastik vb.
maddeler kullanrlmahdrr.
Ambalajlarrn iizerindeki iirijn etiketleri Ttirk Grda Kodeksinde tanrmlanan bilgileri igermelidir.
Uretici firmaya ait, Grda, Tarrm ve Hayvancrlrk Bakanhlrndan ahnmrg Glda Uretim ve Grda Sicil
Sertifikalarrnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir'
1
Bu Sartnamede yer almayan hususlarda TS 2970 veb]u standartta attfyapllan standartlar esas
ahnacaktrr.
TARHANA:
Tarhana renk sartmttrak turuncu koku ve tat kendine dzgii olacaktrr. Tarhana TSE 2882ye uygtn
bigimdeki ambalajlar iginde gelecek, iizerinde yaprm tarihi ay ve yrl olarak yazrll olacak, imalatgr
firmanrn adt ve adresi olacakttr.
PiRiNq UNU:
Piring unu; kendine 6zgii renk, koku, tat ve gdriinUgte olmah iginde yabancr madde bulunmamalt.
Ayflca krzrgmrg, acrmrg, ek9imi9, kiiflenmig, kokmug veya herhangi bir gekilde kendine dzgii niteli!i.
de!igmig olmamalldrr. Piring unu iginde bOcek, kurt ve difer canh, cansrz parazitler, bunlarrn kallntr
ve benzeri kirlilikleri ile kavuz pargacrklan bulunmamahdrr. Piring unu boyanmtg ve renk agartma
iqlemine u[ramrg; zararslz da olsa kimyasal maddelerle mamule edilmig olmamaltdtr. Yabancr higbir
madde bulunmamaltdlr.
o/o6'nln altlnda
Pirinc ununda rutubet miktarr Vol4'den f'azla; kuru madde de protein miktarl
olmamalrdrr. Kuru madde de kiilmiktarr %o0,7'den fazla olmamaltdtr.
Piring unu 500 gr'lrk ambalajlar halinde teslim edilmelidir. Ambalajlamada kullanrlacak malzeme
yeni, saflam, kuru, temiz, yamastz, insan sagllglna zarar vermeyen, torba veya kutular olmalldtr'
Ambalajlarrn iizerindeki tiriin etiketleri Tiirk Grda Kodeksinde tantmlanan bilgileri igermelidir.
Uretici frrmaya ait, Grda, Tarrm ve Hayvancrhk Bakanhlrndan ahnmrg Grda Uretim ve Grda Sicil
Sertifikalarrnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir.
Bu gartnamede yer almayan hususlarda TS 2639 ve bu Standarda atrfyaprlan TS'larl esas ahnacaktlr.
BUGDAY UNU:
Unlar; kendine iizgii tat ve kokuda olmalr, aclm4 ekqime ktiflenme, kokugma, bozulma vb. yabanct
tat ve koku bulunmamahdrr. Kendine 6zgii renk ve gdri.iniiqte olmah gtizle gdriilen yabancr madde
buf unmamalr; ambar zararllan, parga ve kaltnttst olmamahdrr. Alartma igleri uygulanmamlg
olmalldlr. Yerli mah 60-70 randrmanh bulday unu olup, hafifsanmtlrak, beyaz renkte olacaktrr.
Unlar, pasta, bdrek ve tath yaprmrnda uygun, tip bir olmahdrr. Kiil miktarr tip I unlarda %0,6 olmah,
i.iriinler yeni mahsul olmahdrr.
o%14 rutubet esaslna
Unlar net un agrrltgt 25 Kg olan ambalajlarda teslim edilmelidir. Net un alrrhlr
gore hesaplanmrg olmahdrr. Ambalajlamada G.M. T. genel esaslan belirlenmig olan kilrt veya bez
torbalar kuf lanrlmalrdrr. Bunlar alrzlarr agrlmayacak gekilde dikilmig yeya sa$lr$a zararsrz tutkallarla
yaprptrrrlmrg olmalrdtr.
Ambalajlarrn iizerindeki iiriin etiketleri l-tirk Crda Kodeksinde tanrmlanan bilgileri igermelidir'
Uretici firmaya ait, Crda, Tarrm ve Hayvancrhk Bakanlr[rndan alrnmrg Grda Uretim ve Grda Sicil
Sertifikalarrnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir'
Bu $artnamede yer almayan hususlarda TS 4500 ve bu Standarda atrfyaprlan TS'lart esas allnacaktlr.
ERi$Tf,:
l- Bulday unundan usuliine
gdre yaprlmtg eriqteler olacakhr. Bulday unundan bagka un karlgtrrrlmrg
olmayacaktrr.
2- Erigteler %l tuz ihtiva eden kaynar suya atrlarak 20 dakika kaynatrldrlrnda hepsi pigmig olacak
fakat dagrlmayacaktrr.
3- Teslim gekli; 5kg.hk paketlerde olacaktrr.
4- Ambalaj iizerindi iiretici firmanrn adt, adresi, TS numarasl, net agtrllgl, imal ve son kullanma
tarihleri, cinsi yazrh olacakttr. Son kullanma tarihinden tince bozulan ve numuneden farkh grkan
0r0nler mi.iteahhit fi rma taraftndan degi$tirilecektir.
5- Yerlimah ve iyi cins olacakttr. Boyasrz, tabii renkte olacaktlr. Koyu san, ye;il, yeqilimtrrak,
esmerimsi renk olmayacakttr. Ev tipi erigte ku llanrlacakttr.
83
6- iginde gatlak olmayacak, canlt-canstz hagarat ve yumurtalarl bulunmayacaktrr.
7- Bu gartnamede bulunmayan difier hususlar igin CMT gegerli olacakhr.
MAKARNA:
Makarnalar; kirlenmig, acrmrg, ktifli.i, kurtlu, bdcek ve zararltlarca yenik olmamaltdrr.
Kendine ozg[ renk, koku ve tad da olmah, pigmeden rince ve pigirildikten sonra yabanct koku ve
-tat da olmamalr ve iginde yabancl madde boya ve tuz bulunmamaltdtr.
tuzlu, kaynar suda en 9ok 20 dakika kaynatrldrlrnda hepsi iyice pigmeli, daltlmamah ve suya
-l'lik
gegen madde miktan (kuru madde esastna gcire ) %1O'dan gok olmarnaltdrr.
Rutubet miktan %13'ii gegmemelidir.
-Ambalaj; tagrma ve saklama siiresince iyi bir durumda tutacak nitelikte
,
i
olmak tizere, selafon kAflrt,
kullanrlan her 9e9it
yaprlmrg
Ambalajlamada
olmahdrr.
karton, polietilen vb. uygun malzemeden
makamalar
aynr
ambalajdaki
malzeme yeni, temiz, kuru, kokusuz ve insan salh[rna zararstz olmalt,
qeqit bakrmrndan bir drnek olmaltdrr. Ambalaj a!rrh!r 5 kg olmahdrr.
Aqafrdaki bilgiler okunakh olarak, silinmeyecek ve bozulmayacak qekilde yazrlmahdrr.
Firmanrn adr veya tescilli markast ve adresi,
-- Tiirk Malr deyimi veya TM igareti.
ilgili standardrn isaret ve numarasr (TS 1620)
- lmalat seri ve parti numarasl.
