close

Enter

Log in using OpenID

bilancio di missione 2013 - Azienda Ospedaliero

embedDownload
Bilancio di Missione 2013
%,/$1&,2',0,66,21(
$=,(1'$263('$/,(5281,9(56,7$5,$',3$50$
,1',&(
3UHVHQWD]LRQH
&RQWHVWRGLULIHULPHQWR
4XDGURQRUPDWLYRHLVWLWX]LRQDOH
,OVLVWHPDGHOOHUHOD]LRQLFRQO¶8QLYHUVLWj
/DUHWHLQWHJUDWDGHOO¶RIIHUWDUHJLRQDOH
$FFRUGLGLIRUQLWXUD
2VVHUYD]LRQLHSLGHPLRORJLFKH
3URILORD]LHQGDOH
6RVWHQLELOLWjHFRQRPLFDILQDQ]LDULDHSDWULPRQLDOH
/DVRVWHQLELOLWjHFRQRPLFD
/DVRVWHQLELOLWjILQDQ]LDULD
/DVRVWHQLELOLWjSDWULPRQLDOH
,PSDWWRVXOFRQWHVWRWHUULWRULDOH
,PSDWWRHFRQRPLFR
,PSDWWRVRFLDOHHFXOWXUDOH
,PSDWWRDPELHQWDOH
&RQWULEXWRDOODFRSHUWXUDGHLOLYHOOLHVVHQ]LDOLGLDVVLVWHQ]D
&RVWRSURFDSLWHSHUOLYHOORGLDVVLVWHQ]D
$VVLVWHQ]DFROOHWWLYDLQDPELHQWHGLYLWDHGLODYRUR
$VVLVWHQ]DGLVWUHWWXDOH
$VVLVWHQ]DVSHFLDOLVWLFDDPEXODWRULDOH
$VVLVWHQ]DRVSHGDOLHUD
4XDOLWjGHOO¶DVVLVWHQ]D
5LFHUFDHGLGDWWLFD
$WWLYLWjGLULFHUFD
$WWLYLWjGLGDWWLFD
$VVHWWRRUJDQL]]DWLYR
2ELHWWLYLLVWLWX]LRQDOLHVWUDWHJLHD]LHQGDOL
3DUWHFLSD]LRQHGHJOLHQWLORFDOLDOODSURJUDPPD]LRQHVDQLWDULD
8QLYHUVDOLWjHGHTXLWjGLDFFHVVR
$VVLVWHQ]D6SHFLDOLVWLFD$PEXODWRULDOH
3URJHWWL,&7GL6DQLWj2Q/LQH
$VVLVWHQ]DRGRQWRLDWULFD
*HVWLRQHUHWLFOLQLFKHSHUFRUVLLQWHJUDWL2VSHGDOH±'LVWUHWWR
&RQWUDVWDUHOHLQLTXLWj
&HQWUDOLWjGHOFLWWDGLQR
3URPR]LRQHGHOODSDUWHFLSD]LRQHDWWUDYHUVRL&RPLWDWL&RQVXOWLYL0LVWL
/HUHOD]LRQLFRQLFLWWDGLQLDWWUDYHUVRODULOHYD]LRQHGHOODTXDOLWjSHUFHSLWD
+HDOWKOLWHUDF\HEXRQHSUDWLFKHGLFRPXQLFD]LRQH
&RQVROLGDUHLSURFHVVLGLFXUHSDOOLDWLYHHGLWHUDSLDGHOGRORUH
4XDOLWjGHOO
DVVLVWHQ]DHGHIILFLHQ]DJHVWLRQDOH
*HVWLRQHGHOULVFKLR
5LVFKLRLQIHWWLYRHVRUYHJOLDQ]DHFRQWUROORGHOOHPDODWWLHLQIHWWLYHHSDUDVVLWDULH
3ROLWLFDGHOIDUPDFRHJRYHUQRGHOODVSHVDIDUPDFHXWLFDHGLVSRVLWLYLPHGLFL
3LDQLILFD]LRQHGHOOHDWWLYLWjLQHUHQWLO
$FFUHGLWDPHQWRLVWLWX]LRQDOH
i
3HUFRUVLVSHFLDOLVWLFL
6LVWHPDGHOOHFXUHLQDUHDFULWLFD
3URQWR6RFFRUVR
3LDQLILFD]LRQHGHOO¶DWWLYLWjQHJR]LDOHHSROLWLFKHGLDFTXLVWR
$]LRQLGLUD]LRQDOL]]D]LRQHLQDPELWR,&7
3URPR]LRQHGHOO
HFFHOOHQ]DWHFQRORJLFDFOLQLFDHRUJDQL]]DWLYD
6WUDWHJLHHSHUFRUVLGLLQWHJUD]LRQHLQWHUD]LHQGDOLHGL$UHD9DVWD
5HWHPDODWWLHUDUH
0LJOLRUDPHQWRGHLSURFHVVLGLDFFHVVRWUDWWDPHQWRHGLPLVVLRQHGHOOHSHUVRQHFRQ
ELVRJQRGLDVVLVWHQ]DLQIDVHSRVWDFXWDHULDELOLWDWLYD
*RYHUQRFOLQLFR3URJUDPPD1D]LRQDOH(VLWL
/¶LQQRYD]LRQHWHFQRORJLFD
,QWHJUD]LRQHWUDOHDWWLYLWjDVVLVWHQ]LDOLGLGLGDWWLFDHGLULFHUFD
&RPLWDWRGL,QGLUL]]R
,O SURFHVVR GL LQWHJUD]LRQH LQ DWWXD]LRQH GHOO¶$WWR $]LHQGDOH H GHJOL $FFRUGL
$WWXDWLYL/RFDOL
0DVWHUHSURJHWWLGLFROODERUD]LRQHFRQO¶8QLYHUVLWjGHJOL6WXGLGL3DUPD
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]D
GHOO¶RUJDQL]]D]LRQH
/D³FDUWDGLLGHQWLWj´GHOSHUVRQDOH
$QDOLVLGLJHQHUHGHOSHUVRQDOH
0RELOLWjGHOSHUVRQDOH
3DULRSSRUWXQLWj
3DUWHFLSD]LRQHGHLSURIHVVLRQLVWLDOO¶LQGLYLGXD]LRQHGHOOHVWUDWHJLH
D]LHQGDOLHDOODJHVWLRQHRSHUDWLYD
2UJDQL]]D]LRQHHIXQ]LRQDPHQWRD]LHQGDOHLOUXRORGHO&ROOHJLRGL'LUH]LRQH
*HVWLRQHGHOULVFKLRHVLFXUH]]D
5LGHILQL]LRQHGHLUXROLSURIHVVLRQDOLLQUHOD]LRQHDOORVYLOXSSR
GHOOHVWUDWHJLHD]LHQGDOL
6LVWHPDGLYDOXWD]LRQHGHOOHFRPSHWHQ]HHVLVWHPLSUHPLDQWL
9DOXWD]LRQHGHOULVFKLRJHVWLRQHGHOOHHPHUJHQ]HHSLDQLIRUPDWLYL
*HVWLRQHGHJOLLQIRUWXQL
6LVWHPDG¶LQFHQWLYD]LRQHGHOSHUVRQDOHGLULJHQWH
6LVWHPDG¶LQFHQWLYD]LRQHGHOSHUVRQDOHGHOO¶DUHDFRPSDUWR
)RUPD]LRQH
/DIRUPD]LRQHGHJOLRSHUDWRULVDQLWDULQHOO¶DPELWRUHOD]LRQDOH
GDOODFXUDDOSUHQGHUVLFXUD
6LVWHPDLQIRUPDWLYRGHOSHUVRQDOH
6WUXWWXUDGHOOHUHOD]LRQLFRQLOSHUVRQDOHGLSHQGHQWHHFRQOHVXH
UDSSUHVHQWDQ]H
,GDWLGLDWWLYLWj
,OSURFHVVRGLDFFUHGLWDPHQWRGHOODIXQ]LRQHIRUPDWLYDHGHOODIXQ]LRQHGL3URYLGHU
3URJHWWLSULQFLSDOLDWWLYDWL
5HOD]LRQLVLQGDFDOL
/LEHUDSURIHVVLRQH
*HVWLRQHGHOFRQWHQ]LRVR
/HD]LRQLLQWHPDGLVHUYL]LDOODSHUVRQDHDJOLRSHUDWRUL
,OQLGRD]LHQGDOH
,VHUYL]LDOODSHUVRQD
&RPSDWLELOLWjIUDWHPSLGLYLWDHGLODYRUR
ii
6LVWHPDGLUHOD]LRQLHVWUXPHQWLGLFRPXQLFD]LRQH
/DFRPXQLFD]LRQHSHUO¶DFFHVVRDLVHUYL]L
/DFRPXQLFD]LRQHSHUOHVFHOWHGLLQWHUHVVHSHUODFRPXQLWj
/DFRPXQLFD]LRQHLQWHUQDD]LHQGDOH
*RYHUQRGHOODULFHUFDHLQQRYD]LRQH
$WWLYLWjGHOO¶LQIUDVWUXWWXUDSHUODULFHUFDHO¶LQQRYD]LRQH
6YLOXSSRGLXQDPELHQWHFXOWXUDOHIDYRUHYROH
$FFHVVLELOLWjDOODLQIRUPD]LRQHHGRFXPHQWD]LRQHVFLHQWLILFD
&DSDFLWjGLDWWUD]LRQHGDSDUWHGHOOD$]LHQGDGLULVRUVHILQDQ]LDULH
8WLOL]]RDSSURSULDWRGHOOHLQQRYD]LRQL
$WWLYLWjGLIRUPD]LRQHGHOSHUVRQDOH
&ROODERUD]LRQLFRQDOWUH$]LHQGHGHOOD5HJLRQH(PLOLD5RPDJQD
6YLOXSSRGLSURJHWWLGLULFHUFDHLQQRYD]LRQHLQUHWHFRQDOWUHLVWLWX]LRQLHVWUXWWXUH
VDQLWDULHQD]LRQDOLHVWUDQLHUH
*DUDQ]LHGLWUDVSDUHQ]D
2ELHWWLYLVSHFLILFLGLSDUWLFRODUHULOHYDQ]DLVWLWX]LRQDOH
5LRUJDQL]]D]LRQHGHOO¶RIIHUWDDVVLVWHQ]LDOHQHOO¶$]LHQGD
2VSHGDOLHUR8QLYHUVLWDULDGL3DUPD
$OWULSHUFRUVLGLULRUJDQL]]D]LRQH
$QDJUDIHGHOODULFHUFD
5HSRUWLVWLFD
9DORUL]]D]LRQHGHOUXRORGHO&RPLWDWR(WLFR
&RQFOXVLRQLGHO'LUHWWRUH*HQHUDOH
$SSHQGLFH
,
iii
3UHVHQWD]LRQH
/D VFHOWD GHOOD QRVWUD $]LHQGD GL VSHULPHQWDUH LO PRGHOOR RUJDQL]]DWLYR SHU LQWHQVLWj GL FXUD FKH WHQJD
FRQWR GHOOD FHQWUDOLWj GHO SD]LHQWHFLWWDGLQR GHOOD GLQDPLFD GHOO¶LQQRYD]LRQH WHFQRORJLFD GHOO¶LPSHUDWLYR
VRFLDOHGHOODTXDOLWjGHOOHFXUHGHOOHULVRUVHOLPLWDWHHGHOODFRQVHJXHQWHQHFHVVLWjGLXQXWLOL]]RHIILFLHQWH
LQ XQ¶RWWLFD GL VRVWHQLELOLWj GHO VLVWHPD KD VLJQLILFDWLYDPHQWH FDUDWWHUL]]DWR LO *Lj QHO OD
VSHULPHQWD]LRQH HUD LQL]LDWD QHOOH XQLWj RSHUDWLYH GL 2UWRSHGLD H &OLQLFD 2UWRSHGLFD 7XWWDYLD
FDPELDPHQWL RUJDQL]]DWLYL GL TXHVWD SRUWDWD ULFKLHGRQR WHPSR SHUFKp LQYHVWRQR OD FXOWXUD VWHVVD GL
XQ
RUJDQL]]D]LRQH,OFDPELDPHQWRqWXWWRUDLQFRUVRHQHSUHVHQWLDPRXOWHULRULVWHSGLDYDQ]DPHQWRQHO
FDSLWROR/RVFRUVRDQQRDEELDPRGHGLFDWRLOFDSLWRORDOO¶2VSHGDOHGHL%DPELQL³3LHWUR%DULOOD´8QD
JUDQGH RSSRUWXQLWj SHU O¶$]LHQGD H SHU OD FLWWj WXWWD FRQ XQ SRWHQ]LDOH GL VYLOXSSR FKH ULFKLHGH DOOH
SHUVRQH H DOO¶RUJDQL]]D]LRQH FDSDFLWj GL FDPELDPHQWR H GL DGDWWDPHQWR D QXRYH PRGDOLWj GL ODYRUR H D
FRQWHVWL GLYHUVL FKH URPSRQR OH URXWLQH FRQVROLGDWH 4XHVWR VSLULWR H TXHVWD VSLQWD DO FDPELDPHQWR
FDUDWWHUL]]DQR DQFKH LO SURJHWWR 0$.( LQ 3DUPD SUHVHQWDWR QHO FDSLWROR H FKH VWD PXRYHQGR L SULPL
SDVVLRSHUDWLYL
4XHVWD EUHYH SUHVHQWD]LRQH LQWHQGH IRUQLUH DO OHWWRUH XQD EXVVROD SHU RULHQWDUVL QHL FRQWHQXWL GHO
GRFXPHQWRFKH!ULFFRHFRUSRVR
6L FRQIHUPDQR DQFKH LQ TXHVWR YROXPH OH VFHOWH HGLWRULDOL GHJOL VFRUVL DQQL WHVH D VHPSOLILFDUH L
FRQWHQXWLSHUUHQGHUOLVHPSUHSL"IUXLELOLVHEEHQHJOLDUJRPHQWLWUDWWDWLSUHVHQWLQRXQDOWRWDVVRWHFQLFR
QRQIDFLOPHQWHULGXFLELOH
,O FDSLWROR ! SUREDELOPHQWH LO FDSLWROR FRPSOHVVLYDPHQWH SL" DUGXR GHO YROXPH SURSULR SHU OD VXD
FDUDWWHULVWLFD GL SUHVHQWDUH GDWL GL DWWLYLW# H SURGX]LRQH H GDWL HFRQRPLFL R GL HIILFLHQ]D JHVWLRQDOH
VWDQGDUG GL ULIHULPHQWR H GL FRQIURQWR UHJLRQDOH XWLOL]]DQGR LQGLFDWRUL H JUDILFL H FRQWHQXWL VSHVVR
IRUWHPHQWH WHFQLFL 6RQR VWDWH FRQIHUPDWH OH VFHOWH GHJOL VFRUVL DQQL GL DOOHJJHULUH LO WHVWR XWLOL]]DQGR
O$DSSHQGLFH SHU GDWL H WDEHOOH XWLOL SHU HYHQWXDOH FRQVXOWD]LRQH H OD VHPSOLILFD]LRQH SXU PDQWHQHQGR
ULJRUHHSXQWXDOLW#GHOSDUDJUDIRGHGLFDWRDOOD%6RVWHQLELOLW#HFRQRPLFDILQDQ]LDULDHSDWULPRQLDOH&
,OFDSLWRORSUHVHQWDXQLQWHUHVVDQWHTXDGURVLQWHWLFRGHOFRQWHVWRD]LHQGDOHDWWUDYHUVRO$LQGLFD]LRQHGHL
SULQFLSDOLDWWLGLJRYHUQRHGLJHVWLRQHFKHKDQQRFDUDWWHUL]]DWRLOHULPDQGDQGRDOSRUWDOH6$/87
(5SHULULIHULPHQWLQRUPDWLYLQD]LRQDOLHUHJLRQDOLGLPDJJLRUULOLHYRVIUXWWDQGRFRV'LQPRGRUD]LRQDOHOH
ULVRUVH PHVVH D GLVSRVL]LRQH GDO VLVWHPD UHJLRQDOH LQ TXDQWR LO SRUWDOH SX( IRUQLUH VSXQWL H FKLDYL GL
OHWWXUDROWUHODSDUWHQRUPDWLYD,QWDOHFDSLWROR!SRVVLELOHLQTXDGUDUHLOSRVL]LRQDPHQWRGHOO$$]LHQGDQHOOD
UHWH LQWHJUDWD GHOO$RIIHUWD UHJLRQDOH FRJOLHQGR OH SHFXOLDULW# GHO QRVWUR WHUULWRULR ULVSHWWR DOO$DPELWR
UHJLRQDOH ,QILQH YHQJRQR TXL ULFKLDPDWH OH SULQFLSDOL DWWLYLW# IRUPDWLYH SUHODXUHD H SRVWODXUHD
UHDOL]]DWH GDOOD )DFROW# GL 0HGLFLQD H &KLUXUJLD GL 3DUPD DWWUDYHUVR TXDWWUR 'LSDUWLPHQWL FKH
FRVWLWXLVFRQRRJJLOD)DFROW#QRQFK)OHOLQHHGLVYLOXSSRSUHYLVWHDEUHYHPHGLRWHUPLQH
1HO FDSLWROR VRQR VWDWH PDQWHQXWH OH QRYLW# LQWURGRWWH JOL DQQL VFRUVL RVVLD XQD SUHVHQWD]LRQH SL"
VFKHPDWLFDGHLULVXOWDWLFRQVHJXLWLULVSHWWRDYDULRELHWWLYLHODULRUJDQL]]D]LRQHGLDOFXQHVH]LRQL
