close

Enter

Log in using OpenID

- F. De Filippis

embedDownload
DOMANDA FREQUENTE:
QUALE E’ LA FUNZIONE DI UNA CERTA PROTEINA ?
OVERESPRESSIONE DELLA PROTEINA
ESPRESSIONE ECTOPICA CON UN VETTORE DI ESPRESSIONE
ABOLIZIONE DELLA ESPRESSIONE DELLA PROTEINA
INTERFERENZA A RNA (RNAi)
SI AUMENTA O SI DIMINUISCE
L’ESPRESSIONE DELLA PROTEINA
ALLA RICERCA DI EVENTUALI VARIAZIONI FENOTIPICHE !
RECETTORI EFRINICI:
è la più numerosa famiglia di
RTK (Receptor Tyrosine Kinases),
composta da 16 membri.
RECETTORI NON SOLUBILI:
Proteine di membrana di un’altra cellula
RECETTORI EFRINICI
REGOLANO:
l’adesione cellula-cellula,
la motilità,
la invasività
(METASTASI)
RECETTORI EFRINICI
La loro over-espressione
o iper-fosforilazione (pTyr)
è associata al fenotipo tumorale
in tumori prostatici.
STUDIO DEGLI EFFETTI FENOTIPICI
CAUSATI DALLA OVER-ESPRESSIONE
DEL RECETTORE Eph
IN CELLULE IN COLTURA
Colture cellulari
= propagazioni di cellule fuori dall’ organismo
vantaggi:
1) l’ambiente extracellulare puo’ essere manipolato
2) uso di un tipo cellulare ben definito
3) grandi quantita’ di cellule
4) studio di varie funzioni cellulari
Due tipi di colture cellulari:
1) colture primarie
2) linee cellulari
Linee cellulari
Possono derivare da varie fonti:
cellule trasformate in vitro
(p.e. espressione di oncogene)
espianti tumorali
(posti in coltura crescono indefinatamente)
differentiating
muscle
cell line =
C2C12
Vettore di espressione
per cellule animali in coltura
Piccolo introne
G418 - GENETICIN
Blocca la traduzione in tutti gli organismi
La resistenza è conferita da una chinasi
(Neo R) che fosforila l’antibiotico,
inattivandolo
LIPOFEZIONE
Si utilizzano “liposomi”
caricati con
i vettori di espressione
siRNA
Possibilità di
modulare negativamente
l’espressione di specifici geni
Somministrazione sperimentale
di siRNA
FORTE RIDUZIONE DELL’ESPRESSIONE DELLA
PROTEINA
Contiene una
ORF continua !!
Retrotrascrizione
in
cDNA
5’ NT “non tradotto”
3’ NT
Sul cromosoma 1
posizione
1p36
GENE: circa 35 kbp,
17 esoni
ORF:
mRNA: 3970 basi
2931 basi
(12%)
(circa 150 basi di 5’-NT e circa 900 di 3’-NT)
Peptide: 976 aminoacidi
Gene: circa 35.000 basi (negative strand)
16 370 247
16 553 713
Circa 180.000 basi
SEQUENZA DEL cDNA
SITO DI INIZIO
DELLA
TRADUZIONE
SEQUENZA DEL cDNA (mRNA)
5’ NT
(non tradotto)
STOP
3’ NT
Poly Adenylation site
SEQUENZA PROTEICA
N terminal (citoplasmatico)
•
/translation="MELQAARACFALLWGCALAAAAAAQGKEVVLLDFAAAGGELGWL
•
THPYGKGWDLMQNIMNDMPIYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTV
•
RDCNSFPGGASSCKETFNLYYAESDLDYGTNFQKRLFTKIDTIAPDEITVSSDFEARH
•
VKLNVEERSVGPLTRKGFYLAFQDIGACVALLSVRVYYKKCPELLQGLAHFPETIAGS
•
DAPSLATVAGTCVDHAVVPPGGEEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQAC
•
SPGFFKFEASESPCLECPEHTLPSPEGATSCECEEGFFRAPQDPASMPCTRPPSAPHY
•
LTAVGMGAKVELRWTPPQDSGGREDIVYSVTCEQCWPESGECGPCEASVRYSEPPHGL
•
TRTSVTVSDLEPHMNYTFTVEARNGVSGLVTSRSFRTASVSINQTEPPKVRLEGRSTT
•
SLSVSWSIPPPQQSRVWKYEVTYRKKGDSNSYNVRRTEGFSVTLDDLAPDTTYLVQVQ
•
Sequenza
ALTQEGQGAGSKVHEFQTLSPEGSGNLAVIGGVAVGVVLLLVLAGVGFFIHRRRKNQR
•
ARQSPEDVYFSKSEQLKPLKTYVDPHTYEDPNQAVLKFTTEIHPSCVTRQKVIGAGEF segnale interna
e
•
GEVYKGMLKTSSGKKEVPVAIKTLKAGYTEKQRVDFLGEAGIMGQFSHHNIIRLEGVI
trans-membrana
•
SKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGMLRGIAAGMKYLANMNYVHRDL
•
AARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTSGGKIPIRWTAPEAISYRKFTSAS
•
DVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPMDCPSAIYQLMMQCWQQ
•
ERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSGSEGVPFRTVSEWLE
•
SIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAYSLLGLKDQVNTV
•
•GIPI“