- Mahn adr veya geqidi
- Net a!rrhIr(kg olarak)
- imalat tarihi(ay-yrl olarak)
-Ambalajlarrn iizerindeki ijrtin etiketleri Tiirk Grda Kodeksinde tantmlanan
bilgileri igermelidir.
Grda
Uretim ve Grda Sicil
ahnmtg
Bakanhlrndan
Uretici frrmaya ait, Gtda, Tartm ve Haynrancrlk
gerekmektedir.
Sertifikalarrnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi
Bu $artnamede yer almayan hususlarda TS 1620 ve bu Standarda atrfyaprlan TS'lart esas allnacaktlr.
$EHRiYf,(ARPAVDTEL):
E
$ehriyeler, kirlennrig, acrrnrg, kiillii, kurtlu, bcicek ve zararlllarca yetrik ohnarnalrdrr.
Kendine cizgii renk, koku ve tat da olmalr, pigirmeden once piqirildikten sonra yabancl koku ve tat
-da olmamah ve iginde yabancr madde, boya ve tuz bulunmamalldtr.
tuzlu, kaynar suda en gok 20 dakika kaynatrldrlrnda hepsi iyice pigmeli, daltlmamah ve suya
-l'lik
gegen madde miktarr (kuru madde esasrna gdre ) %ol0'dan gok olmamahdrr.
Kuru maddede protein miktart %10.5-13.5 arastnda olmaltdtr.
- Rutubet miktan %13'ti gegmemelidir.
-Ambalaj; ta$lma ve saklama siiresince gehriyeleri iyi bir durumda tutacak nitelikte olmak iizere,
selafon irigrt, karton, polietilen vb. uygun nralzemeden yaprlmrg ohnalrdrr. Ambalajlamada kullanrlai
her gegit nalzeme yeni, terniz, kuru, kokusuz ve insan sa[lrlrna zararstz olmalt, aynr ambalajdaki
gehriyeler geqit baktmrndan bir tirnek olmahdrr. Ambalaj alrrhlr 5 kg olmahdrr.
Aga[rdaki bilgiler okunakh olarak, silinmeyecek ve bozulmayacak qekilde yazrlmahdrr'
Firmanrn adr veya tescilli markast ve adresi,
- Tiirk Mah deyimi veya TM igareti,
- ilgili standardrn iqaret ve numarasr (TS 1620)
- Imalat seri ve parti numarast,
- Mahn adr veya gegidi
- Net agrrlrBr (Kg olarak),
- imalat tarihi (ay-yrlolarak)
-Arnbalajlann iizerindeki iiriin etiketleri Tiirk Grda Kodeksinde
it
tantmlanan bilgileri igermelidir.
ahnmrg Grda Uretim ve Grda Sicil
ve
Bakanh[rndan
Tarrm
Hayvancrlrk
Uretici irmaya ait, Grda,
gerekmektedir'
edilmesi
ibraz
Sertifikalarrnrn mal teslimlerinde muayene komisyonuna
yaprlan
TS'lan esas altnacakttr.
atrf
Bu gartnamede yer almayan hususlarda TS 1620 ve bu Standarda
sisxirvi:
Biskiiviler; gevrek bir drnek yapt ve gdriinii$te, kendine has renk, tat ve kokuda olmall, yabancl tat ve
!
koku almamrs olmalrdrr. Grda katkr Maddeleri Ytinetmelifi'nde kullantlmastna izin verilenlerin
drgrnda boya maddeleri kullanllmamrg olmalrdrr. Kirlenmig, acrmrg, sabunlagmrg, kiiflti, kurtlu, bdcek
vb. parga iahntrh ayrrca zedelenmig olmamahdrr. Biskijviler sade olmah, tip iizelliIi olarak kurumun
istegine bagh olarak tuzlu veya tatll biski.ivi tipinde olmahdrr.
84
o% 1.5, gekerli
Rutubet miktan en gok o/o6, kiil miktan kuru madde de tuzlu bisktivilerde en gok
o/o8,
gekerli bisktvilerde geke{
biskiivilerde ise o/o1.0 olmahdrr. Tuzlu biskiivilerde tuz miktan en 9ok
miktan en azYol\ olmaltdr.
Biskiivilerin ambalaj lanmasrnda kullanrlacak malzeme, krrtlmayr <inleyecek, tiriinii iyi bir gekilde
muhafaza edebilecek ya! emmeyen, rutubet gekmeyen nitelikte, selafon kaglt, karton, teneke,
polietilen vb. maddelerden yaprlmrg olmahdlr. Malzemeler kuru, kokusuz insan sagllglna zararslz ve,
sallam of malrdrr. Net ambalaj aprhlr 2.4 Kg olmahdrr.
Ambalajlaln iizerindeki ijriin etiketleri Tiirk Grda Kodeksinde tantmlanan bilgileri igermelidir.
Uretici hrnraya ait, Grda, Taflm ve Hayvancrlrk Bakanlllrndan ahnmrq Crda Uretim ve Grda Sicil
Sertifikalarrnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir.
Bu $artnamede yer almayan hususlarda TS 2383 ve bu Standarda atrfyaprlan TS'larr esas altnacakttr;
TEL KADAYIF:
Tel kadayrflar; ktzartrlmrg tipinde ve ince tel kadayrf gegidinde saplam, temiz, kendine has giiriinii$te
olma1, ekqimig ve actmtq olmamalt, kendine mahsus, renk, tat ve kokuda olmaltdtr. Ki.if kokusu, kiif
tadr veya g<izle gciriilebilen bir kiiflenme meydana gelmig olmamah, 962le gdriilebilen yabanct madde
bulunmamahdrr.
l/2 ila 5 Kg'hk ambalajlarda gelecek.
Ambalajlamada kullanrlacak malzeme tel kadayfa zarar vermeyecek ve tel kadayrfrn dzelliklerini
koruyacik nitelikte kagrt, selafon, aluminyum, plastik esash maddeler kullanrlmahdrr'
Ambalajlann iizerindeki tiriin etiketleri Tiirk Grda Kodeksinde tantmlanan bilgileri igermelidir.
Uretici firmaya ait, Glda, Tartm ve Hayvancrhk Bakanhlrndan ahnmrg Grda Uretim ve Grda Sicil
Sertifikalarrnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir.
Bu gartnamede yer almayan hususlarda TS 10344 ve bu standartta atrf yapr lan TS'larr esas altnacakttr.
YUFKA:
Yufkalar; kendine has renkte ve yaklaqrk daire geklinde olmah, pargalanmrq ve kiiflenmig olmamahdtr.
Kendine has tat ve kokuda olmah, acrlagmtg, ek;imi9, kokugmuq olmamah; kiifkokusu ve tat
hissedilmemelidir. Gtizle g<lriilebilen yabanct madde bulunmamahdrr.
Rutubet r.niktarr en Qok o/o43, tuz miktan en goko/02 olmahdrr.
yufkanrn ambalajrnda kullanrlan malzeme, yufkanrn 0zelliklerini bozmayacak ve yufkadan olumsuz
ydnde etkilenmeyecek nitelikte, karton, mukavva veya 6zel mevzuatlna uygun plastik ambalajlar igine
Lonularak teslim edilmelidir. Ambalaj alrrlrklarr I Kg'dan 5 Kg'a kadar olabilir'
Ambalajlaln i.izerindeki iiri.in etiketleri Tiirk Grda Kodeksinde tanrmlanan bilgileri igermelidir.