&RPH RJQL DQQR QHO FDSLWROR LQ SDUWLFRODUH H LQ DOWUL SXQWL GHO YROXPH WXWWL VSHFLILFDPHQWH
HYLGHQ]LDWL SURSRQLDPR DUJRPHQWL FKH VRQR VWDWL UHGDWWL FRQJLXQWDPHQWH FRQ O
$]LHQGD WHUULWRULDOH SHU
GDUHFRQWRGLDOFXQLGHJOLDPELWLGLLQWHJUD]LRQHVXFXLVWLDPRODYRUDQGR,OWHPDGHOO$LQWHJUD]LRQHULVXOWD
GLSDUWLFRODUHULOLHYRQHOVLDDOLYHOORLQWHUD]LHQGDOHFKHDOLYHOORGLDUHDYDVWD,QIDWWLQHOFDSLWRORYL
! XQ SDUDJUDIR GHGLFDWR %6WUDWHJLH H SHUFRUVL GL LQWHJUD]LRQH LQWHUD]LHQGDOL H GL $UHD 9DVWD& PD GLYHUVL
VSXQWLVRQRULSUHVLLQGLYHUVHSDUWLGHOWHVWR
1HLSULPLFDSLWROLHLQTXHOORGLFKLXVXUDGHOYROXPHVLFRQFHQWUDQRODPDJJLRUSDUWHGHOOHLQIRUPD]LRQL
GLLQTXDGUDPHQWRUHODWLYHDOOHIXQ]LRQLWLSLFKHGHOODQRVWUD$]LHQGDRVVLDOHIXQ]LRQLGLDVVLVWHQ]DULFHUFD
HGLGDWWLFD,QROWUHWURYDQRHVSOLFLWD]LRQHLSULQFLSDOLSHUFRUVLGLUHOD]LRQHHLQWHJUD]LRQHFRQ8QLYHUVLW#H
$]LHQGD86/GL3DUPD
*OL DOWUL FDSLWROL GHO YROXPH VRQR GL IDWWR FDSLWROL WHPDWLFL LQ FXL LO OHWWRUH LQWHUHVVDWR SX( WURYDUH
DSSURIRQGLPHQWLPLUDWLVXWHPLFHQWUDOLSHUODQRVWUDRUJDQL]]D]LRQHLOFDSLWDOHXPDQRQHOFDSLWROROH
VWUDWHJLHGLFRPXQLFD]LRQHQHOFDSLWRORHO$DWWLYLW#GLULFHUFDQHOFDSLWROR
$O FRQWHVWR GL ODYRUR H DOOH SHUVRQH FKH VYROJRQR OD SURSULD DWWLYLW# DOO$LQWHUQR GHOO$$]LHQGD ! GHGLFDWR LO
FDSLWROR 1HO FDSLWROR WURYD LOOXVWUD]LRQH LQ IRUPD VLQWHWLFD O
DWWLYLW# GHO &ROOHJLR GL 'LUH]LRQH TXDOH
VQRGR FHQWUDOH GHJOL RUJDQL H PHFFDQLVPL D]LHQGDOL GL SDUWHFLSD]LRQH GHL SURIHVVLRQLVWL DOO$LQGLYLGXD]LRQH
GHOOHVWUDWHJLHD]LHQGDOLHDOODJHVWLRQHRSHUDWLYDFIUODVH]LRQH
/D FRPXQLFD]LRQH WHVWLPRQLDQ]D FRQFUHWD GHOO$DWWLYLW# GHOO$$]LHQGD H VWUXPHQWR GL FRPSUHQVLRQH GHOOD
VWUXWWXUD RVSHGDOLHUD ! LO WHPD FDUDWWHUL]]DQWH LO FDSLWROR 9HQJRQR TXL ULSUHVH IUD O$DOWUR GLYHUVH
DWWLYLW# SUHVHQWDWH QHL FDSLWROL R GDO SXQWR GL YLVWD GHJOL HYHQWL FRPXQLFDWLYL FKH OH KDQQR
FDUDWWHUL]]DWH
,O FDSLWROR LOOXVWUD LQ PRGR SXQWXDOH H FRQ XQD IRUWH DWWHQ]LRQH SHU OH OLQHH VWUDWHJLFKH GL VYLOXSSR
GHOOD IXQ]LRQH OH DWWLYLW# GL ULFHUFD SRUWDWH DYDQWL QHO GDL SURIHVVLRQLVWL GHOO
$]LHQGD H OH LQL]LDWLYH
DWWXDWHSHUORVYLOXSSRGHOOHFRPSHWHQ]HFRQQHVVHDOODULFHUFDHDOO
LQQRYD]LRQH
,OVXJJHULPHQWRFRPHRJQLDQQR!TXHOORGLFRQVLGHUDUHLOGRFXPHQWRFRPHVWUXPHQWRGLFRQVXOWD]LRQH
FKHSUHVHQWDXQRVSDFFDWRVXOO$DWWLYLW#VXOOHFDUDWWHULVWLFKHHVXOIXQ]LRQDPHQWRGHOO$2VSHGDOH,OIRUPDWR
HOHWWURQLFR FKH ! VWDWR VFHOWR SHU DJHYRODUH OD GLYXOJD]LRQH H ULGXUUH L FRVWL GHULYDQWL GD XQD
SXEEOLFD]LRQH FDUWDFHD FRQVHQWH GL HIIHWWXDUH OHWWXUH WUDVYHUVDOL SHU WHPL GL LQWHUHVVH R SHU SDUROH
FKLDYH
5LFRUGLDPR FKH SHU FRQWDWWDUH O$$]LHQGD ! GLVSRQLELOH O$LQGLUL]]R ELODQFLRGLPLVVLRQH#DRSULW DO TXDOH VL
SRVVRQRLQYLDUHFRQVLGHUD]LRQLVXJJHULPHQWLRLQGLFD]LRQL
*QHFHVVDULRLQILQHSRUJHUHXQVHQWLWRULQJUD]LDPHQWRDOOHSHUVRQHFKHRSHUDQRTXRWLGLDQDPHQWHHFKH
PHWWRQRLQJLRFROHSURSULHFRPSHWHQ]HHLOSURSULRVSLULWRGLVHUYL]LRHDFRORURFKHVRQRGLHWURDOOHWDQWH
SDUROHQXPHULHLQIRUPD]LRQLSUHVHQWLVXTXHVWRYROXPH
/HRQLGD*ULVHQGL
'LUHWWRUH*HQHUDOH
&RQWHVWRGL5LIHULPHQWR
4XHVWRFDSLWRORGHOGRFXPHQWRqYROWRDWUDWWHJJLDUHOR
VIRQGRVXOTXDOHO¶$]LHQGDDJLVFH$WWUDYHUVRGLHVVRVL
SRVVRQRFRJOLHUHFDUDWWHULVWLFKHHOHPHQWLHDVSHWWLGHO
FRQWHVWRGLULIHULPHQWRFKHLQFLGRQRVXOOHFRQGL]LRQLGL
JHVWLRQHD]LHQGDOH
,OFDSLWRORqDUWLFRODWRVXFLQTXHDPELWL
•
4XDGURQRUPDWLYRHLVWLWX]LRQDOH
•
,OVLVWHPDGHOOHUHOD]LRQLFRQO¶8QLYHUVLWj
•
/DUHWHLQWHJUDWDGHOO¶RIIHUWDUHJLRQDOH
•
$FFRUGLGLIRUQLWXUD
•
2VVHUYD]LRQLHSLGHPLRORJLFKH
&RQWHVWRGLULIHULPHQWR
/HD]LHQGHVDQLWDULHRSHUDQRLQXQFRQWHVWRGLULIHULPHQWRDVVDLFRPSOHVVRDQFKHGDOSXQWRGLYLVWDGHO
TXDGURLVWLWX]LRQDOHHGHOOHGLVSRVL]LRQLQRUPDWLYHQD]LRQDOLHUHJLRQDOLFKHSURGXFRQRHIIHWWLVLJQLILFDWLYL
SHUO¶DVVHWWRHO¶DWWLYLWjGHOOHD]LHQGHHLQIRUPDQRJOLRULHQWDPHQWLGLSROLWLFDVDQLWDULDHOLQHHGLVYLOXSSR
VWUDWHJLFKHGHOOHVWHVVHQHOULVSHWWRGHLYLQFROLHFRQRPLFRILQDQ]LDULGHOVLVWHPD
1HLSDUDJUDILVXFFHVVLYLGHOSUHVHQWHFDSLWRORODGLPHQVLRQHGHOFRQWHVWRYLHQHGHOLQHDWDFRQULIHULPHQWR
DOO¶DUWLFRODWR VLVWHPD GHOOH UHOD]LRQL FRQ O¶8QLYHUVLWj H DOOD SURJUDPPD]LRQH GHOOD )DFROWj GL 0HGLFLQD H
&KLUXUJLDHWUDWWHJJLDWDDWWUDYHUVRDOFXQLLQGLFDWRULFKHGHILQLVFRQRODUHWHGHOO¶RIIHUWDHQWURFXLO¶$]LHQGD
VLLQVHULVFH
'LVHJXLWRYHQJRQRLQYHFHVHJQDODWHDOFXQHGHOLEHUHGHO'LUHWWRUH*HQHUDOHUHODWLYHDOFKHWRFFDQR
GLYHUVLDVSHWWLJHVWLRQDOLGHOO¶RVSHGDOH
3HU TXDQWR DWWLHQH OD FRQVXOWD]LRQH H O¶DSSURIRQGLPHQWR GHOOH GLVSRVL]LRQL QD]LRQDOL H UHJLRQDOL SL
VLJQLILFDWLYH H GL UHFHQWH HPDQD]LRQH QHOOD ORUR YHUVLRQH LQWHJUDOH VL ULQYLD DO 3RUWDOH GHO 6HUYL]LR
6DQLWDULR 5HJLRQDOH DOOD VH]LRQH LQWHUDPHQWH GHGLFDWD DOOD OHJLVOD]LRQH LO FXL LQGLUL]]R q
KWWSZZZVDOXWHULWGRFXPHQWD]LRQHOHJJL
KWWSZZZVDOXWHULWVVUODOHJLVOD]LRQHGHOVVU
KWWSZZZWURYDQRUPHVDOXWHJRYLW
$ ULJXDUGR q SRVVLELOH DQFKH FRQVXOWDUH L %LODQFL GL 0LVVLRQH UHODWLYL DJOL DQQL SUHFHGHQWL QHO VLWR
D]LHQGDOHDOO¶LQGLUL]]RKWWSZZZDRSULWD]LHQGDELODQFLRPLVVLRQHELODQFLRPLVVLRQHKWP
¾
'HOLEHUD]LRQH GHO 'LUHWWRUH *HQHUDOH IHEEUDLR Q ³,QWLWROD]LRQH GHO QXRYR SDGLJOLRQH
RVSHGDOLHUR GHOO¶$]LHQGD 2VSHGDOLHUR 8QLYHUVLWDULD GL 3DUPD ³2VSHGDOH GHL %DPELQL GL 3DUPD 3LHWUR%DULOOD´´
¾
'HOLEHUD]LRQH GHO 'LUHWWRUH *HQHUDOH PDJJLR Q ³3URURJD GHOO¶DFFRUGR GL SDUWHQDULDWR
QHOODIRUPD]LRQH(&0WUD$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGL3DUPDHG2UGLQHGHL0HGLFL&KLUXUJKL
HG2GRQWRLDWULGHOOD3URYLQFLDGL3DUPDELHQQLR´
¾
'HOLEHUD]LRQH GHO 'LUHWWRUH *HQHUDOH PDJJLR Q ³&RQYHQ]LRQH WUD O
8QLYHUVLWj GHJOL
6WXGLGL3DUPDHO¶$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGL3DUPDLQWHPDGLVSHULPHQWD]LRQLFOLQLFKH´
¾
'HOLEHUD]LRQH GHO 'LUHWWRUH *HQHUDOH JLXJQR Q ³$SSURYD]LRQH SLDQR GHOOH D]LRQL
SRVLWLYHSUHGLVSRVWRGDO&RPLWDWR8QLFRGL*DUDQ]LD´
¾
'HOLEHUD]LRQH GHO 'LUHWWRUH *HQHUDOH JLXJQR Q ³6RWWRVFUL]LRQH GHO SURWRFROOR G¶LQWHVD
FRQ3UHIHWWXUDGL3DUPD4XHVWXUDGL3DUPD&RPDQGR3URYLQFLDOHGHL&DUDELQLHULGL3DUPD3URYLQFLD
GL3DUPD&RPXQHGL3DUPD0LXUHUXVU8II [LLL±DPELWR7HUULWRULDOH3URYLQFLDGL3DUPD$]LHQGD
86/ GL 3DUPD 2UJDQL]]D]LRQL 6LQGDFDOL XIILFLR LPPLJUDWL &*,/ &,6/ ± 8,/ 7HU]R 6HWWRUH ± )RUXP
6ROLGDULHWjLQPDWHULDGLULFRQJLXQJLPHQWLIDPLOLDULHDFFRJOLHQ]DGHLPLQRUL´
¾
'HOLEHUD]LRQHGHO'LUHWWRUH*HQHUDOHOXJOLRQ³1RPLQDGHO5HVSRQVDELOH$]LHQGDOHGHOOD
SUHYHQ]LRQHGHOODFRUUX]LRQHDLVHQVLGHOOD/HJJHQRYHPEUHQ´
¾
'HOLEHUD]LRQHGHO'LUHWWRUH*HQHUDOHOXJOLRQ³1RPLQDGHO5HVSRQVDELOH$]LHQGDOHSHUOD
7UDVSDUHQ]DDLVHQVLGHO'HFUHWR/HJLVODWLYRPDU]RQ´
¾
'HOLEHUD]LRQH GHO 'LUHWWRUH *HQHUDOH OXJOLR Q ³$GHPSLPHQWL FRQVHJXHQWL DOOD QRPLQD
GHO5HVSRQVDELOHD]LHQGDOHGHOODSUHYHQ]LRQHGHOODFRUUX]LRQHDLVHQVLGHOOD/HJJHQRYHPEUH
Q FRVWLWX]LRQH GHO *UXSSR GL /DYRUR D VXSSRUWR GHO 5HVSRQVDELOH D]LHQGDOH GHOOD SUHYHQ]LRQH
GHOODFRUUX]LRQH´
&RQWHVWRGLULIHULPHQWR
4XDGURQRUPDWLYRHLVWLWX]LRQDOH
¾
&RQWHVWRGLULIHULPHQWR
¾
¾
¾
¾
'HOLEHUD]LRQHGHO'LUHWWRUH*HQHUDOHGLFHPEUHQ³$GHPSLPHQWLLQRUGLQHDO'/JVQ
LQ PDWHULD GL ³$PPLQLVWUD]LRQH 7UDVSDUHQWH ± $SSURYD]LRQH GHO GRFXPHQWR ³/LQHH GL
GLUHWWLYDHLQGLUL]]RRSHUDWLYRLQPDWHULDGL7UDVSDUHQ]D´´
6LWUDWWDGHOOHGHOLEHUHD]LHQGDOLFKHKDQQRGDWRDWWXD]LRQHDOOHUHFHQWLQRUPDWLYHQD]LRQDOLLQWHPD
GLSUHYHQ]LRQHGHOODFRUUX]LRQHHGLDPPLQLVWUD]LRQHWUDVSDUHQWH
1HO VRQR VWDWL QRPLQDWL LO 5HVSRQVDELOH GHOOD 3UHYHQ]LRQH GHOOD &RUUX]LRQH DL VHQVL GHOOD /
H GHOOD &LUFRODUH GHOOD 3UHVLGHQ]D GHO &RQVLJOLR GHL 0LQLVWUL'LSDUWLPHQWR GHOOD )XQ]LRQH
3XEEOLFDQHLO5HVSRQVDELOHGHOOD7UDVSDUHQ]DDLVHQVLGHO'/JV7DOLUHVSRQVDELOL
VRQR VWDWL LQGLYLGXDWL WUD L GLULJHQWL DPPLQLVWUDWLYL GL FRPSURYDWD HVSHULHQ]D H GRWDWL GL
SURIHVVLRQDOLWj LGRQHD WHQHQGR FRQWR GHOOH LQGLFD]LRQL QRUPDWLYH H UHJRODPHQWDUL LQ PHULWR D GHWWH
ILJXUH
, VXFFHVVLYL DGHPSLPHQWL KDQQR LQWHVR VXSSRUWDUH RSHUDWLYDPHQWH LO 5HVSRQVDELOH D]LHQGDOH GHOOD
SUHYHQ]LRQHGHOODFRUUX]LRQHSHUODUHDOL]]D]LRQHGHOOHD]LRQLHGHJOLRELHWWLYLSHUODGHWHUPLQD]LRQH
GHOOHVFHOWHRSHUDWLYHSHUODGHILQL]LRQHGHOO¶DQDOLVLHGHOODPDSSDWXUDGHOOHDUHHDULVFKLRGHLIOXVVL
LQIRUPDWLYLHGRFXPHQWDOLHGHLSHUFRUVLGLPRQLWRUDJJLRHFRQWUROORSHUOHLQL]LDWLYHGLIRUPD]LRQHH
SHU O¶DGHJXDPHQWR H DJJLRUQDPHQWR GHOOH SURFHGXUH H SURWRFROOL ,QIDWWL OH SDUWLFRODUL LQQRYD]LRQL