C TERMINAL (EXTRACELLULARE)
2
N
Sequenza segnale
INTERNA
a monte
della seq. segnale interna
Presenza di
AA carici
+
a valle
della seq. segnale interna
3
Inizio traslocazione
al RER
e successivo
intrappolamento
nella membrana.
Sequenza segnale:
NON VIENE TAGLIATA E FUNGE ANCHE DA SEQ . DI ARRESTO !
STRATEGIA DI AMPLIFICAZIONE
DELL’ mRNA
3’ NT
Poly Adenylation site
PURIFICAZIONE DELLA FRAZIONE polyA+
Catene di oligo dT
legate alla matrice
Strategia di amplificazione mediante PCR
al fine ricavare la regione codificante per la EphA2,
ottenendo un frammento con EcoRI alle due estremità,
per facilitare il successivo clonaggio.
5’----GGGAUCCCC AUCUGAGCCU CGACAGGGCC UGGAGCCCCA UCGG ---- 3’
3’ TAGACTCGGA GCTGTCCCGGCTTAAGGGCCGG
PRIMER REVERSE
SUL CODONE DI STOP,
CONTENENTE, AL 5’,
IL SITO PER EcoRI
E 6 ALTRE BASI
PRIMER REVERSE
EcoRI
Strategia di amplificazione mediante PCR
al fine ricavare la regione codificante per la EphA2,
ottenendo un frammento con EcoRI alle due estremità,
per facilitare il successivo clonaggio.
5’----UCGGACCGAG AGCGAGAAGC GCGGCAUGGA GCUCCAGGCA ----- 3’ RNA
3’----AGCCTGGCTC TCGCTCTTCG CGCCGTACCA CGAGGTCCGT ----- 5’cDNA
GGCCGGGAATTCAGCGAGAAGC GCGGCATGGA 3’
PRIMER FORWARD
PRIMER FOWARD
EcoRI
SUL CODONE DI INIZIO,
CONTENENTE, AL 5’,
IL SITO PER EcoRI
E 6 ALTRE BASI
5’----GGGAUCCCC AUCUGAGCCU CGACAGGGCC UGGAGCCCCA UCGG -- 3’
3’ TAGACTCGGA GCTGTCCCGGCTTAAGGGCCGG
PRIMER REVERSE
SUL CODONE DI STOP,
CONTENENTE, AL 5’,
IL SITO PER EcoRI
E 6 ALTRE BASI
PRIMER REVERSE
EcoRI
RNA
AMPLIFICAZIONE MEDIANTE RT-PCR
1)
2)
3)
Copiatura dell’mRNA con trascrittasi inversa e creazione del
primo filamento di cDNA
Inizio della reazione di PCR con copiatura del filamento di
cDNA ottenuto con RT
Amplificazione del doppio filamento di cDNA
1
2
3
EcoRI
5’ GAATTC
5’
5’
5’ GGCCGGGAATTC
GAATTCGGCCGG
CTTAAGCCGGCC
CCGGCCCTTAAG
5’
5’
Taglio con EcoRI
Generazione di terminali “appiccicosi”
5’
Vettore di espressione
per cellule di mammifero
ori C di E.coli
Inizio trascrizione
resistenza alla Ampicillina
per selezione nel batterio
resistenza al G418 (Neo)
per selezione nelle cellule animali
termine trascrizione
AZIONE DELLA DNA LIGASI
PROTOCOLLO PER LA DNA LIGASI
Vettore:
5670 bp
Inserto: circa 2950 bp
1.9
DNA LIGASI
TRASFORMAZIONE:
Si utilizzano cellule di E.coli “competenti”
(danneggiate con shock salino, ma ancora vitali)
Il DNA entra (molto raramente, 1/106) nelle cellule
Le cellule vengono spatolate su terreno selettivo
(agar con LB e Ampicillina, in piastre Petri da 10 cm)
Dopo una notte a 37°si recuperano le singole colonie
INOCULO DI SINGOLE COLONIE
IN TERRENO LB LIQUIDO
(crescita O/N)
PURIFICAZIONE DEI PLASMIDI IN PICCOLA SCALA
(MINIPREP)
SCHEMA DELLE ESERCITAZIONI PRATICHE
•
•
•
Recupero dei dati in rete: sequenze dell’ mRNA e della proteina.
Amplificazione del cDNA mediante RT-PCR di mRNA (frazione polyA+), con l’uso
di primer che aggiungono siti di riconoscimento per EcoRI alle estremità
Digestione con EcoRI e inserimento in vettore di espressione eucariotico
(pTargetT). Reazione di ligasi
Trasformazione e isolamento colonie
•
•
•
•
Inoculo di singole colonie in terreno liquido
Inoculo colonie in LB, crescita in liquido.
GIORNO 1
Preparazione del plasmide (miniprep)
Controllo della qualità del plasmide su gel di agarosio
•
•
•
•
Digestione dei cloni positivi con EcoRI
Controllo dei digeriti su gel di agarosio
GIORNO 2
Preparazione su larga scala dei cloni positivi
Esperimento di trasfezione su cellule di mammifero in coltura
•
Author
Document
Category
Uncategorized
Views
0
File Size
7 873 KB
Tags
1/--pages
Report inappropriate content