Uretici hrmaya ait, Grda, Tarrm ve Hayvancrhk Bakanhlrndan alrnmrq Grda Uretim ve Grda Sicil
Sertifikalaflnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir.
Bu gartnamede yer almayan hususlarda TS 10443 ve bu standartta atlfyaptlan TS'larr esas
.
alrnacaktlr.
KONSERVE: (Ti.irlii, Taze Fastilye, Taze Bezelye, Bamya)
Konserveler; gegidine dzgu tat ve kokuda olmah, hig bir yabancr tat, koku ve madde bulunmamaltdtr.
icindeki sebzelei, fazla sirt veya fazla pigrnig olmamahdrr. igindeki tuz ve limon hrzundan baEka katkt
o/o0,3'ii
maddesi bulunmamalrdrr. Dolgu suyu igindeki tuz miktan %o2'yi,limon tuzu veya suyu
o%70'inden az (Bezelye konservesinde o/060)
gegmemelidir. Konserve de siizme a[rrhpr net a[rrlr[rn
tepe boglulu kabin hacminin 7o l0'undan gok olmamahdrr'
Kbnserve idilecek sebzelerTS 7g8,TS797,TS 1255, TS 1205, TS 794, TS l898,TS 1467'de
belirtilen gartlara uygun sebzelerden imal edilmig olmaltdlr. Konserve ambalajlarl sallam, zarar
gormemig ve bombajsrz olmalrdrr. Kabulii yaprlan konserveler ambalajlan tizerinde yer_alan siizme ,
ilrrhk iizerinden iagede kullanrlacaktrr. Konserveler 5'hk ambalajlarda teslim edilmelidir.
A-mbalajlamada hermetik olarak kapatrlmrq laklanmrg kok teneke kutular igerisinde olmahdtr.
Arrbalajlarrn iizerindeki iiriln etiketleri Ttirk Grda Kodeksinde tantmlanan bilgileri igermelidir.
Uretici rtrmaya ait, Grda, Tarrm ve Hayvancrhk Bakanh[rndan altnmrq Grda Uretim ve Grda Sicil
Sertifikalaflnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir.
Bu gartnamede yer almayan hususlarda TS l468,T5 382, TS 1470 ve bu standartta atrfyaprlan TS'larr
esas ahnacakttr.
DONDURULMU$ TAZE FASULYE:
bondu.rlnrus tare iasulyeler (9496 no'lu TS'da) yazrlr olan ve
aqagrda
belirtilen delerlere uygun
olarak haztrlanmts olmah.
85
Dondurulacak taze fasulyeler aynr gegit ve kendine has renkte olmalt.
Taze fasulyeler taze, temiz, sa!lam ve dondurulmaya uygun olgunlukta ve uglart altnmtg olmalt,
krlcrkll ve kart olmamalt.
Taze fasulyeler kendine dzgii tat ve kokuda olmalr, yabancl tat ve koku ahnmrg olmamalt.
Tazefasu|yelernormalboydakesilmigolma|r,butiinveyaktsakesilmi9olmamalr.
Taze fasulyeler temiz g<iriintimlii olmah, bdcek yeni$i ve hastahklarrn meydana getirdi[i zararlar,
donma yanrklan, bereler ile yabancr madde (kendinden baqka her tiirlii madde) bulunmamah.
Taze fasulyeler sulu (veya gok sulu) dondurulmug olmamah, gdziindiiriildiikten sonra tekrar
dondurulmug taze fasulyeler teslim edilmemeli.
Dondurulmug taze fasulyeler yeni tiretilmig ve aynr parti mall olmah, defii9ik tarihlerde iiretilmig
olmamalt.
!
Uriinler max - lSoC'de frigorik aragla teslim edilecek. Gelen iiriinler gtiztinmemiS olacakttr.
Uriinler belirtilen tarihlerde mutfak ambartna teslim edilecektir.
DONDURULMU$ BEZELYE:
Dondurulmug bezelyeler iri boy (3 numara) olmah; taneleri saglam, biitiin, zedesiz, temiz, gegidine
tjzgii renk, tat ve kokuda olmah; muhteviyatrnda herhangi bir katkr malzemesi veya yabancr madde
bulunmamalrdtr.
Parti igindeki evsafa uymayan tane miktart (don yanrkh, lekeli, pargalanmrg) %5'i gegmemelidir.
uriinler ma"r -l8oc'de frigorik aragla teslim edilecek. Gelen iiri.inler goziinmemig olacaktrr.
Uriinler belirtilen tarihlerde mutfak ambarlna teslim edilecektir'
DONDURULMU$ BAMYA
Dondurulmug bamya kiigtik boy (tombul veya sivri bamya) olmah; taneleri sa!lam, biitiin, zedesiz,
temiz, geqidine tizgii renk, tat ve kokuda olmalr; muhteviyatrnda herhangi bir katkr malzemesi veya
yabancr madde bulunmamahdrr.
Parti igindeki evsafa uymayan tane miktan (don yanrkll, lekeli, pargalanmrg) %5'i gegmemelidir.
Uriinler max - l8.C,de frigorik aragla teslim edilecek. Gelen iiriinler gdztinmemig olacaktrr.
Ur0nler belirtilen tarihlerde mutfak ambanna teslim edilecektir.
DONDT]RULMU$ YEZ TtIRLUSU:
Dondurulmug yaz tiirlii kangrmrnrn pargalarr sallam, biitiin, zedesiz, temiz, geqidine dzgii renk, tat ve
kokuda olmalr; muhteviyatrnda herhangi birkatkr malzemesi veya yabancr madde bulunmamaltdrr. '
Yaz t0rlii karrgrmrnrn pargalan taze, temiz, sallam ve dondurulmaya uygun olgunlukta olmalt.
yaz tiirlii kafllrmr temiz gdrtiniimlU olmalr, b<icek yenili ve hastaltklarrn meydana getirdigi zaratlar,
donrna yanrklarr, bereler ile yabancr madde (kendinden bagka her ttirlii madde) bulunmamalr.
yaz Tt;lU Kalgrmrnda bulunmasr gereken malzemelerin karrqrm yiizdeleri aqatrda belirtilen oranlarda
olmalrdrr.
Taze
Fasulye %32-34
Patlrcan
Kiip Biber
Domates
Bamya
% 1911
% 1911
% 16-18
% 9-l I
TUrlii kangrrnr gdzijndiiriildiikten sonra tekrar dondurulmuq olmamalt.
Donduruimug ttirlii karrgrrnr yeni iiretilmiq ve aynr parti mal olmalr, deli9ik tarihlerde i.iretilmig
olmamalt.
urtinler ma.r -l8oc'de frigorik aragla teslim edilecek. Gelen uriinler gdziinmemig olacaktlr.
Urtinler belirtilen tarihlerde mutfak ambarlna teslim edilecektir.
Dondurulmug sebzelerde mikrobiyolojik kalite kiterle
N
Aerobik mezofilik bakteri (kob/g)
5
E.coli
Salmonella spp.
5
l0
c
2
0
M
m
l.0xl05
1.0x104
44
9
25 g'da bulunmayacak
Dondurulmug Taze Fasulye, Bezelye, Bamya ve Tiirlii Karrgrmr insan sallr!rna zararsrz, igindeki
malrn duyusaf tjzelliklerini bozmayacak nitelikte en fazla 5-12 kg'lrk ambalajlar iginde olmah.