LQWURGRWWH GDOOD /HJJH Q O¶DPSLH]]D H OD YDULHWj GHOOH DWWLYLWj GD LPSOHPHQWDUH H OD
GHOLFDWH]]D GHL FRPSLWL RUJDQL]]DWLYL H GL FRRUGLQDPHQWR KDQQR RULHQWDWR DOOD FRVWLWX]LRQH GL XQ
*UXSSRGLODYRURDGKRF/HIXQ]LRQLHLFRPSLWLGHO5HVSRQVDELOHGHOODSUHYHQ]LRQHVLULFRQGXFRQRD
ƒ
HODERUDUHODSURSRVWDGLSLDQRWULHQQDOHGHOODSUHYHQ]LRQH
ƒ
GHILQLUH SURFHGXUH DSSURSULDWH SHU VHOH]LRQDUH H IRUPDUH L GLSHQGHQWL GHVWLQDWL DG RSHUDUH LQ
VHWWRULSDUWLFRODUPHQWHHVSRVWLDOODFRUUX]LRQH
ƒ
SURSRUUH PRGLILFKH DO SLDQR LQ FDVR GL DFFHUWDPHQWR VLJQLILFDWLYR GL YLROD]LRQL R GL PXWDPHQWL
GHOO¶RUJDQL]]D]LRQH
ƒ
YHULILFDUH G¶LQWHVD FRQ LO GLULJHQWH FRPSHWHQWH O¶HIIHWWLYD URWD]LRQH GHJOL LQFDULFKL QHJOL XIILFL
SUHSRVWL DOOR VYROJLPHQWR GL DWWLYLWj QHO FXL DPELWR q SL HOHYDWR LO ULVFKLR FKH VLDQR FRPPHVVL
UHDWLGLFRUUX]LRQH
ƒ
LQGLYLGXDUHLOSHUVRQDOHGDLQVHULUHQHLSHUFRUVLGLIRUPD]LRQHVXLWHPLGHOO¶HWLFDHGHOODOHJDOLWj
,Q WHPD GL WUDVSDUHQ]D q VWDWR DSSURYDWR LO GRFXPHQWR ³/LQHH GL GLUHWWLYD H LQGLUL]]R RSHUDWLYR LQ
PDWHULD GL 7UDVSDUHQ]D´ GRFXPHQWR LQWHVR D FRDGLXYDUH L YDUL UHVSRQVDELOL GHOOH
6WUXWWXUH6HUYL]L8IILFL GHOO¶$]LHQGD LQ RUGLQH DOO¶DSSOLFD]LRQH GHOOH QRUPH H DJOL DVSHWWL RSHUDWLYL
FRQQHVVL DJOL REEOLJKL GL WUDVSDUHQ]D FRQ LQGLYLGXD]LRQH GHOOH FRPSHWHQ]H PRGDOLWj H WHPSL GHOOH
D]LRQLGDVYROJHUHGDSDUWHGHOOHDUWLFROD]LRQLD]LHQGDOLWHQHQGRFRQWRGHOOHLQGLFD]LRQLFRQWHQXWHQHL
SURYYHGLPHQWLQD]LRQDOLGLLQGLUL]]R
'HOLEHUD]LRQH GHO 'LUHWWRUH *HQHUDOH OXJOLR Q ³6RWWRVFUL]LRQH GHO 3URWRFROOR G¶LQWHVD
³3HUFRUVR1DVFLWD´FRQLO&RPXQHGL3DUPDLO&RPXQHGL&RORUQRLO&RPXQHGL7RUULOHLO&RPXQHGL
6RUERORLO&RPXQHGL0H]]DQLHO¶$]LHQGD6DQLWDULD/RFDOHGL3DUPD´
,O SURWRFROOR LQWHULVWLWX]LRQDOH QDVFH GD GXH LPSRUWDQWL FRQVLGHUD]LRQL FKH JOL HQWL DGHUHQWL KDQQR
FRQGLYLVR
D O¶HYHQWR GHOOD QDVFLWD QHOO¶DPELWR GHOOD FXOWXUD GHOOD SURPR]LRQH GHO EHQHVVHUH q XQ IHQRPHQR
FKHULJXDUGDLOYLYHUHVRFLDOHQHOVXRFRPSOHVVRHQRQGHYHHVVHUHFRQVLGHUDWRFRPHXQHYHQWR
VWUHWWDPHQWHVDQLWDULR
E LO FRPSLWR GHOO¶,VWLWX]LRQH SXEEOLFD FRQVLVWH QHO IRUQLUH VHUYL]L GL DVVLVWHQ]D PD DQFKH
SULRULWDULDPHQWH QHO SURPXRYHUH XQD FXOWXUD LQ FXL WXWWL JOL DVSHWWL GHOOD YLWD VRFLDOH H
LQWHUSHUVRQDOHVLDQRULFRQRVFLXWLHYDORUL]]DWL
'HOLEHUD]LRQH GHO 'LUHWWRUH *HQHUDOH OXJOLR Q ³5HFHSLPHQWR GHOOD ³&RQYHQ]LRQH
DWWXDWLYD SHU OR VYROJLPHQWR LQWHJUDWR GHOO¶DWWLYLWj GL DFTXLVL]LRQH GL %HQL H 6HUYL]L GHOOH $]LHQGH
GHOO¶$UHD9DVWD(PLOLD1RUG´´
'HOLEHUD]LRQH GHO 'LUHWWRUH *HQHUDOH OXJOLR Q ³5HFHSLPHQWR GHOOD ³&RQYHQ]LRQH
$WWXDWLYD DL VHQVL GHOO¶DUW GHOOD 'HOLEHUD]LRQH *LXQWD 5HJLRQDOH Q H GHOO¶DUW GHOO¶$FFRUGR 4XDGUR SHU OD GLVFLSOLQD GHOOH UHOD]LRQL WUD OH $]LHQGH 6DQLWDULH GHOO¶$UHD 9DVWD (PLOLD
1RUG SHU OD FRVWLWX]LRQH GHO &RRUGLQDPHQWR ,QWHUD]LHQGDOH IUD L 'LSDUWLPHQWL H 6HUYL]L )DUPDFHXWLFL
GHOO¶$UHD9DVWD(PLOLD1RUG´´
'HOLEHUD]LRQH GHO 'LUHWWRUH *HQHUDOH OXJOLR Q ³5HFHSLPHQWR GHOOD ³&RQYHQ]LRQH
$WWXDWLYD DL VHQVL GHOO¶DUW GHOOD 'HOLEHUD]LRQH *LXQWD 5HJLRQDOH Q H GHOO¶DUW GHOO¶$FFRUGR 4XDGUR SHU OD GLVFLSOLQD GHOOH UHOD]LRQL WUD OH $]LHQGH 6DQLWDULH GHOO¶$UHD 9DVWD (PLOLD
¾
¾
¾
¾
¾
¾
1RUGSHUODFRVWLWX]LRQHGHO&RRUGLQDPHQWR,QWHUD]LHQGDOHIUDL6HUYL]LGL,QJHJQHULDFOLQLFDGHOO¶$UHD
9DVWD(PLOLD1RUG´´
'HOLEHUD]LRQH GHO 'LUHWWRUH *HQHUDOH OXJOLR Q ³5HFHSLPHQWR GHOOD ³&RQYHQ]LRQH
$WWXDWLYD DL VHQVL GHOO¶DUW GHOOD 'HOLEHUD]LRQH *LXQWD 5HJLRQDOH Q IUD OH $]LHQGH
6DQLWDULHGHOO¶$UHD9DVWD(PLOLD1RUGSHUODJHVWLRQHFRQJLXQWDGHOOD)RUPD]LRQH´´
'HOLEHUD]LRQH GHO 'LUHWWRUH *HQHUDOH OXJOLR Q ³5HFHSLPHQWR GHOOD ³&RQYHQ]LRQH
$WWXDWLYD DL VHQVL GHOO¶DUW GHOOD 'HOLEHUD]LRQH *LXQWD 5HJLRQDOH Q IUD OH $]LHQGH
6DQLWDULH GHOO¶$UHD 9DVWD (PLOLD 1RUG SHU OD JHVWLRQH FRQJLXQWD GL SURFHGXUH FRQFRUVXDOL SHU LO
SHUVRQDOHGHOFRPSDUWR´´
*OL DWWL GHOLEHUDWLYL TXL ULFKLDPDWL VXJJHOODQR FRQFUHWDPHQWH OH FRQYHQ]LRQL VWLSXODWH IUD OH D]LHQGH
VDQLWDULHGHOO¶$UHD9DVWDHGDQQRFRUSRDOOHVWUDWHJLHGLLQWHJUD]LRQHFRQULIHULPHQWRDLGLYHUVLDPELWL
LQGLFDWL
6RQRVWDWHVRWWRVFULWWHGDL'LUHWWRUL*HQHUDOLFLQTXH&RQYHQ]LRQL$WWXDWLYHFRQO¶LQWHQWRGLUDIIRU]DUH
ODFROODERUD]LRQHLQDPELWLULWHQXWLVWUDWHJLFL
1HO OD IXQ]LRQH GHO 'LSDUWLPHQWR ,QWHUD]LHQGDOH $FTXLVWL D OLYHOOR GL $UHD 9DVWD q GLYHQXWD
JHVWLRQDOHTXHVWRSHUUDIIRU]DUHLOFRQWUROORGHOO¶DWWLYLWjHPRQLWRUDUHPHJOLRO¶DQGDPHQWRGHOOHJDUH
HODORURJHVWLRQHULVSRQGHQGRTXLQGLSLHQDPHQWHDJOLRELHWWLYLUHJLRQDOL
&RRUGLQDPHQWR GHL 'LSDUWLPHQWL6HUYL]L )DUPDFHXWLFL FRQ O¶RELHWWLYR GL JDUDQWLUH XQD FRVWDQWH
LQWHJUD]LRQH WUD OH $]LHQGH UHODWLYDPHQWH DOOH FRPSHWHQ]H GL DPELWR IDUPDFHXWLFR QRQFKp XQ
DGHJXDWRVXSSRUWRDOSURFHVVRGLFHQWUDOL]]D]LRQHGHJOLDFTXLVWL
&RRUGLQDPHQWR GHL 6HUYL]L GL ,QJHJQHULD &OLQLFD SHU JDUDQWLUH XQD FRQWLQXD FROODERUD]LRQH SHU OH
DWWLYLWj FRQQHVVH DOO¶DFTXLVL]LRQH H JHVWLRQH GHOOH DSSDUHFFKLDWXUHWHFQRORJLH VDQLWDULH QRQFKp OD
JHVWLRQHXQLWDULDHLQWHJUDWDGHOOHDWWLYLWjFRQQHVVHDOO¶DFTXLVWRGHOOHDSSDUHFFKLDWXUHVDQLWDULHHGHL
GLVSRVLWLYLPHGLFLGLFRPSHWHQ]D
&RRUGLQDPHQWR GHL 6HUYL]L )RUPD]LRQH D FXL DIILGDUH OD SURJHWWD]LRQH H OD UHDOL]]D]LRQH GL HYHQWL
IRUPDWLYLGLLQWHUHVVHFRPXQHHODSURJHWWD]LRQHHUHDOL]]D]LRQHFRQJLXQWDGHLFRUVL)$'
JHVWLRQH FRPXQH GHL FRQFRUVL UHODWLYL DO SHUVRQDOH GHO FRPSDUWR DWWUDYHUVR OD FRQGLYLVLRQH GL
SURFHGXUHFRPXQLSHUORVYROJLPHQWRGHLFRQFRUVLUHODWLYLDOSHUVRQDOHGHOFRPSDUWR$OO¶LQWHUQRGHOOD
&RQYH]LRQH VRQR VWDWH GHILQLWH OH PRGDOLWj RSHUDWLYH SHU OR VYROJLPHQWR FRPXQH GHL FRQFRUVL H LO
VXFFHVVLYRXWLOL]]RGHOOHJUDGXDWRULH
8Q DSSURIRQGLPHQWR VX TXHVWL DVSHWWL q SUHVHQWDWR QHOOD VH]LRQH GHO FDSLWROR ³3URPR]LRQH
GHOO
HFFHOOHQ]DWHFQRORJLFDFOLQLFDHRUJDQL]]DWLYD´
'HOLEHUD]LRQH GHO 'LUHWWRUH *HQHUDOH OXJOLR Q ³&RVWLWX]LRQH GHO &RPLWDWR (WLFR SHU
3DUPDHQRPLQDGHLUHODWLYLFRPSRQHQWL´
'HOLEHUD]LRQHGHO'LUHWWRUH*HQHUDOHDJRVWRQ³5HFHSLPHQWRGHO3URWRFROORGLLQWHQWLWUD
&RQIHGHUD]LRQL VLQGDFDOL &JLO &LVO 8LO$86/ H $]LHQGD 2VSHGDOLHUR8QLYHUVLWDULD GL 3DUPD ³*OL
LPSHJQLGHOODVDQLWjSURYLQFLDOH´´
6LYHGDDULJXDUGRLOSDUDJUDIR6WUDWHJLHHSHUFRUVLGLLQWHJUD]LRQHLQWHUD]LHQGDOLHGL$UHD9DVWDQHOOD
VH]LRQH³3URPR]LRQHGHOO
HFFHOOHQ]DWHFQRORJLFDFOLQLFDHRUJDQL]]DWLYD´GHOFDSLWROR
'HOLEHUD]LRQH GHO 'LUHWWRUH *HQHUDOH DJRVWR Q ³7UDVIHULPHQWR GHOO¶LPPRELOH GL
SURSULHWjGHOO¶$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGL3DUPDGHQRPLQDWR³3DGLJOLRQH%UDJD´DOO¶$]LHQGD
86/GL3DUPD$WWLFRQVHJXHQWL´
,O WUDVIHULPHQWR GL SURSULHWj GHO ³3DGLJOLRQH %UDJD´ q O¶HVLWR GL XQ SHUFRUVR SURPRVVR GDOOH GXH
$]LHQGHVDQLWDULHLQL]LDWRQHOHUHODWLYRDOWUDVIHULPHQWRGHOOHDWWLYLWjDVVLVWHQ]LDOLGLSVLFKLDWULD
LQIDVHDFXWDQRQFKpGHO6HUYL]LR3VLFKLDWULFRGLDJQRVLFXUDHGHJHQ]HSVLFKLDWULFKHGHOO¶$]LHQGD8VO
DOO¶LQWHUQRGHOO¶DUHDRVSHGDOLHUDSHUJDUDQWLUHODSURVVLPLWjHO¶LQWHJUD]LRQHFRQLVHUYL]LGLVXSSRUWRH
GLHPHUJHQ]DGHOO¶$]LHQGD2VSHGDOLHUD
'HOLEHUD]LRQHGHO 'LUHWWRUH *HQHUDOH GHO VHWWHPEUH ³3URJHWWR ³7UDVIHULPHQWRGL EXRQH
SUDWLFKH GL FRQWUDVWR DOOH LQLTXLWj LQ ULIHULPHQWR DJOL XWHQWL QHL VHUYL]L VDQLWDUL VRFLRVDQLWDUL H GL
FRPXQLWj´ ± VRWWRSURJHWWR Q ³0HGLD]LRQH GL VLVWHPD´ )RQGR 5HJLRQDOH SHU OD 0RGHUQL]]D]LRQH
± '*5 Q GHO &2' &83 (- 3URYYHGLPHQWL
FRQVHJXHQWL´
&RQWHVWRGLULIHULPHQWR
¾
¾
¾
¾
&RQWHVWRGLULIHULPHQWR
¾
¾
¾
'HOLEHUD]LRQH GHO 'LUHWWRUH *HQHUDOH RWWREUH Q ³,QWHJUD]LRQH WUD $]LHQGD 86/ H
$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGL3DUPD±$SSURYD]LRQH&RQYHQ]LRQH$WWXDWLYDUHODWLYDDLSURJHWWL
GLLQWHJUD]LRQHFROODERUD]LRQHSHUO¶$UHD$WWLYLWj7HFQLFKHH3DWULPRQLDOL´
7DOH DWWR Gj DSSOLFD]LRQH DO 3URWRFROOR GL LQWHQWL WUD &RQIHGHUD]LRQL VLQGDFDOL &JLO &LVO 8LO$86/ H
$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGL3DUPD³*OLLPSHJQLGHOODVDQLWjSURYLQFLDOH´GLFXLDOODGHOLEHUD
H SDUWH GDOOD FRQVLGHUD]LRQH FKH LO 6HUYL]LR $WWLYLWj 7HFQLFKH H /RJLVWLFKH 6$7/
GHOO¶$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGL3DUPDHLO6HUYL]LR$WWLYLWj7HFQLFKH6$7GHOO¶$]LHQGD86/
GL 3DUPD SXU DYHQGR DGRWWDWR PRGHOOL RUJDQL]]DWLYL GLYHUVL VYROJRQR DWWLYLWj DQDORJKH LQ
SDUWLFRODUH SHU TXHOOH FRQQHVVH D &ROODXGL 'LUH]LRQL ODYRUL &RRUGLQDPHQWR 6LFXUH]]D LQ IDVH GL
SURJHWWD]LRQHHGHVHFX]LRQHHG(QHUJ\0DQDJHPHQWHFKHFRPHHVSOLFLWDWRQHOSURJHWWRVLULWLHQH
RSSRUWXQRYHQJDQRFRRUGLQDWHDOLYHOORSURYLQFLDOHDOILQHGLULGXUUHJOLLQFDULFKLSURIHVVLRQDOLDWHFQLFL
HVWHUQL LQFUHPHQWDUH O¶LQWHUVFDPELR SURIHVVLRQDOH H FRQGLYLGHUH H DWWXDUH OH EXRQH SUDWLFKH VXOOH
RSHUH GD UHDOL]]DUH 3HU WDOL PRWLYD]LRQL VL ULWLHQH FKH OD FRVWLWX]LRQH GL XQD IXQ]LRQH GL
FRRUGLQDPHQWR GHQRPLQDWR ³&RRUGLQDPHQWR 3URYLQFLDOH 6HUYL]L 7HFQLFL 6DQLWDUL´ &676 SRVVD
UDSSUHVHQWDUH OD IRUPD RUJDQL]]DWLYD SL LGRQHD D JDUDQWLUH O¶HIILFDFLD H O¶HIILFLHQ]D GHOOH DWWLYLWj GL
&ROODXGR 'LUH]LRQL /DYRUL &RRUGLQDPHQWR 6LFXUH]]D H (QHUJ\ 0DQDJHPHQW /D FRQYHQ]LRQH
DWWXDWLYDVRWWRVFULWWDGLVFLSOLQDOHPRGDOLWjRSHUDWLYHGLIXQ]LRQDPHQWRGLGHWWRFRRUGLQDPHQWR
'HOLEHUD]LRQH GHO 'LUHWWRUH *HQHUDOH RWWREUH Q ³5HFHSLPHQWR GHOOH ³/LQHH JXLGD SHU
O¶DWWLYLWjRGRQWRLDWULFD´´
3HU XQ DSSURIRQGLPHQWR UHODWLYDPHQWH DOO¶DWWLYLWj RGRQWRLDWULFD H DOOH /LQHH JXLGD UHFHSLWH FRQ OD
GHOLEHUD LQGLFDWD VL YHGD LO SDUDJUDIR $VVLVWHQ]D RGRQWRLDWULFD GHO FDSLWROR SHUFRUVR HODERUDWR LQ
PRGRFRPXQHGDOOHGXH$]LHQGHVDQLWDULH
'HOLEHUD]LRQH GHO 'LUHWWRUH *HQHUDOH QRYHPEUH Q ³8WLOL]]R GL DXWRPH]]L GL SURSULHWj
D]LHQGDOH±$SSURYD]LRQHGHOUHODWLYR5HJRODPHQWR±3URYYHGLPHQWLFRQVHJXHQWL´
'HOLEHUD]LRQH GHO 'LUHWWRUH *HQHUDOH GLFHPEUH Q ³5LFRVWLWX]LRQH GHO &RPLWDWR GHL
*DUDQWL DL VHQVL GHOO¶DUW FRPPD GHO ' /JV H GHOO¶DUW $WWR $]LHQGDOH GHOO¶$]LHQGD
2VSHGDOLHUR8QLYHUVLWDULD GL 3DUPD &RQWHVWXDOH DSSURYD]LRQH GHO UHODWLYR UHJRODPHQWR GL
IXQ]LRQDPHQWR´
'HOLEHUD]LRQH GHO 'LUHWWRUH *HQHUDOH GLFHPEUH Q ³$SSURYD]LRQH GHOO¶DGHVLRQH DOOD
³&RQYHQ]LRQHWUDJOL(QWLSXEEOLFLVRFLGHOOD6RFLHWj&836S$SHUO¶RUJDQL]]D]LRQHGLVHUYL]LDG
DOWD WHFQRORJLD LQIRUPDWLFD D VXSSRUWR GHOOH DWWLYLWj VDQLWDULH VRFLRVDQLWDULH VRFLDOL H GHL VHUYL]L
GHJOL HQWL ORFDOL DOOD SHUVRQD SHU OD GHWHUPLQD]LRQH LQ RUGLQH DO ORUR VYROJLPHQWR D PH]]R GHOOD
6RFLHWj&836S$´DOOHJDWDDOOD'HOLEHUDGL*LXQWD5HJLRQDOHQGHOQRYHPEUH´
'HOLEHUD]LRQH GHO 'LUHWWRUH *HQHUDOH GLFHPEUH Q ³3URJHWWR SHU LO 6HUYL]LR &LYLOH
1D]LRQDOH GHOO¶$]LHQGD 2VSHGDOLHUR 8QLYHUVLWDULD GL 3DUPD ³&XUDUH OD UHOD]LRQH SHU SUHQGHUVL FXUD
GHOODSHUVRQD±´$SSURYD]LRQHJUDGXDWRULDGHLYRORQWDUL´
6LWUDWWDGHOO¶HVLWRGHOODVHOH]LRQHGHLYRORQWDULSHULOVHFRQGRSURJHWWRGLVHUYL]LRFLYLOHGHOO¶$]LHQGD
,O SURJHWWR FXL VL ULIHULVFH TXHVWD GHOLEHUD q DWWXDOPHQWH LQ FRUVR 1HO FDSLWROR YLHQH EUHYHPHQWH
SUHVHQWDWD O¶DWWLYLWj UHDOL]]DWD SHU O¶DQDORJR SURJHWWR FKH q VWDWR UHDOL]]DWR WUD H ,
SURJHWWL GL VHUYL]LR FLYLOH QD]LRQDOH VRQR SUHVHQWL QHOOD SDJLQD GHGLFDWD VXO VLWR D]LHQGDOH
KWWSZZZDRSULWFKLVLDPRWUDVSDUHQ]DDPPLQLVWUDWLYDVHUYL]LRFLYLOHQD]LRQDOH
'HOLEHUD]LRQH GHO 'LUHWWRUH *HQHUDOH GLFHPEUH Q ³$GR]LRQH GHO &RGLFH GL
&RPSRUWDPHQWRGHLSURIHVVLRQLVWLHGHLFRQVXOHQWLGHOO¶$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGL3DUPDDL
VHQVLGHOO¶DUWGHO'/JVQ´
¾
'HOLEHUD]LRQH GHO 'LUHWWRUH *HQHUDOH GLFHPEUH Q ³$JJLRUQDPHQWR GHO 'RFXPHQWR
3URJUDPPDWLFRVXOOD6LFXUH]]DDGRWWDWRDLVHQVLGHO'/JVQGHOJLXJQR´
1HOO¶DQQRO¶$WHQHRGL3DUPDqVWDWRULPRGXODWRDVHJXLWRGHOO¶HQWUDWDLQYLJRUHGHOODOHJJH
OHJJH³*HOPLQL´,QTXHVWRPXWDWRFRQWHVWROD)DFROWjGL0HGLFLQDH&KLUXUJLDqRJJLFRVWLWXLWDGDTXDWWUR
'LSDUWLPHQWL
0HGLFLQD&OLQLFDH6SHULPHQWDOH
1HXURVFLHQ]H
6FLHQ]H%LRPHGLFKH%LRWHFQRORJLFKHH7UDVOD]LRQDOL
6FLHQ]H&KLUXUJLFKH
/D ULPRGXOD]LRQH KD ULJXDUGDWR VRVWDQ]LDOPHQWH VROR DVSHWWL RUJDQL]]DWLYL HVVHQGR GL IDWWR LQYDULDWH OH
IXQ]LRQLGLGDWWLFKHGLULFHUFDHGDVVLVWHQ]LDOL
4XDOHVWUXWWXUDGLUDFFRUGRIUDLTXDWWUR'LSDUWLPHQWLGHQRPLQDWD)DFROWjGL0HGLFLQDH&KLUXUJLDqVWDWD
LVWLWXLWDFRQ'5GHOJLXJQRHQHqVWDWRHOHWWR3UHVLGHQWHLO3URI*LDQ3DROR&HGD
1HOO¶DPELWR GHO VLVWHPD GL UHOD]LRQL FRQ O¶8QLYHUVLWj DO ILQH GL GHILQLUH PHJOLR LO FRQWHVWR QHO TXDOH
O¶$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDRSHUDYHQJRQREUHYHPHQWHULFKLDPDWHOHSULQFLSDOLDWWLYLWjIRUPDWLYH
SUHODXUHD H SRVWODXUHD UHDOL]]DWH GDOOD )DFROWj GL 0HGLFLQD H &KLUXUJLD GL 3DUPD DWWUDYHUVR L TXDWWUR
'LSDUWLPHQWLVRSUDPHQ]LRQDWLQRQFKpOHOLQHHGLVYLOXSSRSUHYLVWHDEUHYHPHGLRWHUPLQH
3HUTXDQWRULJXDUGDL&RUVLGLODXUHDDWWXDOPHQWHVRQRLQHVVHUHFRUVLGLFXLPDJLVWUDOLDFLFORXQLFR
0HGLFLQD H &KLUXUJLD 2GRQWRLDWULD H 3URWHVL 'HQWDULD GL ODXUHD PDJLVWUDOH 6FLHQ]H ,QIHUPLHULVWLFKH
HG 2VWHWULFKH 6FLHQ]H H WHFQLFKH GHOOH DWWLYLWj PRWRULH SUHYHQWLYH H DGDWWDWH H 3VLFRELRORJLD H
QHXURVFLHQ]HFRJQLWLYHWULHQQDOLGHOOHSURIHVVLRQLVDQLWDULH)LVLRWHUDSLD,QIHUPLHULVWLFD/RJRSHGLD
2UWRWWLFD HG $VVLVWHQ]D 2IWDOPRORJLFD 2VWHWULFLD 7HFQLFKH $XGLRSURWHVLFKH 7HFQLFKH GHOOD 3UHYHQ]LRQH
QHOO¶$PELHQWH H QHL /XRJKL GL /DYRUR 7HFQLFKH GL /DERUDWRULR %LRPHGLFR 7HFQLFKH GL 5DGLRORJLD 0HGLFD
SHU ,PPDJLQL H 5DGLRWHUDSLD GL ODXUHD PDJLVWUDOH LQWHUGLSDUWLPHQWDOH %LRWHFQRORJLH PHGLFKH
YHWHULQDULH H IDUPDFHXWLFKH GL ODXUHD WULHQQDOH QRQ DSSDUWHQHQWH DOOH SURIHVVLRQL VDQLWDULH 6FLHQ]H
GHOOH$WWLYLWj0RWRULH6SRUWH6DOXWH
,OQXPHURFRPSOHVVLYRGHJOLVWXGHQWLLVFULWWLQHL&RUVLGL/DXUHDQHOO¶DQQRqSDULDXQLWjGL
FXLFLUFDLOUHVLGHQWLQHOODSURYLQFLDGL3DUPDLOUHVLGHQWLLQIUDUHJLRQHLOUHVLGHQWLIXRUL
UHJLRQHHLOVWUDQLHUL
3HUTXDQWRULJXDUGDOH6FXROHGLVSHFLDOL]]D]LRQHSRVWODXUHDLQDPELWRVDQLWDULRVRQRLQHVVHUHFRUVL
GLFXLGLDUHDPHGLFDGLDUHDFKLUXUJLFDHGLDUHDGHLVHUYL]L$VHJXLWRGHOULDVVHWWRGHOOH6FXROH
GL6SHFLDOL]]D]LRQHJHQHUDWRGDO'0DJRVWRDWWXDOPHQWHOH6FXROHDXWRQRPHVRQRVRQROH
6FXROH DJJUHJDWH OD FXL VHGH DPPLQLVWUDWLYD q 3DUPD H OH 6FXROH DJJUHJDWH DYHQWL FRPH VHGH
DPPLQLVWUDWLYDXQDOWUR$WHQHR,OQXPHURFRPSOHVVLYRGHLPHGLFLLQIRUPD]LRQHLVFULWWLQHOO¶DQQR
q SDUL D FRPH GHFOLQDWR QHL VXFFHVVLYL FDSLWROL H $ SDUWLUH GDOO¶$$ O¶DVVHJQD]LRQH GHL FRQWUDWWL GL IRUPD]LRQH DOOH 6FXROH GL 6SHFLDOL]]D]LRQH YHUUj GHWHUPLQDWD D VHJXLWR
GHOO¶HPDQD]LRQH GL DSSRVLWR '0 ,O FRQFRUVR SHU O¶DPPLVVLRQH GHL PHGLFL LQ IRUPD]LRQH VSHFLDOLVWLFD DL
VXGGHWWLFRUVLYHUUjVYROWRVXEDVHQD]LRQDOHSUHVXPLELOPHQWHDGRWWREUH
3HU TXDQWR ULJXDUGD L &RUVL GL GRWWRUDWR VL q DYXWD OD FUHD]LRQH GL XQ¶XQLFD VFXROD GL GRWWRUDWR LQ
0HGLFLQDH&KLUXUJLDVRQRDGRJJLDWWLYLFLFOLGLGRWWRUDWRGDOƒDOƒFRQXQQXPHURGLGRWWRUDQGL
SDULDFLUFDD
8QDOWURFDPSRGLDWWLYLWjIRUPDWLYDGLULOLHYRQHOSRVWODXUHDqTXHOORUHODWLYRDL0DVWHUGLƒHƒOLYHOOR
QHO QH VRQR DWWLYL FRQ XQ QXPHUR FRPSOHVVLYR GL SDUWHFLSDQWL SDUL FLUFD D ,QILQH
SUHVVROD)DFROWjGL0HGLFLQDH&KLUXUJLDGL3DUPDVLVYROJRQRDOFXQL&RUVLGLSHUIH]LRQDPHQWR1HOO¶DQQR
QHVRQRVWDWLDWWLYDWLFRQXQGLVFUHWRQXPHURGLSDUWHFLSDQWL
1HO FRPSOHVVR LO QXPHUR GL SHUVRQH LVFULWWH D FRUVL GL ODXUHD H SRVWODXUHD GHOOD )DFROWj GL 0HGLFLQD H
&KLUXUJLDGL3DUPDVLPDQWLHQHVWDELOHHVLDJJLUDLQWRUQRDFLUFDVWXGHQWL
'D TXHVWD EUHYH GHVFUL]LRQH GHOOH PDFUR DWWLYLWj GLGDWWLFKH VL HYLQFH XQD VRVWDQ]LDOH VWDELOLWj GHOOD
SURJUDPPD]LRQH XQLYHUVLWDULD GHOOD )DFROWj FRQ XQ OLHYH SRWHQ]LDPHQWR GHOO¶RIIHUWD IRUPDWLYD H GHO
QXPHUR FRPSOHVVLYR GL VWXGHQWL LVFULWWL $QFKH SHU O¶LPPHGLDWR IXWXUR OH OLQHH GL VYLOXSSR GHOOD
SURJUDPPD]LRQH GLGDWWLFD QRQ SUHYHGRQR WDQWR XQR VYLOXSSR TXDQWLWDWLYR SHUDOWUR FDOPLHUDWR GDOOH
QRUPH QD]LRQDOL FKH LPSRQJRQR XQ QXPHUR SURJUDPPDWR GL VWXGHQWL SHU WXWWL L FRUVL XQLYHUVLWDUL GL
DPELWRVDQLWDULRTXDQWRSLXWWRVWRXQDULGHILQL]LRQHHULPRGXOD]LRQHLQVHQVRTXDOLWDWLYRVHFRQGRTXDQWR
SUHYLVWRGDDOFXQHVSHFLILFKHQRUPDWLYHGLUHFHQWHHPDQD]LRQHULJXDUGDQWLL&RUVLGL/DXUHDLQSDUWLFRODUH
&RQWHVWRGLULIHULPHQWR
,OVLVWHPDGHOOHUHOD]LRQLFRQO¶8QLYHUVLWj
LO GHFUHWR PLQLVWHULDOH Q GHO RWWREUH H VXFFHVVLYL GHFUHWL DWWXDWLYL OH 6FXROH GL
VSHFLDOL]]D]LRQH LQ SDUWLFRODUH LO GHFUHWR GHO DJRVWR H VXFFHVVLYL GHFUHWL DWWXDWLYL OD GRFHQ]D
XQLYHUVLWDULDLQSDUWLFRODUHODOHJJHQGHOQRYHPEUHHODOHJJHUHFDQWH³1RUPHLQ
PDWHULD GL RUJDQL]]D]LRQH GHOOH XQLYHUVLWj GL SHUVRQDOH DFFDGHPLFR H UHFOXWDPHQWR QRQFKp GHOHJD DO
*RYHUQRSHULQFHQWLYDUHODTXDOLWjHO¶HIILFLHQ]DGHOVLVWHPDXQLYHUVLWDULR´
,OFRPSOHVVRGLTXHVWHUHFHQWLQRUPDWLYHQD]LRQDOLFKHYDQQRDUDFFRUGDUVLFRQOHQRUPDWLYHUHJLRQDOLLQ
SDUWLFRODUH OD OHJJH UHJLRQDOH Q GHO GLFHPEUH H DL FRQVHJXHQWL DFFRUGL DWWXDWLYL ORFDOL JLj