86
1
Grda maddeleri ile temas edecek ambalajlarrn imalinde kullanrlan boyar maddeler, igindeki mala
higbir gegirgenlik vermemeli ve toksin madde igermemeli.
Ambalajlar iizerinde aga!rdaki bilgiler silinmeyecek ve bozulmayacak gekilde yazrh veya bastlt
olmalr:
:
Firmanrn ticaret unvant, adresi, varsa tescili markast, bu standardtn igaret ve numarasl (TS 9496
geklinde), seri, kod numarast, maltn adr ve tipi, imal tarihi (ay ve yrl olarak), net kiitlesi (En az gr.
veya kg. olarak), son kullanma tarihi, ambalaj materyali iizerinde izin tarihi ve numarast ile iiretici
firmanrn adr ve bulundu$u il belirtilmelidir.
Yiiklenici firma siparig edilen 0r0nleri alacak kapasitede en az -18 C'de gaLgan deep freezleri hastane
idaresine teslim edecektir.
YEMEKLiKZEYTiN:
Zeltin yenm€ olgunlu!una gelmig, siyah veya siyaha yakrn renkte iken hasat edilen tanelerin geqitli
rnetodlarla acrll!rnrn giderilmesi sonucunda haztrlanan mamiildiir. Asit veya bagka bir madde ile
acrhfr giderilmez. Sadece tuz ile salamura yaptltr.
Zeytinler renk, gekil, boy ve sertlik baklmrndan bir dmek, Duble Duble krvrrctk zeytinlerdent
olmahdrr.
Zeytinler bocek yenikli gevgek, ezik, kiiflti gekirdek pargah, bozuk dolgu maddeli krrrgrk, buruguk
olmamalrdrr. I Kg. Zeylin tane sayrsr en fazla 300 adet olmahdrr. G.M.T.'de miisaade edilen koruyucu
maddeler drgrnda hig bir katkr maddesi igermemelidirYemeklik zeytinler l0 veya l2 Kg'ltk
ambalajlarda teslim edilmelidir. Ambalajlamada zeytinin kalitesini bozmayacak insan sallrltna
zararslz cam, teneke, plastik ve di[er uygun maddeler kullanrlmahdlr.
Ambataj igindeki zeytinlerin gegidi, srnrfr, grubu, tipi ve sitili aynr olmaltdtr
Zel,tin ambalajlan iizerine aqaltdaki bilgiler okunakh bir gekilde yzrlmahdrr.
imalatcrnrn markast veYa ktsa adt
MaLn adt, Kalite ve srnrfr
Tipi (hazrrlama ve igleme qekline gore)
Boyu ve derecesi,Net miktarr,lmalat seri numarast
TS igaret ve numarast,Ttirk Mah deyimi,Mahsulyrlr
Ambalajlama tarihi
Koruyucu, gegni verici ve diler katkt maddelerinin adt ve orant
Uretici firmaya ait, Grda, Tanm ve Hayvancrhk Bakanhprndan ahnmrq Grda Uretim ve Grda
Sertifikalarrnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir.
Sicil '
Bu $artnamede yer almayan hususlarda TS 774 ve bu standartta atrf yaprlan TS'larl esas altnacakttr.
Cerektiginde tuzsuz zelin getirilecektir.
YE$iL ZEYTiN:
l- Yegil zeytin yegilden sarrmsr yegile kadar defi$en renklerdeki, yenme olgunlulunu kazanmrg,
tanelerin gegitli metodlar ile acrh!rnrn giderilmesi suretiyle hazrrlanan
no*ul irilig"
".i9miq
mamiildiir.
2- Yalh, gizik salamura, Kiigiik gekirdekli yegil zeytin (kokteyl) olacakhr'
3- Zefiinfrcr t" itsallam olmaL, yabancr tat ve kolu ihtiva etmemelidir.
4- Grup ve tipine has yenme olgunlulunda ve yenilebilir ijzellikte olmaltdtr.
5- Ambalaj igindeki zeytinlerin gegidi, srnrfl, grubu, tipi ve sitili aynr olmahdrr'
6- Kirli, koku9mu9, ozellikler kaybolmug, kurtlanmtg veya kiiflenmig olmamaltdtr'
7- Her tiirlii parazit, bdcek veya bunlartn pargalarr ihtiva etmemelidir'
8- Gdzle gtirtiliir yabanct madde bulunmamalt, zararsz yabanu madde I kg da en gok bir adet
I
olmalrdrr.
9- Her tane irilik derecesindeki zelinlerin en kiigtik tanesi ile en buyiik tanesinin yatay eksenleri
1
arasrndaki fark en 9ok 4 mm olmaltdrr.
l0- Salamura suyu temiz olmalr, yabancr tat ve koku ihtiva etmemeli ve berrak olmaltdtr.
ll- Ambalaj igindeki zeyinde saiamura suyu; zeyinin iizerini tamamen tirtmiig olmah ve kabrn dolu
oranr kabrn su kapasitesinin en azo/o90'm olmahdrr'
l2- Ambalajlama; Ambalaj olarak kullanrlan kaplar yeni ve temiz olmalr, zeytine yabancr tat ve koku
vermemeli ve iqindeki zeytini iyi bir gekilde laklanmalr, alt ve iist kapaklarda laklanmrg olmalrdrr.
Ayrrca TS I I
l8'e
uYgun olmahdrr;
87
Ambalajlarr iizerine aqafirdaki bilgiler okunaklr bir gekilde yazrlmahdrr
Firmanrn ticari iinvant, ktsa adt, adresi veya tescilli markast
Standartln i$aret ve numarasl
Parti, seri kod numarasrndan en az birisi, iiriiniin adr, grubu
imal edildili zeytinin gegidi, srnrfi, tipi, tane irilik derecesi
Net miktarr. siizme miktafl
Varsa katkr ve ilave edilen diEer maddelerin adr
Ambalajlama tarihi
Firmaca tavsiye edilen son kullanma tarihi veya raf Omrii
l3- Bozuk ve numuneden farkh grkan yegil zeytinler miiteahhit firma tarafindan deligtirilecektir
PO$Er CAY (2 GR'LIK):
gtiriilebilen
Qay; kendine has gdriiniiq, renk ve kokuda olmah, yabancr koku ihtiva etmemelidir. COzle
yabancr madde bulunmamalrdrr. Qaylar birinci slnrf n iteliklere sahip olmahdrr.
Kuru gayrn gOrUniigi.i; diizgiin goriinuglii, siyah veya koyu bakrr renkli olmah, lifve 9dp ihtiva
etmemelidir.
Dem rengi; koyu krrmrzt veya ktrmtztmsl gdriinii$te, parlak olmah, mat ve bulantk, tortulu veya
esmerimsi olmamalrdrr.
Burukluk, dolgunluk; dili geker durumda buruk olmalr ve dolgun <izellikte olmalldrr. Dem artrll
(posa)nrn rengi ve kokusu; mlitecaniz ve uygun bir bakrr krrmrztst renkte olmah, yeqil yaprak miimkiin
oldu$u kadar az, posadaki yapraklar parlak olmalr ve kararmtg olmamaltdtr' Demin aromasr; iyi, gaya
has ve hog olmaltdrr.
o/ol0'u
Qaylarda boyar madde kesinlikle bulunmamahdrr. Toplam toz 9ay miktan alrrhkga
gegmemelidir. Qaylar sa!hla zararh olmayan ve <izelliklerini etkilemeyecek nitelikte sahip, karton,
uygun plastik materyal ve bunlarrn bir kagryla iiretilen ambalaj malzemeleri igerisinde teslim
edilnelidir. Qayda rutubet % l2 den fazla olmamahdrr.