UHDOL]]DWL D 3DUPD VSLQJRQR YHUVR VFHQDUL QXRYL DQFKH QHOO¶DPELWR GHOOR VYLOXSSR GHOODSURJUDPPD]LRQH
GLGDWWLFDHGHOODJHVWLRQHGHOOD)DFROWjGL0HGLFLQDH&KLUXUJLD
6HODVLWXD]LRQHHFRQRPLFDORSHUPHWWHUjJOLRELHWWLYLSULQFLSDOLGHOODSURJUDPPD]LRQHGLGDWWLFDDEUHYH
PHGLRWHUPLQHSRVVRQRHVVHUHVLQWHWLFDPHQWHLQGLFDWLLQWHUPLQLTXDQWLWDWLYLHTXDOLWDWLYL
,QWHUPLQLTXDQWLWDWLYLVLSUHYHGH
y
LOPDQWHQLPHQWRGHJOLDWWXDOL&RUVLGL/DXUHD
y
LOPDQWHQLPHQWRGHJOLDWWXDOL&RUVLGHOOH6FXROHGL6SHFLDOL]]D]LRQH
y
LO PDQWHQLPHQWR GHJOL DWWXDOL FRUVL GL 0DVWHU H O¶DWWLYD]LRQH GL QXRYL 0DVWHU QHOO¶DPELWR GHOOH
SURIHVVLRQLVDQLWDULH
y
LOPDQWHQLPHQWRGHJOLDWWXDOL&RUVLGL3HUIH]LRQDPHQWR
y
y
,QWHUPLQLTXDOLWDWLYLHGLVLVWHPDFRQLO665HO¶$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGLULIHULPHQWRVL
SUHYHGH
y
XQD UHYLVLRQH GHOO¶RIIHUWD IRUPDWLYD H XQD ULPRGXOD]LRQH RUJDQL]]DWLYD GL WXWWL L &RUVL GL ODXUHD DOOD
OXFH GL TXDQWR GLVSRVWR GDO VLVWHPD $9$ $1985 FRQ O¶LQWHQWR GHOOD VHPSOLILFD]LRQH
UD]LRQDOL]]D]LRQH PLJOLRUH XWLOL]]R GHO FRUSR GRFHQWH H LQFUHPHQWR GHOOD TXDOLWj H GHOOD SURGXWWLYLWj
VWXGHQWHVFD
y
XQULDVVHWWRGLWXWWHOH6FXROHGLVSHFLDOL]]D]LRQHDOODOXFHGLTXDQWRGLVSRVWRGDO'HFUHWRPLQLVWHULDOH
GHODJRVWRHVXFFHVVLYLGHFUHWLDWWXDWLYLFRQO¶LQWHQWRGLPLJOLRUDUHHXOWHULRUPHQWHTXDOLILFDUH
LOSHUFRUVRSURIHVVLRQDOHGHLPHGLFLLQIRUPD]LRQH
y
XQ¶HVWHQVLRQH GHOOD FROODERUD]LRQH FRQ O¶$]LHQGD 86/ GL 3DUPD FRQ OH $]LHQGH VDQLWDULH GL 5HJJLR
(PLOLDH3LDFHQ]DHFRQOD)DFROWjGL0HGLFLQDH&KLUXUJLDGHOO¶8QLYHUVLWjGL0RGHQDH5HJJLR(PLOLD
VLD SHU JOL DVSHWWL GLGDWWLFL FKH SHU OD ULFHUFD LQ FDPSR FOLQLFR LQ XQD ORJLFDGL DUHD YDVWD GHOO¶(PLOLD
RYHVW
3HU TXDQWR ULJXDUGD LO SHUVRQDOH GRFHQWH GL $UHD 0HGLFR&KLUXUJLFD FRQVLGHUDWR FKH O¶$]LHQGD
2VSHGDOLHUR8QLYHUVLWDULDGL3DUPDFRVWLWXLVFHSHUO¶8QLYHUVLWjGHJOL6WXGLGL3DUPDO¶D]LHQGDGLULIHULPHQWR
SHUOHDWWLYLWjDVVLVWHQ]LDOLHVVHQ]LDOLDOORVYROJLPHQWRGHOOHIXQ]LRQLGLGLGDWWLFDHULFHUFDVLUDSSUHVHQWD
QHOO¶DPELWR GHO FRPSOHVVLYR QXPHUR GHL GRFHQWL DIIHUHQWL DL 'LSDUWLPHQWL 8QLYHUVLWDUL GL $UHD 0HGLFR
&KLUXUJLFD O¶HQWLWj GHO SHUVRQDOH GRFHQWH LQVHULWR LQ DWWLYLWj DVVLVWHQ]LDOH QHOO¶DQQR SUHVVR
'LSDUWLPHQWL DG $WWLYLWj ,QWHJUDWD GHOO¶$]LHQGD LQ DWWXD]LRQH GHOO¶$FFRUGR $WWXDWLYR /RFDOH VWLSXODWR WUD
O¶$]LHQGDHO¶8QLYHUVLWjLQGDWD
7DEHOOD'RFHQWLXQLYHUVLWDULLQVHUYL]LRSUHVVRL'LSDUWLPHQWL8QLYHUVLWDULGL$UHD0HGLFR
&KLUXUJLFDDOODGDWD
&RQWHVWRGLULIHULPHQWR
)DFROWj
3HUVRQDOHGRFHQWHDIIHUHQWHDL
'8GL$UHD0HGLFR&KLUXUJLFD
GLFXLLQVHULWLLQDWWLYLWj
DVVLVWHQ]LDOLQHL'$,
GHOO¶$]LHQGD2VSHGDOLHUR
8QLYHUVLWDULDGL3DUPD
'RFHQWLGL
3ULPD
IDVFLD
'RFHQWLGL
6HFRQGD
IDVFLD
5LFHUFDWRUL
7'
/
$VVLVWHQWL
RUGLQDUL
7RWDOL
5LFHUFDWRUL
XQLYHUVLWDUL
7DEHOOD'RFHQWLXQLYHUVLWDULFHVVDWLDVVXQWLQHOO¶DQQRDIIHUHQWLDL'8GL$UHD0HGLFR
&KLUXUJLFD
$QQR
3ULPDIDVFLD
&HVVDWL
$VVXQWL
5LFHUFDWRUL
XQLYHUVLWDUL
6HFRQGDIDVFLD
&HVVDWL
$VVXQWL
&HVVDWL
$VVXQWL
7DEHOOD'RFHQWLXQLYHUVLWDULFHVVDWLDVVXQWLQHOO¶DQQRDIIHUHQWLDL'8GL$UHD0HGLFR
&KLUXUJLFDLQVHULWLLQDWWLYLWjDVVLVWHQ]LDOHSUHVVRL'$,GHOO¶$]LHQGD2VSHGDOLHUR8QLYHUVLWDULD
GL3DUPD
$QQR
3ULPDIDVFLD
&HVVDWL
1XRYLLQVHULPHQWLLQ
DWWLYLWjDVVLVWHQ]LDOH
6HFRQGDIDVFLD
&HVVDWL
1XRYLLQVHULPHQWL
LQDWWLYLWj
DVVLVWHQ]LDOH
5LFHUFDWRULXQLYHUVLWDUL
&HVVDWL
1XRYLLQVHULPHQWLLQ
DWWLYLWjDVVLVWHQ]LDOH
$VHJXLWRGHOO¶$FFRUGRWUDO¶$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGL3DUPDHO¶8QLYHUVLWjGHJOL6WXGLGL3DUPD
VWLSXODWR LQ GDWD GLFHPEUH VXOO¶LPSLHJR LQ DWWLYLWj DVVLVWHQ]LDOH GL 5LFHUFDWRUL D 7HPSR
'HWHUPLQDWR57'GLFXLDOO¶DUWFR/GHOGLFHPEUHVRQRVWDWLLQVHULWLQULFHUFDWRUL
7DEHOOD5LFHUFDWRULD7HPSR'HWHUPLQDWRGLFXLDOO¶DUWFR/GHOGLFHPEUH
QHOO¶DQQRDIIHUHQWLDL'8GL$UHD0HGLFR&KLUXUJLFD
$QQR
5LFHUFDWRULD7HPSR'HWHUPLQDWR
GLFXLDOO¶DUWFR/GHOGLFHPEUH
&HVVDWL
$VVXQWL
7DEHOOD5LFHUFDWRULD7HPSR'HWHUPLQDWRGLFXLDOO¶DUWFR/GHOGLFHPEUH
QHOO¶DQQRDIIHUHQWLDL'8GL$UHD0HGLFR&KLUXUJLFDLQVHULWLLQDWWLYLWjDVVLVWHQ]LDOHSUHVVR
L'$,GHOO¶$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGL3DUPD
5LFHUFDWRULD7HPSR'HWHUPLQDWR
GLFXLDOO¶DUWFR/GHOGLFHPEUH
&HVVDWL
1XRYLLQVHULPHQWLLQDWWLYLWj
DVVLVWHQ]LDOH
3HU SDUWLFRODUL HVLJHQ]H DVVLVWHQ]LDOL HVVHQ]LDOL DOOR VYROJLPHQWR GHOOH IXQ]LRQL GL GLGDWWLFD H GL ULFHUFD
O¶8QLYHUVLWjDLVHQVLGHOO¶DUWGHO'/JVHGHOO¶DUWGHO3URWRFROORG¶LQWHVD5HJLRQH8QLYHUVLWj
FRQFRUGDFRQOD5HJLRQHO¶XWLOL]]D]LRQHGLXOWHULRULVWUXWWXUHSXEEOLFKHHRGLVWUXWWXUHDVVLVWHQ]LDOLSULYDWH
(QWURWDOHFRQWHVWRVRQRLQHVVHUHOHVHJXHQWLFRQYHQ]LRQL
&RQYHQ]LRQH WUD O¶8QLYHUVLWj GHJOL 6WXGL GL 3DUPD H O¶$]LHQGD 86/ GL 3DUPD SHU OR VYLOXSSR GL DWWLYLWj GL
GLGDWWLFD H GL ULFHUFD LQ PDWHULD RUWRJHULDWULFD SUHVVR O¶8QLWj 2SHUDWLYD GL 2UWRSHGLD H 7UDXPDWRORJLD
GHOO¶2VSHGDOHGL)LGHQ]D6DQ6HFRQGR3DUPHQVH
&RQYHQ]LRQH WUD O¶8QLYHUVLWj GHJOL 6WXGL GL 3DUPD OD )RQGD]LRQH 'RQ &DUOR *QRFFKL 2QOXV GL 0LODQR
O¶$]LHQGD 2VSHGDOLHUR8QLYHUVLWDULD GL 3DUPD H O¶$]LHQGD 86/ GL 3DUPD SHU O¶XWLOL]]D]LRQH WUDPLWH
O¶$]LHQGD GL ULIHULPHQWR GHOOD VWUXWWXUD DVVLVWHQ]LDOH &HQWUR ³6 0DULD GHL 6HUYL´ GHOOD )RQGD]LRQH 'RQ
&DUOR *QRFFKL FRQ VHGH LQ 3DUPD SHU OH DWWLYLWj DVVLVWHQ]LDOL HVVHQ]LDOL DOOR VYROJLPHQWR GHOOH IXQ]LRQL GL
GLGDWWLFDHULFHUFDLQGLYLGXDWHQHOO¶8QLWj2SHUDWLYDGL5LDELOLWD]LRQH&DUGLRYDVFRODUHGLWDOH&HQWUR
$FFRUGR GL 3URJUDPPD WUD O¶$]LHQGD 86/ GL 3DUPD O¶$]LHQGD 2VSHGDOLHUR8QLYHUVLWDULD GL 3DUPD
O¶8QLYHUVLWj GHJOL 6WXGL GL 3DUPD H OD )RQGD]LRQH 'RQ &DUOR *QRFFKL SHU OD UHDOL]]D]LRQH GL XQ ³&HQWUR
7HUULWRULDOHSHUODSUHYHQ]LRQHFDUGLRYDVFRODUHSULPDULDHVHFRQGDULD´
&RQWHVWRGLULIHULPHQWR
$QQR
&RQWHVWRGLULIHULPHQWR
,OVLVWHPDGHOOHUHOD]LRQLFRQO¶8QLYHUVLWjHODFROODERUD]LRQHWUD6HUYL]LR6DQLWDULR5HJLRQDOHHOH)DFROWjGL
0HGLFLQDH&KLUXUJLDSUHYHGHODYDORUL]]D]LRQHGHOO¶DSSRUWRGHOSHUVRQDOHGHO665DOOHDWWLYLWjIRUPDWLYH
(QWUR WDOH ORJLFD VL HYLGHQ]LD OD SDUWHFLSD]LRQH GHO SHUVRQDOH GHOO¶$]LHQGD 2VSHGDOLHUR8QLYHUVLWDULD GL
3DUPDDOO¶DWWLYLWjGLGDWWLFDSUHHSRVWODXUHDDWWUDYHUVRO¶DWWLYLWjGLGRFHQ]DHGLWXWRUDWR
3HUTXDQWRULJXDUGDLFRUVLGLODXUHDGHOOHSURIHVVLRQLVDQLWDULHDIURQWHGLQGRFHQWLXQLYHUVLWDULGL
FXL GL DOWUH )DFROWj SDUWHFLSDQR DOO¶DWWLYLWj GL GRFHQ]D FRQ LQFDULFR GL LQVHJQDPHQWR XIILFLDOH Q SURIHVVLRQLVWL GHO 665 GHOO¶$]LHQGD 2VSHGDOLHUR8QLYHUVLWDULD GL 3DUPD GHOO¶$]LHQGD 86/ GL
3DUPDGHOO¶$]LHQGD86/GL3LDFHQ]D
3DUWHFLSDQR DOO¶DWWLYLWj GL GRFHQ]D FRQ LQFDULFKL GL GLGDWWLFD LQWHJUDWLYD Q SURIHVVLRQLVWL GHO 665 GHOO¶$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGHOO¶$]LHQGD86/GL3DUPDGHOO¶$]LHQGD86/GL3LDFHQ]D
/H IXQ]LRQL GL WXWRUDWR VRQR VYROWH GD Q 7XWRU G¶DQQR GHOO¶$]LHQGD 2VSHGDOLHUR8QLYHUVLWDULD GL
3DUPDGHOO¶$]LHQGD8VOGL3DUPDGHOO¶$]LHQGD86/GL3LDFHQ]DFXLVLDJJLXQJRQRSURIHVVLRQLVWL
FRQIXQ]LRQLGL7XWRUSHULOWLURFLQLRFOLQLFR
$VVXPRQR IXQ]LRQH GL FRRUGLQDPHQWR R GLUH]LRQH GL FRUVR FRRUGLQDWRUL WHRULFRSUDWLFL GL FXL GHOOD
QRVWUD$]LHQGDGHOO¶$XVOGL3DUPDHGHOO¶$XVOGL3LDFHQ]D
5HODWLYDPHQWHDLFRUVLGLODXUHDGHOOHSURIHVVLRQLPHGLFKHIDQQRSDUWHGHOFRUSRGRFHQWHSURIHVVLRQLVWL
GHO 665 GL FXL GHOO¶$]LHQGD 2VSHGDOLHUR8QLYHUVLWDULD GL 3DUPD H GHOO¶$]LHQGD 86/ GL 3DUPD FRQ
LQFDULFKLGLGLGDWWLFDLQWHJUDWLYD
6L VHJQDOD LQROWUH LO SDUWLFRODUH DSSRUWR UHVR GDL SURIHVVLRQLVWL GHOO¶$]LHQGD 2VSHGDOLHUR8QLYHUVLWDULD GL
3DUPDQHOO¶DPELWRGHLSURFHVVLGLIRUPD]LRQHSRVWODXUHDGHJOLVSHFLDOL]]DQGL
1HOO¶DQQR DFFDGHPLFR Q GLULJHQWL RVSHGDOLHUL KDQQR VYROWR DWWLYLWj GL GRFHQ]D HWXWRUDWR
SHUOH6FXROHGL6SHFLDOL]]D]LRQHGL$UHD6DQLWDULD0HGLFR&KLUXUJLFD,OGHWWDJOLRYLHQHULSRUWDWRQHOFDS
GLTXHVWRYROXPHGHGLFDWRDOO¶,QWHJUD]LRQHWUDOHDWWLYLWjDVVLVWHQ]LDOLGLGLGDWWLFDHGLULFHUFD
,OFRQFRUVRGHOO¶$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGL3DUPDDOORVYLOXSSRGHLSHUFRUVLIRUPDWLYLSRVWODXUHD
VL UHDOL]]D DQFKH DWWUDYHUVR O¶DWWLYD]LRQH GL UDSSRUWL GL FROODERUD]LRQH FRQ DOWUH 8QLYHUVLWj SHU OR
VYROJLPHQWRGLDWWLYLWjGLGDWWLFKHLQWHJUDWLYH
1HOPHULWRVLHOHQFDQROHVHJXHQWLFRQYHQ]LRQL
o &RQYHQ]LRQHFRQO¶8QLYHUVLWjGHJOL6WXGLGL3DYLD6FXRODGLVSHFLDOL]]D]LRQHLQ&KLUXUJLDSHGLDWULFD
o &RQYHQ]LRQHFRQO¶8QLYHUVLWjGL)HUUDUD)DFROWjGL0HGLFLQDH&KLUXUJLD6FXRODGLVSHFLDOL]]D]LRQHLQ
*HQHWLFD0HGLFD