Ambalajlaln iizerindeki iirtin etiketleri Tiirk Grda Kodeksinde tantmlanan bilgileri igermelidir.
Uretici firmaya ait, Grda, Tartm ve Hayvancrhk Bakanhprndan ahnmrq Grda Uretim ve Glda Sicil
Sertifikalarrnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir.
Bu gartnamede yer almayan hususlarda TS 4600 ve bu standartta atrfyaprlan TS'larr esas altnacaktlr.
PUDRA $EKERI
Pudra gekeri TS E6l'de tanrmr yaptlan standart kristal ieker (toz $eker)'in 9ok ince olarak <iliitiilmesi
ile elde edilmi$ olmahdrr. Pudra gekerinin fiziksel, kimyasal ve hijyenik dzelliklerini TS 861'de
belirtilen niteliklere sahip olmahdrr.
Pudra $ekeri 250 gr'hk ambalajlar igerisinde teslim edilmelidir. Ambalaj igerisinde kullanrlacak
malzeme temiz ve drg ortamdan gelebilecek safsrzhklara kargt koruyucu dzellikte kaft ve benzeri
maddeler olmalrdtr.
Ambalajlarrn iizerindeki ijrtjn etiketleri Tiirk Grda Kodeksinde tanrmlanan bilgileri igermelidir.
Uretici firrnaya ait, Glda, Tarrm ve Hayvancrlrk Bakanlr$rndan alnmrg Glda Uretim ve Gtda Sicil
Sertifikalarrnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir'
iC
rrsrrx:
i9 frshklar; sallam, temiz, olgunlagmrg, ince uzun kendine has renkte kendi tat ve kokusunda
olma[drr. Kurtlu, kiiflii, b<icek ve hagereler sonucu hasar gdrmemig olmaltdtr. Iglerinde bozuk tane
olmama[, eski ve yeni mahsul birbirine karrqtrrrlmamtg olmaltdrr. Yabanct madde ihtiva etmemelidirl
o/o7 olmahdlr.
i9 frstrklar, ekstra srnrf niteliklerine sahip olmalrdrr. Rutubet miktarr a!rrltkga en gok
i9 frstrklar 250 gr'hk ambalajlar igerisinde teslim edilmelidir. Ambalajlamada kullantlacak malzeme
sa r$a ve iirline zarar vermeyecek gekilde, nitelikte temiz, yeni, kuru, kokusuz malzemeden yaptlmtg
olmahdrr.
Ambalailarrn iizerindeki [rtin etiketleri Ti.irk Grda Kodeksinde tanrmlanan bilgileri igermelidir.
Uretici irrmaya ait, Glda, Taflm ve Hayvancrhk Bakanhlrndan altnmrq Grda Uretim ve Glda Sicil
Sertifikalarrnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir.
Bu gartnamede yer almayan hususlarda ilgili TS 'lart esas allnacaktlr.
KARBONAT:
Karbonatlar; homojen yapr ve gdrtiniigte, kendine has renk ve kokuda olmah, muhtevast dtqmda
gdriilebilen yabancr madde ihtiva etmerneli topaklanmamrg olmaltdtr. Karbonat imalinde kullanrlan
Grda Katkr Maddeleri ytinetmeliIinde belirtilen saflrk tizelliklerinde olmaltdtr.
88
Karbonatlar 35 gr'hk ktigiik ambalajlar igerisinde teslim edilmelidir. Ambalajlamada kullanrlacak
malzeme temiz, rutubet ve hava gegirgenlili az kaglt kaph folyo veya poli etilen gibi malzemelerden::
yaprlmrq olmahdtr.
Ambalajlarrn iizerindeki iiriin etiketleri Ttirk Grda Kodeksinde tanrmlanan bilgileri igermelidir.
Uretici firmaya ait, Grda, Tartm ve Hayvancthk Bakanlrlrndan ahnmrg Grda Uretim ve Grda Sicil
Sertifikalarrnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir.
Bu gartnamelerde yer almayan hususlarda ilgili TS esas ahnacakttr
LiMON TUZU:
Limon tuzu; homojen yapr ve gortiniiqte kendine has renk ve kokuda olmah, igerisinde gdzle
gtiriilebilen yabancl madde ihtiva etmemeli, topaklanmrg olmamalrdrr. Limon tuzu imalinde kullanrlan
[i.yeui ruidel"r Grda Katkr Maddeleri Y<inetmeli[i'nde belirtilen saflrk iizelliklerine uygun r
olmalrdrr. Lirnon tuzlarr ince gekilmig olmalr, kaba tabir edilen limon tuzu olmamaltdtr.
Limon tuzlarr 250 gr'lrk ambalajlar igerisinde teslirn edilmelidir. Ambalajlamada kullanrlacak
malzeme temiz, rutubet ve hava gegirgenlifi az olan ka$rt kaplr folyo veya polietilen gibi
malzemelerden yaprlmrg olmahdrr.
Ambalajlaln iizerindeki iiriin etiketleri Tiirk Grda Kodeksinde tantmlanan bilg-ileri igermelidir.
Uretici firmaya ait, Grda, Tarrm ve Hayvancrhk Bakanhllndan ahnmrg Grda Uretim ve Grda Sicil
Sertifikalarrnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir.
,
Bu gartnamelerde yer almayan hususlarda ilgili TS esas altnacakttr.
GUL STryU:
Sallr$a zarar vermeyen TS de belirtilmig, plastik,250 gr hk gigelerde, kendine has tat, renk ve kokuda
olmall; iginde yabancr bir katkr maddesi olmamalr, homojen olmahdrr.$i9e iizerinde imal ve son
kullanma tarihi, iiretici firma adr, tescilli markasl y Lzrh etiket bulunmalrdrr.
KIRMIZI VE Yf,$il- MERCiMEK:
Mercimekler; saglam, biitiin, iyi kurutulmul olmah bunlarda yabanct tat ve koku, anormal dtq nem,
canh bcicek, gdzle gdriilebilir kimyasal madde artrklarr, bozuk, kiiflenmig, giiriimus, lekelenmig tane
bulunmamalidrr. Mircimekler yeni iiriin olmalr, bayatlamrg, parlak rengini kaybetmig buruimus.
mercimekler olmamahdr. Mercimekler iri taneli futbol tabir edilen mercimeklerden olmah, krflk veya
yanm taneli mercimeklerden olmamalldtr.
o/o
'N4ercimeklerde
rutubet miktan afrrltkga en gok %14,5, yabancr madde miktarr alrrltkga en gok I '
alrrlrkga
kalbur altr miktarr alrrhkga en gok % I 'i, bozuk tane afrrhkga en gok % I , krrrk tane m iktarr
pigmi'
yarrm
iginde
gartlarda
saat
%3 olmalrdri Tane boyu % | 'in iizeri'de olmaldrr. Normal
en
9ok
olacaktrr.
Mercimekler; sa!hla zarar vermeyecek nitelikte yeni, temiz, kokusuz 25 Kg'hk guvallar igerisinde
ambalajlanmrS olmaltdtr.
Ambalajlallr ijzerindeki iiriin etiketleri Tiirk Grda (odeksinde tanrmlanan bilgileri igermelidir'
Sicil
Uretici irrmaya ait, Grda" Tarrm ve Halvancrhk Bakanh[rndan ahnmrq Glda uretim ve Grda
Sertifikalannrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir.
Bu gartnamelerde yer almayan hususlarda ilgili TS 142 ve bu standartta atlfyaprlan TS' larr esas
alrnacakttr.
HiNDiSTAN CEViZi:
Kendine has renk, tat ve aromada olmah, yabancr madde igermemeli, canh bdcek, cjlii biicek veya
b6cek kalntrlarr igermemelidir. Dof,al nemini kaybetmig olmamahdrr. Hindistan cevizi birinci srnrf
niteliklerini tagrmalldrr.
Hindistan cevizi 200 gr'hk ambalajlar halinde teslim edilmelidir. Ambalajlarrn alrzlart stktca
malln
kapatrlmrg olmahdrr. Ambalajlamada kullanrlan malzeme yeni, temiz, kuru, kokusuz igindeki
yaptlmrq
olmalrdrr'
tizelligini'bozmayan ve salll[a zarar vermeyen malzemelerden
Ambaiajlarrn iizerindeki 6itin etiketleri Ttirk Grda Kodeksinde tanrmlanan bilgileri igermelidir.
Uretici frrmaya ait, Grda, Tarrm ve Hayvancrlrk Bakanll[rndan a1nmt9 Ctda Uretirt ve Grda Sicil
Sertifikalannrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir'
Bu Sartnamede yer almayan hususlarda G.M. T. ile ilgili TS'lanndaki Sartlar esas altnacakttr.
I
KEKiK:
89
;
:
Kekikler; kendisine iizgii renk, tat ve aromada olmalt, bozulmug, kiiflenmig, yabancl tat ve koku alm$
olmamah, grplak gdzle baklldr!rnda igerisinde canlt bthek,0lii bticek veya bOcek kahnhlarr
g6riinmemelid ir. Kekikler l. srnrf nrteliklerini tagrmah, iglerinde yabancr madde bulunmamaltdtr. ,
Kekikler,250 gr'hk ambalajlarda teslim edilmelidir. Ambalajlamada kullanllacak malzeme, tirtinii i
rutubetten koru-yacak ve ,ugl,g. ,"r", u"rteyecek nitelikte yini, temiz, kuru, kokusuz, ka$rt mukavva
polietilen lak'h teneke veya diler uygun ntaddelerden yaprlmrg olmalrdrr'
Ambalajlarrn i.izerindeki iirtin etiketleri Tiirk Grda Kodeksinde tanrrnlanan bilgileri igermelidir.
Uretici firmaya ait, Grda, Tanm ve Hayvancthk Bakanh[rndan ahnmrg Gtda Uretim ve Grda Sicil
Sertifikalarrnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir.
Bu $artnamede yer almayan hususlarda G.M. T. ile TS'landaki gartlar esas allnacaktlr.
TOZ $EKER:
Toz $ekerler; TS 891'de belirtilen tip dzelliklerinden, srnrf2'de yer alan standart kristal qeker tipinde
olmahdrr.
Toz qekerlerin; fiziksel, kimyasal ve hijyenik dzellikleri a9a!rda belirtilen delerlere uygun olmahdtr.
Toz gekerlerin polarizasyon deleri (S) en az 99,7; invert geker en gok %0.04; iletkenlik kiilii en golo
%0.04, kristal rengi (Braunchwein puanr) en gok l2; gdzelti rengi (ICUMSA birimi) en gok 60;
kurutma kaybr en gok %0.1; koruyucu madde kiiktirt dioksit (SO2) en gok ppm; zehirli ve yabancr
maddeler olan Arsenik en 9ok I ppm; Bakrr (Cu) engok 2 ppm; Kurgun (Zn) en gok 2 ppm;
topaklagmayr dnleyici madde; nigasta, yabancr madde ve patojen mikroorganizma igermemelidir.
Toz gekerler; gekeri etkileyemeyen ve toz gekerden etkilenmeyen, insan salhIrna zararlt olmayan ve
toz gekerin tizelliklerini bomrayan, bunlarrn birkagrnrn bir arada kullanrldrpr malzemelerden yaptlmtq
25 veya 50 kg'lrk ambalajlar igerisinde teslim edilmelidir.
Ambalajlarrn Uzerindeki iiriin etiketleri TUrk Grda Kodeksinde tantmlanan bilgileri igermelidir.
Uretici irmaya ait, Grda, Tarrm ve Hayvancrlrk Bakanhlrndan ahnmrE Grda Uretim ve Grda Sicil
Sertifikalaflnrn mal teslimlerinde muayene komisyonuna ibraz edilmesi gerekmektedir.
Bu sartnamede yer almayan hususlarda TS 861 ve Ctda Maddeleri Ti.iziili.i'ndeki hiikiimler esas
alrnacakttr.
SARMA KESME SEKER (Ki]P):
Nemsiz 75G-1000 gr'[k kutularda olup ambalaj iizerinde imalat tarihi ve son kullanma tarihi yazrlt
otacakttr r.s. 'ye ulgun olacaktrr. Diser ozelliilel toz $eker ile aynr olacakttr. Kesme gekerler kasrt
veya benzeri maddelerle kaplanmrg olmalrdrr.
PO$ET IHLAMUR
-.
Piyasanrn en iyisi olacak ve komisyonun be$eneceSi evsafta olacakttr. Qigek oranr fazla olacaktlr.
Kendine dzgii renk, koku ve gdriinii$te olmah.
Kiiflenrnemig, giiriimii$, bozulmug, rengi kararmrg olmamaltdtr'
ok 9'u yapraklr gigeklerde % I I'i gegmemelidir'
Rutubet 9i9ek thlamurda aptrlkga
Yabancr madde miktarr a[rrhkga %oo 5'ten 9ok olmamahdrr'
icerisinde can; bticek bulunmayacak, grplak gdzle bakrldrlrnda dlii btjcek veya bdcek kaltntrlan, i
kemirici hal,van yenikleri g<iriilmeyecektir.
Mahn Ozelligini Lor*"yu"uk nitelikte malzemeden yaprlmrg temiz saglam ve kokusuz ambalajlarda
getirilmelidir.
Adet gr 1,6 olacaktrr.
KURU BAMYA:
piyasada satrlan yeni sene mahsul0 ve yerli mah olacaktrr. ipliklere dizili, kurutulmu$ miimkiin
,nirt"b" uyn, Ufiytit<tutte gigek bamyalirrndan olacaktrr. Kurtlu, kiiflti, b<icekli, fena kokulu olmayacak
pi girildiIinde da!tlmayacakttr.
TAYUK YUMURTASI:
yumurtalann; safl ve beyazr, kendine has tat, renk ve kokuda olmah, kuflti, bozuk ve gurtik olmama6drr. Yumurtalar, dolrudan tiiketilen yumurta grubunda, hi9 bir iglem giirmemig ve AA stntftnda '
olmalrdtr.
sekilli, anormal kabuklu, gatlak ve lekeli yumurtalar olmamaltdr'
-Anormaltemiz, lekesiz, gekil ve kabu!u normal, sallam yaprlr gatlaksrz ve ktrtkstz olmaltdtr.