o &RQYHQ]LRQHFRQO¶8QLYHUVLWjGL3DGRYD)DFROWjGL0HGLFLQDH&KLUXUJLD6FXRODGLVSHFLDOL]]D]LRQHLQ
1HXURFKLUXUJLD
o &RQYHQ]LRQHFRQO¶8QLYHUVLWjGL)LUHQ]H)DFROWjGL0HGLFLQDH&KLUXUJLD6FXRODGLVSHFLDOL]]D]LRQHLQ
1HXURFKLUXUJLD
o 6HPSUH DL ILQL GL GLGDWWLFD LQWHJUDWLYD q VWDWD ULQQRYDWD OD FRQYHQ]LRQH FRQ OD )DFROWj GL )DUPDFLD
GHOO¶8QLYHUVLWj GHJOL 6WXGL GL 3DUPD SHU TXDQWR DWWLHQH OD 6FXROD GL VSHFLDOL]]D]LRQH LQ )DUPDFLD
2VSHGDOLHUD HG q DWWLYD OD FRQYHQ]LRQH FRQ O¶8QLYHUVLWj 6DFUR &XRUH GL 5RPD SHU TXDQWR DWWLHQH OD
6FXRODGLVSHFLDOL]]D]LRQHLQ)LVLFD0HGLFD
o /DUHWHGLUHOD]LRQLLQWHUFRUUHQWLWUDO¶$]LHQGDHOHDOWUH)DFROWjH6WUXWWXUHGHOO¶8QLYHUVLWjGHJOL6WXGLGL
3DUPD H FRQ YDULH )DFROWj H VWUXWWXUH GL DOWUH 8QLYHUVLWj q RULHQWDWD DOOD ILQDOLWj SUHYDOHQWH GL
DVVLFXUDUH OD FROODERUD]LRQH SHU LO FRPSOHWDPHQWR GHOOD IRUPD]LRQH DFFDGHPLFD H SURIHVVLRQDOH GHL
GLVFHQWL
o &RQDQDORJDILQDOLWjQHOSHULRGRDQWHFHGHQWHLOVRQRVWDWHVWLSXODWHFRQYHQ]LRQLFRQDWHQHL
QD]LRQDOLFKHSUHYHGRQRODPHVVDDGLVSRVL]LRQHGHOSHUVRQDOHHGHOOHVWUXWWXUHD]LHQGDOLSHULGLYHUVL
WLURFLQLGHJOLVWXGHQWLHGHLODXUHDWL'LTXHVWHVLWURYDQRLULIHULPHQWLQHLELODQFLGLPLVVLRQHGHJOLDQQL
SUHFHGHQWL $ FRPSOHWDUH LO TXDGUR GHOO¶RIIHUWD IRUPDWLYD UHODWLYD DL WLURFLQL H DG DOWUH IRUPH GL
GLGDWWLFDLQWHJUDWLYDQHOqVWDWDVWLSXODWDODFRQYHQ]LRQHFRQO¶8QLYHUVLWj7HOHPDWLFD(&DPSXV
GL1RYHGUDWH
1.3 La rete integrata dell’offerta regionale
Sulla base dei dati presenti nella banca dati regionale, è possibile fornire alcuni elementi utili a descrivere
il quadro generale in cui l’attività ospedaliera della provincia di Parma si colloca e con cui si confronta, al
fine di verificare i risultati raggiunti rispetto alle indicazioni contenute nella programmazione sanitaria.
Dall’analisi del tasso di ospedalizzazione standardizzato (esclusa la mobilità passiva extraregionale 2012)
emerge che la provincia di Parma, presenta nel triennio un trend in decremento attestandosi, nel corso
del 2013, su valori di 152 per mille abitanti (tabella 6 e grafico 1). Si registra infatti un decremento sia
sul regime di DH, che passa da 44 nel 2012 a 38 nel 2013, sia sulla degenza ordinaria con una
diminuzione di 10 punti. Per entrambi i regimi si osserva un valore superiore alla media regionale.
In merito all'attività di ricovero, è importante rilevare che tra le Aziende USL sul cui territorio insiste
l’Azienda ospedaliera, l’Ospedale di Parma è quello al quale ricorre la maggior quota di cittadini (il 57%
della popolazione parmigiana, tabelle 7 e 8) con un valore stabile rispetto all’anno precedente; l’attività di
ricovero erogata nelle strutture ospedaliere private della provincia di Parma rimane superiore (14%)
rispetto a quella rilevata a livello regionale dove rappresenta il 10% dei ricoveri (grafici 2 e 3). Inoltre,
dall’analisi dell’indice di dipendenza della popolazione dalle strutture ospedaliere (tabella 8), è possibile
desumere che la percentuale di cittadini che si rivolge a strutture extra provincia risulta più bassa (13%)
della media regionale (19%).
Tabella 6 Regime di ricovero: tasso di ospedalizzazione standardizzato per residenti nella
provincia di Parma, anni 2011-2013
Provincia di Parma
Anno
Degenza
ordinaria
Medie regionali
Day hospital
Med.
Chir.
Deg.
Ord. +
DH
Tot. Day
hospital
Degenza
ordinaria
Day hospital
Med.
Chir.
Tot. Day
hospital
Deg.
Ord. +
DH
2011
126
23
25
47
173
128
20
22
42
170
2012
128
20
24
44
172
125
19
19
38
164
2013
113
17
21
38
151
111
17
17
34
146
Fonte: Banca dati Regione Emilia-Romagna.
Note: I dati sono comprensivi del 13° invio regionale.
Sono esclusi i neonati sani. Sono comprese le schede di mobilità passiva extraregionale 2012 in contestazione.
La popolazione tipo utilizzata per standardizzare i tassi è quella E.R. residente al 01/01/2010.
I tassi specifici sono stati calcolati utilizzando la popolazione E.R. residente al 01/01/2013.
Grafico 1 Regime di ricovero: tasso di ospedalizzazione standardizzato per residenti nella
provincia di Parma confronto con le altre province della regione, anni 2012-2013
178
2012
2013
1 72
165
165
1 65
164
16 0
15 5
155
151
151
147
13
RER anno 2013=146
CESENA
RIMINI
141
140
FORLI'
FERRARA
BOLOGNA
140
IMOLA
MODENA
REGGIO E.
PARMA
141
RAVENNA
14 3
14 2
1 47
1. Contesto di riferimento
161
155
152
PIACENZA
185
180
175
170
165
160
155
150
145
140
135
130
7DEHOOD5HJLPHGLULFRYHURLQGLFHGLGLSHQGHQ]DGHOODSRSROD]LRQHUHVLGHQWHD3DUPDGDOOH
VWUXWWXUHRVSHGDOLHUHDQQL
$QQR
ULFRYHULSUHVVR
SUHVLGL$86/GL
3DUPD
3XEEOLFR
3ULYDWR
ULFRYHUL
SUHVVR
SUHVLGL
$28GL
3DUPD
WRWDOH
ULFRYHUL
HQWUROD
SURYLQFLD
ULFRYHULLQ
DOWUHSURYLQFH
5(5
3XEEOLFR
3ULYDWR
ULFRYHUL
IXRUL
UHJLRQH
$112
WRWDOH
)RQWH%DQFDGDWL6'2ƒLQYLR
1RWH6RQRHVFOXVLGDOFDOFRORLQHRQDWLVDQL
6RQRFRPSUHVHOHVFKHGHGLPRELOLWjSDVVLYDH[WUDUHJLRQDOHLQFRQWHVWD]LRQH
7DEHOOD5HJLPHGLULFRYHURLQGLFHGLGLSHQGHQ]DGHOODSRSROD]LRQHUHVLGHQWHGDOOHVWUXWWXUH
RVSHGDOLHUHDQQRFRQIURQWR3DUPDH5(5
$86/
35
SXE
$86/
35
SULY
$28
35
$OWUH
$]
5(5
SXE
$OWUH
$]
5(5
SULY
$]
([WUD
5(5
$86/
SXE
$86/
SULY
$263
$OWUH
$]
5(5
SXE
$OWUH
$]
$]
([WUD
5(5
5(5
SULY
)RQWH%DQFDGDWL6'2ƒLQYLR
1RWH6RQRHVFOXVLGDOFDOFRORLQHRQDWLVDQL
6RQRFRPSUHVHOHVFKHGHGLPRELOLWjSDVVLYDH[WUDUHJLRQDOHLQFRQWHVWD]LRQH
*UDILFR5HJLPHGLULFRYHURLQGLFHGLGLSHQGHQ]DGHOODSRSROD]LRQHUHVLGHQWHD3DUPDGDOOH
VWUXWWXUHDQQR
$OWUHVWUXWWXUH
5(5SULYDWR
6WUXWWXUH([WUD
5(5
$86/35
SXEEOLFR
$OWUHVWUXWWXUH
5(5SXEEOLFR
$86/35
SULYDWR
&RQWHVWRGLULIHULPHQWR
$283DUPD
*UDILFR5HJLPHGLULFRYHURLQGLFHGLGLSHQGHQ]DGHOODSRSROD]LRQHUHVLGHQWHQHOODUHJLRQH
GDOOHVWUXWWXUHDQQR
$OWUH5(53ULYDWR
$OWUH5(5
3UXEEOLFR
$263
([WUD5(5
$86/SXE
$86/SULY
/D FDSDFLWj GL DWWUD]LRQH GL XQ RVSHGDOH YLHQH HVSUHVVD PHGLDQWH O¶LQGLFH GL GLSHQGHQ]D GHOOD 6WUXWWXUD
GDOOD SRSROD]LRQH /¶$]LHQGD 2VSHGDOLHUR8QLYHUVLWDULD GL 3DUPD QHO HYLGHQ]LD XQ WHQGHQ]LDOH OLHYH
GHFUHPHQWR GHOO¶LQGLFH GL DWWUD]LRQH ULVSHWWR DJOL DQQL SUHFHGHQWL 6L ULOHYD XQ GHFUHPHQWR GL SRFR SL
DFFHQWXDWR GHOOR VWHVVR LQGLFDWRUH QHO FRUVR GHO WULHQQLR UHODWLYDPHQWH DOOH DOWUH D]LHQGH RVSHGDOLHUH
GHOODUHJLRQHFKHSDVVDQRGDGLSD]LHQWLSURYHQLHQWLGDDOWUHUHJLRQLDVLYHGDQRODWDEHOOD
HLJUDILFLH
7DEHOOD5HJLPHGLULFRYHURLQGLFHGLGLSHQGHQ]DGHOOHVWUXWWXUHRVSHGDOLHUHGDOOD
SRSROD]LRQH±FRQIURQWR$283DUPDH$]LHQGHRVSHGDOLHUHGHOOD5(5DQQL
3RSROD]LRQHUHVLGHQWH
$QQR
$]LHQGH
RVSHGDOLHUHGL
ULFRYHUR
QHOGLVWUHWWR$86/
LQFXLqDOORFDWR
LQDOWURGLVWUHWWR
O¶RVSHGDOH
VWHVVD$86/
QHOWHUULWRULR
DOWUH$86/
5(5
IXRUL5(5
HHVWHUR
$2835
$2635(5
$2835
$2635(5
$2835
$2635(5
)RQWH%DQFD'DWL6'2GDOOHSDJLQHULVHUYDWHSHULO%G0
1RWHVRQRHVFOXVLLQHRQDWLVDQL
*UDILFR5HJLPHGLULFRYHURLQGLFHGLGLSHQGHQ]DGHOODVWUXWWXUDRVSHGDOLHUDGL3DUPDGDOOD
SRSROD]LRQHGHOODSURYLQFLDDQQR
3RSROD]LRQHUHVLGHQWHDPELWRWHUULWRULDOH$86/GL3DUPD
*UDILFR5HJLPHGLULFRYHURLQGLFHGLGLSHQGHQ]DGHOOHVWUXWWXUHRVSHGDOLHUHGHOODUHJLRQH
GDOODSRSROD]LRQHDQQR
3RSROD]LRQHUHVLGHQWHDPELWRWHUULWRULDOHUHJLRQDOH
'LVWUHWWR$86/$OWUR'LVWUHWWR $OWUH$]LHQGH )XRUL5(5HG
LQFXLq
VWHVVD$86/
86/5(5
(VWHUR
DOORFDWR
O¶2VSHGDOH
&RQWHVWRGLULIHULPHQWR
'LVWUHWWR$86/$OWUR'LVWUHWWR $OWUH$]LHQGH )XRUL5(5HG
LQFXLq
VWHVVD$86/
86/5(5
(VWHUR
DOORFDWR
O¶2VSHGDOH
Relativamente all’attività erogata in regime ambulatoriale (tabella 10 e grafici 6 e 7), per l’analisi dei
bisogni della popolazione, è stato scelto un indicatore sovrapponibile a quello utilizzato per i ricoveri:
l’indice di consumo (numero di prestazioni annuali per 1000 residenti) standardizzato per età, al fine di
consentire il confronto fra il dato provinciale e il dato complessivo regionale (non influenzato dalla diversa
distribuzione per età della popolazione). Complessivamente nel corso del 2013, in provincia di Parma, il
consumo di prestazioni ambulatoriali risulta uno dei più bassi a livello regionale con un valore
dell’indicatore di 12.049 prestazioni annue per 1000 residenti, decisamente inferiore a quello di
riferimento regionale (pari a 13.574 prestazioni).
Tabella 10 Attività specialistica ambulatoriale: tasso di consumo standardizzato per età per
residenti nella provincia di Parma e nella regione, anni 2011-2013
Anno
2011
2012
2013
Residenza
Diagnostica
Laboratorio
Riabilitazione
Prestazioni
terapeutiche
Visite
Totale
Totale escluso
laboratorio
PR
1.386
9.081
448
496
1.597
13.007
3.927
RER
1.526
11.087
437
475
1.499
15.025
3.938
PR
1.376
8.596
384
499
1.425
12.280
3.684
RER
1.465
10.753
413
457
1.356
14.444
3.691
PR
1.359
8.431
418
496
1.344
12.049
3.617
RER
1.398
10.044
404
441
1.288
13.574
3.531
Fonte: Banca dati ASA
Nota: Gli indici specifici sono stati calcolati utilizzando la popolazione E.R. residente al 01/01/2012
Sono inclusi i dati di mobilità passiva extraregionale 2012
Grafico 6 Attività specialistica ambulatoriale – tasso di consumo per provincia di residenza,
anno 2013
17.000
16.000
1 4971
1 437 2
15.000
14 840
139 12
14 224
1 4114
145 88
14.000
13.000
12.000
RER= 13.574
12 201
11.000
10.000
1 296 5
120 49
9.000
8 087
1. Contesto di riferimento
16
RIMINI
CE SEN A
FORLI'
RAVENNA
FERRARA
BOLOG NA
IMOLA
MODEN A
REGGIO
E.
PARMA
PIACENZA
8.000
Grafico 7 Attività specialistica ambulatoriale – tasso di consumo per provincia di residenza –
totale escluso laboratorio, anno 2013
5.500
5.000
4.500
4 206
3859
4.000
392 6
374 4
403 3
356 1
3.500
3.000
32 82
RER= 3.531
368 4
34 75
35 06
2896
2.500
RIMINI
CESENA
FORLI'
RAVEN NA
FERRARA
BOLOG NA
IMOLA
MODE NA
REGG IO
E.
PARMA
PIACE NZA
2.000
Dall'analisi dell'indice di dipendenza della popolazione (tabella 11), si evince che i parmigiani si rivolgono
in modo significativo all'Azienda Ospedaliero-Universitaria del capoluogo di provincia, che ha erogato, nel
2013, il 39,2% delle prestazioni ambulatoriali fruite dai residenti (escluso l’assorbimento dei punti
prelievo dell’Azienda Usl). Il dato medio regionale mostra invece un andamento in cui le Aziende Usl
emergono come i maggiori erogatori a favore dei cittadini residenti (64,9% delle prestazioni).
Un altro indicatore di particolare interesse è l'indice di dipendenza dell'Azienda Ospedaliero-Universitaria
dalla popolazione, dal quale si evince che l'AOU di Parma eroga più del 50% delle prestazioni ai cittadini
residenti nello stesso distretto (tabella 12 e grafico 10).
Tabella 11 Attività specialistica ambulatoriale: indice di dipendenza della popolazione
residente dalle strutture ospedaliere, anni 2011-2013
Anno
2011
2012
2013
Stessa
Azienda
USL
49,7
3,4
Fuori RER ed
Estero
(anno 2012)
4,8
RER
65,4
22,5
7,1
5,1
PR
51,2
39,9
3,1
5,8
RER
64,5
22,3
7,4
5,9
Residenza
PR
Azienda ospedaliera
che insiste sul
territorio
42,1
Altre Aziende
RER
PR
52,5
39,2
2,9
5,4
RER
64,9
21,5
7,5
6,1
Grafico 8 Attività specialistica ambulatoriale: indice di dipendenza residenti nella provincia di
Parma, anno 2013
Altre Aziende
RER
Fuori RER ed
Estero
Stessa Azi enda
AUSL
Azienda
Ospedaliera ch e
ins iste sul
territorio
17
1. Contesto di riferimento
Fonte: Banca dati ASA (dalle pagine riservate per il BdM)
La voce "Altre Aziende R.E.R." comprende anche II.OO.R.
Nota: Non sono disponibili i dati di mobilità passiva per l'anno corrente. Sono stati utilizzati i dati dell'anno 2012
*UDILFR$WWLYLWjVSHFLDOLVWLFDDPEXODWRULDOHLQGLFHGLGLSHQGHQ]DUHVLGHQWL5(5DQQR
)XRUL5(5HG
(VWHUR
$OWUH$]LHQGH5(5
$]LHQGD
2VSHGDOLHUDFKH
LQVLVWHVXO
WHUULWRULR
6WHVVD$]LHQGD
$86/
7DEHOOD$WWLYLWjVSHFLDOLVWLFDDPEXODWRULDOHLQGLFHGLGLSHQGHQ]DGHOO¶$]LHQGD2VSHGDOLHUR
8QLYHUVLWDULDGL3DUPDHGHOOH$]LHQGHRVSHGDOLHUHGHOODUHJLRQHGDOODSRSROD]LRQHDQQL
WXWWHOHSUHVWD]LRQL
3RSROD]LRQHUHVLGHQWH
$QQR
$]LHQGH
2VSHGDOLHUH
GLULFRYHUR
'LVWUHWWR$86/LQ
FXLqDOORFDWR
O¶2VSHGDOH
$OWURGLVWUHWWR
$OWUH$86/
)XRUL5(5
VWHVVD$86/
5(5
H(VWHUR
$2835
$2635(5
$2835
$2635(5
$2835
$2635(5
)RQWH%DQFD'DWL$6$GDOOHSDJLQHULVHUYDWHSHULO%G06RQRFRPSUHVHOHSUHVWD]LRQLGLODERUDWRULR
*UDILFR$WWLYLWjVSHFLDOLVWLFDDPEXODWRULDOHLQGLFHGLGLSHQGHQ]DGHOO¶$]LHQGD2VSHGDOLHUR
8QLYHUVLWDULDGL3DUPDGDOODSRSROD]LRQHDQQR
&RQWHVWRGLULIHULPHQWR
3RSRO D] LRQHUHVLGHQWHDPEL WRW HUULW RULDOH$86/GL3DUPD
'LV WUHWW R$8 6 /LQ
FXL q DOORFDW R
O¶2V SHGDOH
$OW UR 'LV WUHWW R $ OWUH$] LHQG H 86 /
VW HVVD$ 8 6/
)XRUL 5(5 HG
5( 5
(VW HUR
*UDILFR$WWLYLWjVSHFLDOLVWLFDDPEXODWRULDOHLQGLFHGLGLSHQGHQ]DGHOOHD]LHQGHGHOOD5(5
GDOODSRSROD]LRQHDQQR
3RSROD]LRQHUHVLGHQWHDPELWRWHUULWRULDOHUHJLRQDOH
'LVWUHWWR$86/LQ $OWUR'LVWUHWWR
FXLqDOORFDWR
VWHVVD$86/
O¶2VSHGDOH
$OWUH$]LHQGH
86/5(5
)XRUL5(5HG
(VWHUR
$FFRUGLGLIRUQLWXUD
1HO FRUVR GHO VRQR VWDWL VWLSXODWL DFFRUGL GL PRELOLWj H[WUDSURYLQFLDOL FRQ OH $]LHQGH 86/ GHOOD
5HJLRQH(PLOLD5RPDJQDIRUPDOL]]DWLJHQHUDOPHQWHVXOODEDVHGHOOH³/LQHHJXLGDSHUJOLDFFRUGLHFRQRPLFL
VX PRELOLWj DWWLYD H[WUDSURYLQFLDOH GHOOH $]LHQGH RVSHGDOLHUH´ WUDVPHVVH GDOOD 'LUH]LRQH *HQHUDOH DOOD
6DQLWjH3ROLWLFKH6RFLDOLGHOOD5HJLRQH(PLOLD5RPDJQD
/H LQGLFD]LRQL FRQWHQXWH QHOOH OLQHH JXLGD LQ RVVHUYDQ]D GHOOD '*5 IDQQR ULIHULPHQWR
DOO¶REEOLJDWRULHWj GL SUHYHGHUH DFFRUGL WUD D]LHQGH HURJDWULFL GL SUHVWD]LRQL VDQLWDULH HG D]LHQGH
FRPPLWWHQWL SHU YROXPL GL VFDPELR UHODWLYL DOO¶DWWLYLWj GL ULFRYHUR /¶$]LHQGD 2VSHGDOLHUR8QLYHUVLWDULD GL
3DUPDKDSURFHGXWRDGHIIHWWXDUHJOLDFFRUGLGLIRUQLWXUDFRQOH$86/UHJLRQDOLFDUDWWHUL]]DWHGDVFDPEL
VXSHULRULDOWHWWRGHL¼LQOLQHDFRQTXDQWRSUHYLVWRGDOOD'*5