-Kabuk,
Hava boglufu tek, sabit ve derinlipi 4 mnr'den az olmaltdrr'
-Ak.
berrak ve homoien olmaltdlr.
90
ve prhtrsr
ortada yuvarlak, tek, homojen renkte, gevresi belirsiz, ak prhtrsr, et ve kan lekesi
-Safl,
gOriilmemelidir.
-Yumurtalartn
aprrhklarr 60-65 gr.
arastndaolmahdrr.:ifffllil"rffi',H:[l'flilff"t;
Ot
*
.
kuru, temiz, hijyenik gartlara uygun, iyi halde!
e yaprlmrg olmalldrr. Ambalajlar iizerinde ijretim
da krrtk gtkan yumurtalar altnmaz'
EKMEK:
Ekmek:Bufdayununa;su,tuzVemaya(Saccharomycescerevisiae)ilaveediliptekniEineuygun
na brrakrlrnasr ve pigirilmesi ileyaprlan iiriinti,
gekil
ine uygun olarak iiretilen ekmek gegidini
Ta
oranrnda tam bulday unu ilave edilip tekniiine
ekmek
olarak; yogiulmasr,
ranl nuga'.y ekmepi:
tam Uu!'Oay unlu
uygun olarak tiretilen
("lp"tti r,m"r, Bupday ununa en az%o
ekmektir
l0
I
:r- - ^r:,:en ftzla%o 30 oramnda kepek ilave edilip
,
+^r.-:*:-^,,,,.
tekniline uygun
olarak iiretilen ekmektir
il"p.r.,
ir.nl"t"
gf.l"i * .f...f
geklinde olacaktrr.
tullanrlacak kepek grda amagh kullanrlan bulday ve yulaf kepepi
olmahdrr'
uygun
qeqitlerinin kimyasal dzellikleri aga$rdaki tabloya
ln
Tchlo Fkmek ve Ekmek
Rutubet o4
Ozellikleri
Szellikleri
Im/m) engok
Ki.il (tuz harig) %(m/m) en
az kuru maddede
0kmek
l8
0,85
Ekmek ve Ekmek Qeiitleri
Kepekli Ekmek
Iam Bu[daY ekmegi ve tam
a,,;'lav rrnlrr eLmek
DiPer Ekmek Qegtt]g.t
Tuz % (m/m) en 9ok
kuru maddede
41
Aa
2
A'
2,0
15
sanitasyonu ve hijyeniagtsrndan uygun
Un ihtiyacrnr kargrlayacak olan fabrika, igleme teknolojisi,
olmahdtr.
Ununtekno|ojikvehijyenikdurumuileetiketbilgileriTiirkGrdaKodeksi,BupdayUnuTeblili,net
uvgun olmaltdtr.
il-"r"'r.i",
ir, iio randrmanl,
unundan pi9mi9
Toprak Mahsulleri ofisi Standartlarrna uygun francala
olacaktrr.
Katkrmaddeleri:,.TiirkGrdaKodeksiYt'netmeligi'.ninGrdaKatkrMaddeleribOlilmiindeyeralan
ler ve un geqitlerinin yiizde oranlart
ise ekmele tizellilini veren bileqen ekmeiin adt
Ekmeklerin teslimi plastik kasalar igerisinde norm
Hastane idaresince periyodik ve gtiriilen liizum ilz
hattlndan ve muhafaza deposundan numune alrnm
Numune Alma ve Analiz Metodlarr biiliimiindeki
3522) kullanrlacakttr'
a Maddeleri Nizamnamesindeki evsafta olacakttr'
Ktrr.
J
9l
;
Ekmeklerin konulduIu plastik kasalar temiz olacaktrr. Krflk,gatlak, ya!h,gamurlu, kirli kasalara
ekmek konulmayacakttr.
Teslimatta firmayr temsilen bil kigi hazrr bulunacaktlr'
grda katkr maddeleri
Ekmek iyi surett; pi$mi$, kabarmig, nortnal manzara koku ve lezzette bulunmalr;
ydnetmeliPine uygun olmaltdtr.
yantk
k..ifaigi Jaman'k"esit ytizeyinde gdriilen delikler normal biiyUkliikte ve homojen olmalr' trkrz,
yarrk
ve
boqluklar
yup,qtu"n i9ina. hamuihaline getmemig un topaklarl, iplikleqme, biiyiik
olmamahdrr.
olmahdrr.
Ekmeklerin alt ve iist kabuklarr iyi ve tam tegekkiil etmig i9 ktsmrndan ayrrlmamrq
iginde herhangi bir yabancr cisim bulunmamalldrr'
laboratuar tahlilinde;
tjastane ida.eiince periyodik ve gdriilen liizum iizerine yaptrrllacak
o/o 1,5 gr'dan fazla olmamahdtr'
Ekmeklerde tuz miktan, kuru maddede
i* i,i"r,ra,t ronru klil ve ktiliin % l0'tuk klorhidrik asitte eriyen ktsmr ekmelin yaprldr[t un igin
""
kabul edilen kuru maddedeki slnlrt aqmamaltdlr'
Bupday ekme[inde su miktart Vo 37'den fazla
lr'
Ekmeklerde kullanrlacak tuz, mutfak tuzu 6ze
ava gartlartndan ve rutubetten etkilen- '
i9 igin kullanrlan' dtg etkenlerden zarar
soneli tarafrndan mutfaga teslim edilecektir'
ek kasalartnda ve iistleri iirtiilii olarak; bu kasalar
gekilde (kendi kapalt aract ve personeli ile) dara
iist tiste konuldu[unda ekrnekle temas etmeyecek
turt-, yup'ta,Ltu'n sonra ekmelin kilo cinsinden kabulii yaprlacaktrr' poqetlenmig rol ekmekler
i9ii50 gr, normal igin en az 50 gr tek olarak
;il;il;i;'$.D
halinde olacaktrr.
"et
divet
tlacakttr'
rak ihtiyaca gdre teslim altnacakttr
Sertifi kasrna sahiP olacaktrr
lite olup,
-I
8 oC'de dondurulmu; olarak teslim
Dondurulmu5 Ozell i[ini kaybetmig' ezilmig'
tarihi ambalaj iizerinde belirtilecektir' Beher
uygun olarak tiretilmig olan btireklik yufkalardarl
am-Yagh Beyaz Peynir kullanrlarak imal edilmiS
tonlarrnda, kendine has olacaktrr'
gatlak olmayacakhr'
ikten sonra kendine has tat ve kokuda olacak'
kuda olmaYacakttr'
r arasl olacakt lr'
arda teslim edilecektir'
hit firma siparig edilen iiriinleri alacak kapasitede
en az
]iic,a"
yatrk derin dondurucuyu (deep freezleri) hastane mutfagrna
cut,lon I adet 600 litrelik
pnvNinr-i puF BoREGiiqiN
fi1i}ff;'ff'ilrRu,pEyNiRli sicnna soREGi vr
KONTROL VE MUAYENE METODLARI:
l"r"rTy"* .^r"na. satrcr firrnaya al1tr]y""y:I]-ry*gekli her tiirlii personel, "*r:*#;
edilecektir.
taraftndan yenileri ile
Muayenelerde kullantlan, bozulan, hasar goren numuneler.satlct
-ddiil;il;;;k bozulan ambalajlar eski durumuna getirilecektir'
""
92
Dondurulmug iirtinlerin tiimii yeni tiretilmig ve aynr parti mah olmah, deli9ik tarihlerde iiretilmig
-olmamaltdtr.
Uriinler max. -l8C de frigorik aragla teslim edilecek. Gelen iiriinler gciziinmemig olacaktlr. i
- Talep edilen i.iriinler isten ilen tarihte en geg saat 08-10 arasrnda mutfak ambanna teslim edilecektir'
-S.t"l i'iru.n az9 ay sireile milftiy humuilirr, peynirli sigara b6rekleri ve peynirli pufbdreklerinrn
deliqtirilecektir.
edilecektir.
bozulmayacalrna d air garcnti verecektir. Bozulan iirtinler yenisi ile
varsa ibraz
Tesis ve iiietilen mamullerle ilgili kalite sistem belgesi
-Bakanltfitndan
ahnmrg Grda Uretim ve Grda
ve
Hayvancrlk
Ta"rrm
Grda,
T.C.
Uretici Firmanrn
Sicil Sertifikasr
edilecektir.
Tesis ve iiretilen mamullerle ilgili kalite sistem elgesi varsa ibraz
25. ve26. maddesinde
y6netmeliginin
Kodiksi
*aadelerinin ambalalla. Tiirk Grda
-
bulunmaltdrr.
-_ iti,
.
i
.
e,au
belirtilerietiketleme ve etiket bilgilerine uygun olmahdtr'
firma tarafindan
Uriin analiz igin laboratuara 96nderildiginde teknik inceleme iicreti
-
Grda Kodeksi Ydnetmelipi Hiikiimleri uygulanrr'
lrn duyusal <izelliklerini bozmayacak niteliktek
risindi en fazla 5-10 kg'hk orijinal ambalajlar
birim ambalajlarr drgarrdan gelecek fiziksel
- Satrcr firma, iiri.inlerin ambalajlanmastnda
koml
ahnan tiretim izin belgesini muayeneler strastnda muayene
Yonetmeliginin
bozul
..i rizerindek-i igaretleme Grda Kodeksi
nri.i"il". u^rinde agalrdaki bilgiler silinmeyecek ve
n.6"f
-olmalt:
Firmantn
-geklinde),
acaktlr'
bastlt
ticaret unvant, adresi, varsa tescili ma
veya Kg. o
firmantn a
Miiteahhit firma siparig edilen tirunleri alacak k
dondurucularr (deep
Qahgan 600 litrelik yatrk derin
-
KREMA:
brJi"r."irr" t,"tilize edilmig
olarak,
lll
l12litrelik paketlerde olmaltdtr'
K..'^tu,I..ndin"dzgiirenk,tat,kokuveklvamdaolmalrdrr.Krema|arhornojenbirkitleyap|slnda
patojen mikroorgantzma
bulunmalt, kiiflenmig, kokmuP ve actmtq olmamalt, bunlarda
bulunmamaltdrr.
fi"*"i"r" CUf ' de izin verilen maddeler drqrnda maddegrdakatrlmamahdrr'
maddelerinin yaprmrnda kullantlmak
u"yu pu'iu, dondu'tu ub'
zorunludur'
"nitt"L
n pastdrize edilmesi ve bunlarln tatlt krema olmast
gok
kiif veya maya-ve 100'000
den
50
baktri'
koliform
dun
f g,au f O Jun
9ok
metalimsi, okside olmug ya da anormal bir tat ve kokusu olmamahdtr'
den gok germ bulunmailah;
i+-iO.ia"
olmaltdtr.
.uf.Unml$ olmall ve iirtin srcaklr[r +4.-10'C arastnda
imal ve son kullanma tarihled
aglrllgl.
, adresi,'fS numarast, net
glKan
kullanma tarihinden iince bozulan ve numuneden tarKll
kliye iicreti kendine ait olmak kaydryla de[iqtirilecektir'
gerekmektedir.
uriine ait TSE,iiretici firmanrn iSO belgelerine sahip olmasr
rer, glikoz gurubu,
r (pJasyurn fosfatl
hk kapih folyo (pe
€m0lgatdr (mono ve digliserid)'
bulunmaltdtr'
linde olacak; drq ambalajr OMK
koli geklinde olacakttr.
UreticifimraTSENlsog00lKaliteGiivenceSistemBelgesine,GrdaSicilSertifikasrna,
ve mamule ait Grda Uretim
fSe fafit. Uygunluk Belgesinl TSE imalata Uygunluk Belgesine
Senifi kasrna sahiP olacaktrr'
ir,rZin xr,nu
ionn.lnx lruM qoRBA QE$irlf,ni
igiN):
93
Not: (Qegitler: Kremah Sebze, Kremah Tavuk, Mercimek, Ezogelin, Tarhana, Kremah Mantar, Yayla,
iqkembe, Etli Dtptin, Kremah Brokoli, Kremalr Ispanak, Mahluta, Yiiksiik, Tutmag)
t
Birim ambalajr; 3.000 gr.'hk kapah folyo (pet + aliiminyum + pe ) olacaktrr.
Nakliye ambalajr; 3 adet birim ambalajr alacak gekilde Oluklu Mukawa Koli geklinde olacaktrr
Raf rimrti 2 (iki) ytl olacakttr.
Birim ambalaj i.izerinde; mamuliin i.iretim tarihi, son kullanma tarihi, raf dmrii, sahip oldulu kalite
belgesinin igareti, net alrrhpr, hazrrlanrq gekli, igerisinde bulunan maddelerin strastna gtire adlart
bilgilerini igeren iiretici finnanrn orijinal ofset baskrll etiketi bulunacaktrr.
uritici firma Grda sicil Sertifikasrna, crda ile Temasta Bulunan Materyal Sicil Sertifikastna, TSE
Uygunluk Belgesine, TSE imalata Yeterlilik Belgesine ve mamule ait Grda Uretim Sertifikasrna sahip
olacaktrr.
KUTU MI,YVE STIYT] EVSAFI:
Meyve sularrnda yabancl tat, koku, renk de$igiklilili olmamalrdrr, bombelegmig deforme olmamtg
aseptik ambalajh olmahdrr.
Tarrm ve Kdy iqleri Bakanl[r tarafindan onayll olmahdtr
Tiirk grda kodeksi tebliline uygun iiretilmig, ambalajlanmrg, etiketlenmi$, igaretlemig ,taSrnmt$ ve
depolanmrg olmahdrr.
Meyve sularr 200 cc 'lik tjzel ambalajh kutularda olmah kutulann tizerinde a;afrdaki bilgiler okunaklt
olaiak silinmeyecek ve bozulmayacat gekilde yazrlr ve basrlr olmahdrr
Firmantn ticaret unvanl veya ktsa adt, adresi varsa tescili markast
Bu standardtn i;aret ve numarasr (TS I192 $eklinde)
Parti numarasl,
-
-
Mahn adt,
TiPi,
Miktan,
Uretim ve son kullanma tarihi (ay, giin, ytl)
Ketgap ve mayonez tek kullanrmhk poget ambalajda verilecektir.
94
Author
Документ
Category
Без категории
Views
6
File Size
7 792 Кб
Tags
1/--pages
Пожаловаться на содержимое документа