2VVHUYD]LRQLHSLGHPLRORJLFKH
,O PRGHOOR KXE DQG VSRNH UDSSUHVHQWD XQD PRGDOLWj GL SURGX]LRQH H GLVWULEX]LRQH GHOO¶DVVLVWHQ]D
RVSHGDOLHUD VHFRQGR LO SULQFLSLR GHOOH 5HWL LQWHJUDWH FKH SUHYHGH OD FRQFHQWUD]LRQH GHOOD FDVLVWLFD SL
FRPSOHVVDRFKHQHFHVVLWDGLSLFRPSOHVVLVLVWHPLSURGXWWLYLLQXQQXPHUROLPLWDWRGLFHQWULKXE
*OL KXE WUDWWDQR YROXPL GL DWWLYLWj WDOL GD JDUDQWLUH OD PLJOLRU TXDOLWj GHOO¶DVVLVWHQ]D HURJDWD H LO PLJOLRU
XWLOL]]R GHOOH ULVRUVH RUJDQL]]DWLYH GLVSRQLELOL /¶DWWLYLWj GL WDOL FHQWUL q IRUWHPHQWH LQWHJUDWD DWWUDYHUVR
FRQQHVVLRQL IXQ]LRQDOL FRQ TXHOOD GHL FHQWULRVSHGDOLHUL SHULIHULFL VSRNH FKHDVVLFXUDQR O¶DVVLVWHQ]D SHU
OD FDVLVWLFD UHVLGXD 4XHVWR PRGHOOR RUJDQL]]DWLYR DGRWWDWR GDOOD 5HJLRQH (PLOLD5RPDJQD FRQ LO SLDQR
VDQLWDULR'*5QULFRQRVFHDOO¶$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGL3DUPD
XQD YDOHQ]D GL SROR GL ƒ OLYHOOR KXE LQ TXDQWR FHQWUR GL SURGX]LRQH GL VHUYL]L VDQLWDUL DG DOWD
VSHFLDOL]]D]LRQH SHU OD FXUD GHL SD]LHQWL OD FXL SDWRORJLD ULFKLHGH LQWHUYHQWL WHFQLFDPHQWH GL DOWD
FRPSOHVVLWj
1HOODWDEHOODVHJXHQWHVRQRULSRUWDWHOHUHWLXIILFLDOPHQWHULFRQRVFLXWHGDOOD5HJLRQH(PLOLD5RPDJQDDOOH
TXDOL O¶$]LHQGD 2VSHGDOLHUR8QLYHUVLWDULD GL 3DUPD FRQWULEXLVFH DWWUDYHUVR O¶DWWLYLWj GL IXQ]LRQL KXE GL
ULIHULPHQWRSHUXQDPSLREDFLQRG¶XWHQ]DSUHYDOHQWHPHQWHGHOO¶DUHDYDVWD(PLOLDQRUG3LDFHQ]D3DUPD
5HJJLR(PLOLDH0RGHQD
&RQWHVWRGLULIHULPHQWR
$WWLYLWjKXE
7DEHOOD8QLWj2SHUDWLYHGHOO
$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGL3DUPDDIIHUHQWLDOOH5HWL
KXEVSRNHGHOOD5HJLRQH(PLOLD5RPDJQDHUHODWLYLEDFLQLG
XWHQ]D
hŶŝƚăKƉĞƌĂƚŝǀĞ
,ƵďKhWĂƌŵĂ
ĂĐŝŶŽĚΖƵƚĞŶnjĂƐĞĐŽŶĚŽ'ZŶ͘ϭϮϲϳĚĞůůƵŐůŝŽϮϬϬϮĞĞůŝďĞƌĂnjŝŽŶŝ
ƐƵĐĐĞƐƐŝǀĞ
/ů ďĂĐŝŶŽ ĚΖƵƚĞŶnjĂ ğ ŶĂnjŝŽŶĂůĞ͘ ƐŝƐƚĞ ŝŶĨĂƚƚŝ ƵŶĂ ůŝƐƚĂ ĚΖĂƚƚĞƐĂ ƵŶŝĐĂ
EĞĨƌŽůŽŐŝĂ͕ůŝŶŝĐĂ
ƌĞŐŝŽŶĂůĞƉĞƌŝdƌĂƉŝĂŶƚŝZĞŶĂůŝĚĂĚŽŶĂƚŽƌĞĐĂĚĂǀĞƌĞ͕ĐŽŽƌĚŝŶĂƚĂĚĂů
ŚŝƌƵƌŐŝĐĂĞdƌĂƉŝĂŶƚŝ
ĞŶƚƌŽZŝĨĞƌŝŵĞŶƚŽdƌĂƉŝĂŶƚŝĚĞůůĂZZ͕ĂĐƵŝĂĨĨĞƌŝƐĐŽŶŽƌĞƐŝĚĞŶƚŝĞ
ĚΖKƌŐĂŶŽ
ŶŽŶ ĚĞůůĂ ZĞŐŝŽŶĞ͘ >Ğ ŝƐĐƌŝnjŝŽŶŝ ŝŶ ůŝƐƚĂ ƉƌĞƐƐŽ ŝů ĞŶƚƌŽ dƌĂƉŝĂŶƚŝ Ěŝ
dƌĂƉŝĂŶƚŝKƌŐĂŶŽ
;ZĞŶĞͲZĞŶĞĞWĂŶĐƌĞĂƐͲ ZŝĂŶŝŵĂnjŝŽŶĞ
WĂƌŵĂ͕ƐŽŶŽĂůϯϭͬϭϮͬϮϬϭϮ;ƵůƚŝŵŽĚĂƚŽĚŝƐƉŽŶŝďŝůĞͿϯϳϴĚŝĐƵŝϯϴй
ƌĞƐŝĚĞŶƚŝŝŶŵŝůŝĂZŽŵĂŐŶĂĞĚŝůϲϮйĨƵŽƌŝƌĞŐŝŽŶĞ͘/ůĚĂƚŽƌĞŐŝŽŶĂůĞ
ZĞŶĞĚĂǀŝǀĞŶƚĞͿ
ŵĂƚŽůŽŐŝĂĞ͘d͘D͘K͘
ĂůϯϭͬϭϮͬϮϬϭϮĞĚŝϭϭϳϭƉĂnjŝĞŶƚŝĚŝĐƵŝŝůϰϰйƌĞƐŝĚĞŶƚŝĞŝůϱϲйĨƵŽƌŝ
ƌĞŐŝŽŶĞ͘ >͛Kh Ěŝ WĂƌŵĂ ğ ĞŶƚƌŽ Ěŝ ƌŝĨĞƌŝŵĞŶƚŽ ƉĞƌ ŝ ƚƌĂƉŝĂŶƚŝ Ěŝ
;DŝĚŽůůŽŽƐƐĞŽͿ
ƌĞŶĞ͕ƌĞŶĞͲƉĂŶĐƌĞĂƐĞŵŝĚŽůůŽŽƐƐĞŽ͘
ůů͛ŝŶƚĞƌŶŽĚĞůůĂZĞƚĞŝŶƚĞŐƌĂƚĂZĞŐŝŽŶĂůĞƉĞƌůĂdĞƌĂƉŝĂĚĞůůĞ'ƌĂŶĚŝ
hƐƚŝŽŶŝ͕ Ɛŝ ŝŶƐĞƌŝƐĐĞ ůΖĂƚƚŝǀŝƚă ,h ĚĞů ŶŽƐƚƌŽ ĞŶƚƌŽ hƐƚŝŽŶŝ ŝů ĐƵŝ
ŝƉĂƌƚŝŵĞŶƚŽŵĞƌŐĞŶnjĂͲ ĂĐŝŶŽ ĚΖƵƚĞŶnjĂ ğ ƌĞůĂƚŝǀŽ ĂůůĞ ƉƌŽǀŝŶĐĞ Ěŝ W͕ WZ͕ Z͕ DK Ğ Ɛŝ
dĞƌĂƉŝĂĚĞůůĞ'ƌĂŶĚŝ
ĞŶƚƌŽhƐƚŝŽŶŝ
hƌŐĞŶnjĂ
ĐŽŵƉůĞƚĂ ŶĞů ^ŝƐƚĞŵĂ /ŶƚĞŐƌĂƚŽ Ěŝ ƐƐŝƐƚĞŶnjĂ Ăŝ dƌĂƵŵŝ ;^/dͿ͘ >Ă
hƐƚŝŽŶŝ
ĨƵŶnjŝŽŶĞĚŝĂƐƐŝƐƚĞŶnjĂĂŝ'ƌĂŶĚŝƵƐƚŝŽŶĂƚŝŶĞůů͛ĂŵďŝƚŽĚĞůůĂZĞŐŝŽŶĞğ
ƉƌĞƐĞŶƚĞƐŽůŽĂWĂƌŵĂĞĞƐĞŶĂ
>Ğ ĂƌĞĞ ƚĞƌƌŝƚŽƌŝĂůŝ ƐƵ ĐƵŝ ŝŶƐŝƐƚĞ ůΖĂƚƚŝǀŝƚă ,h ƉĞƌ ůĂ ĨƵŶnjŝŽŶĞ
ĂƌĚŝŽĐŚŝƌƵƌŐŝĂ͕
ĂƌĚŝŽĐŚŝƌƵƌŐŝĐĂ Ğ Ěŝ ĂƌĚŝŽůŽŐŝĂ ŝŶƚĞƌǀĞŶƚŝƐƚŝĐĂ Ğ ĚŝĂŐŶŽƐƚŝĐĂ ƐŽŶŽ
DĂůĂƚƚŝĞĂƌĚŝĂĐŚĞĞ ĂƌĚŝŽůŽŐŝĂ;ŵŽĚŝŶĂŵŝĐĂ ůƚƌĞhŶŝƚăKƉĞƌĂƚŝǀĞĚĞů
ƋƵĞůůĞ ĚĞůůĞ ƉƌŽǀŝŶĐĞ Ěŝ WZ Ğ W͘ ƚƚƌĂǀĞƌƐŽ ůĞ hŶŝƚă ŽƉĞƌĂƚŝǀĞ
ĂƌĚŝŽĐŚŝƌƵƌŐŝĂ
ŝĂŐŶŽƐƚŝĐĂͬ
ŝƉĂƌƚŝŵĞŶƚŽƵŽƌĞ
ĚĞůů͛ĂƌĞĂ ĐƵŽƌĞ ĚĞů ŝƉĂƌƚŝŵĞŶƚŽ ĂƌĚŝŽͲƉŽůŵŽŶĂƌĞ͕ ů͛ĂnjŝĞŶĚĂ ğ
/ŶƚĞƌǀĞŶƚŝƐƚŝĐĂͿ
ĐĞŶƚƌŽƌŝĐŽŶŽƐĐŝƵƚŽƉĞƌŝůƚƌĂƚƚĂŵĞŶƚŽĚĞůůĞŵĂůĂƚƚŝĞĐĂƌĚŝĂĐŚĞ͘
>Ğ ĨƵŶnjŝŽŶŝ ,Ƶď Ěŝ EĞƵƌŽĐŚŝƌƵƌŐŝĂ Ğ EĞƵƌŽƌĂĚŝŽůŽŐŝĂ͕ ŝŶƚĞŐƌĂƚĞ
ĨƵŶnjŝŽŶĂůŵĞŶƚĞ͕ ŚĂŶŶŽ ƵŶ ďĂĐŝŶŽ ĚΖƵƚĞŶnjĂ ĐŚĞ ĐŽŵƉƌĞŶĚĞ ůĞ
EĞƵƌŽĐŚŝƌƵƌŐŝĂ͕
ƉƌŽǀŝŶĐĞ Ěŝ WZ Ğ W Ğ Z͘ 'ĂƌĂŶƚŝƐĐŽŶŽ ů͛ĂƐƐŝƐƚĞŶnjĂ Ăŝ ƉĂnjŝĞŶƚŝ ĐŽŶ
EĞƵƌŽůŽŐŝĂ
EĞƵƌŽƐĐŝĞŶnjĞ
EĞƵƌŽƌĂĚŝŽůŽŐŝĂ
ƉĂƚŽůŽŐŝĞĚĞů^ŝƐƚĞŵĂŶĞƌǀŽƐŽĐĞŶƚƌĂůĞĞƉĞƌŝĨĞƌŝĐŽ͕ĐĂƌĂƚƚĞƌŝnjnjĂƚĞĚĂ
ďĂƐƐĂ ŝŶĐŝĚĞŶnjĂ͕ ĞůĞǀĂƚĂ ĐŽŵƉůĞƐƐŝƚă Ğ ŶĞĐĞƐƐŝƚă Ěŝ ƐƵƉƉŽƌƚŝ Ěŝ ĂůƚŽ
ĐŽŶƚĞŶƵƚŽƚĞĐŶŽůŽŐŝĐŽ͘
Kh Ěŝ WZD ŶĞů ƐƵŽ ĐŽŵƉůĞƐƐŽ͕ ŝŶ ƋƵĂŶƚŽ ƐĞĚĞ
ƌŝĐŽŶŽƐĐŝƵƚĂ Ěŝ ƵŶŽ ĚĞŝ ƚƌĞ ^ŝƐƚĞŵŝ /ŶƚĞŐƌĂƚŝ Ěŝ
ƐƐŝƐƚĞŶnjĂĂŝƉĂnjŝĞŶƚŝdƌĂƵŵĂƚŝnjnjĂƚŝ;^/dͿĚĞůůĂZZ͕
ƐƉĞĐŝĨŝĐĂŵĞŶƚĞƋƵĞůůŽĐŚĞĐŽƉƌĞŝƚĞƌƌŝƚŽƌŝĚĞůůΖŵŝůŝĂ /ů^ŝƐƚĞŵĂ/ŶƚĞŐƌĂƚŽĚŝƐƐŝƐƚĞŶnjĂĂŝ'ƌĂŶĚŝdƌĂƵŵŝ;^/dͿĚĞůůĂŵŝůŝĂ
dĞƌĂƉŝĂĚĞŝ'ƌĂŶĚŝ
ŶŽƌĚͲŽĐĐŝĚĞŶƚĂůĞ͘WĞƌĐŝĂƐĐƵŶ^/dƐŝƉƌĞǀĞĚĞŝŶĨĂƚƚŝ EŽƌĚͲŽĐĐŝĚĞŶƚĂůĞ ĐŚĞ ŚĂ ŝů ƐƵŽ ,h ŶĞůůΖnjŝĞŶĚĂ KƐƉĞĚĂůŝĞƌŽͲ
dƌĂƵŵŝ
ƵŶĐĞŶƚƌŽŐƵŝĚĂĚĞƚƚŽdZhDEdZŽ,hĐŽŶ hŶŝǀĞƌƐŝƚĂƌŝĂĚŝWĂƌŵĂ͕ĐŽƉƌĞŝƚĞƌƌŝƚŽƌŝĚŝW͕WZĞZ
ůĂ ƉƌĞƐĞŶnjĂ Ěŝ ƉƌŽĨĞƐƐŝŽŶĂůŝƚă ĐůŝŶŝĐŚĞ ;ŶŽŶ
ŶĞĐĞƐƐĂƌŝĂŵĞŶƚĞ hŶŝƚă KƉĞƌĂƚŝǀĞͿ ĐŚĞ ŐĂƌĂŶƚŝƐĐĂŶŽ
ůĂƉƌĞƐĂŝŶĐĂƌŝĐŽĚĞůƉĂnjŝĞŶƚĞƚƌĂƵŵĂƚŝnjnjĂƚŽ
ZĞƚĞ
hŶŝƚăKƉĞƌĂƚŝǀĞ
^ƉŽŬĞKhWĂƌŵĂ
>͛Kh Ěŝ WĂƌŵĂ ğ ƉĂƌƚĞ ŝŶƚĞŐƌĂŶƚĞ ĚĞůůĂ ƌĞƚĞ ƉĞƌ ů͛ĂƐƐŝƐƚĞŶnjĂ
ŝŶƚĞŐƌĂƚĂ ĂůůĂ ƉĞƌƐŽŶĂ ĐŽůƉŝƚĂ ĚĂ /ĐƚƵƐ͘ dĂůĞ ƌĞƚĞ ŚĂ ů͛ŽďŝĞƚƚŝǀŽ Ěŝ
ƐƐŝƐƚĞŶnjĂŝŶƚĞŐƌĂƚĂ njŝĞŶĚĂ KƐƉĞĚĂůŝĞƌŽͲhŶŝǀĞƌƐŝƚĂƌŝĂ Ěŝ WĂƌŵĂ ƋƵĂůĞ
ƌŝĚƵƌƌĞŵŽƌƚĂůŝƚăĞĚŝƐĂďŝůŝƚăĚŽƉŽů͛ĞǀĞŶƚŽĂĐƵƚŽ͘/ĞŶƚƌŝ,hƐŽŶŽŝ
ĂůůĂƉĞƌƐŽŶĂĐŽůƉŝƚĂ ĞŶƚƌŽ ĂƵƚŽƌŝnjnjĂƚŽ Ăůů͛ƵƚŝůŝnjnjŽ ĚĞůůĂ ƚĞƌĂƉŝĂ
ĐĞŶƚƌŝĂƵƚŽƌŝnjnjĂƚŝĂůů͛ƵƚŝůŝnjnjŽĚĞůůĂƚĞƌĂƉŝĂƚƌŽŵďŽůŝƚŝĐĂĞƐŽŶŽŝƐƚŝƚƵŝƚŝ
ĚĂ/ĐƚƵƐ
ƚƌŽŵďŽůŝƚŝĐĂ
ƉƌĞƐƐŽ ůĞ hŶŝƚă KƉĞƌĂƚŝǀĞ Ěŝ EĞƵƌŽůŽŐŝĂ Ěŝ ŶƵŵĞƌŽƐŝ ŽƐƉĞĚĂůŝ ĚĞůůĂ
ZĞŐŝŽŶĞƚƌĂĐƵŝŝůŶŽƐƚƌŽ͘
dĞƌĂƉŝĂ/ŶƚĞŶƐŝǀĂ
EĞŽŶĂƚĂůĞ
dĞƌĂƉŝĂ/ŶƚĞŶƐŝǀĂ
EĞŽŶĂƚĂůĞ
&RQWHVWRGLULIHULPHQWR
^ŝƐƚĞŵĂ
dƌĂƐĨƵƐŝŽŶĂůĞͲWŝĂŶŽ ^ĂŶŐƵĞ
>͛ƐƐŝƐƚĞŶnjĂŝŶƚĞŶƐŝǀĂƉĞƌŝŶĂƚĂůĞĞƉĞĚŝĂƚƌŝĐĂĨŝŶĂůŝnjnjĂƚĂĂůůĂƌŝĚƵnjŝŽŶĞ
ĚĞůůĂ ŵŽƌƚĂůŝƚă ƉĞƌŝŶĂƚĂůĞ Ğ ŝŶĨĂŶƚŝůĞ ğ ŐĂƌĂŶƚŝƚĂ ĚĂů ĞŶƚƌŽ ŚƵď Ěŝ
dĞƌĂƉŝĂ ŝŶƚĞŶƐŝǀĂ ŶĞŽŶĂƚĂůĞ͘ /ů ďĂĐŝŶŽ ĚΖƵƚĞŶnjĂ ğ ƌĞůĂƚŝǀŽ ĂůůĞ
ƉƌŽǀŝŶĐĞĚŝWĂƌŵĂĞWŝĂĐĞŶnjĂ͘
^ĞƌǀŝnjŝŽ
/ŵŵƵŶŽƚƌĂƐĨƵƐŝŽŶĂůĞ
'ĞŶĞƚŝĐĂDĞĚŝĐĂͲ
>͛ĂƐƉĞƚƚŽ ƚĞĐŶŽůŽŐŝĐŽ ƋƵĂůŝƚĂƚŝǀĂŵĞŶƚĞ ĞůĞǀĂƚŽ͕ ;ůĂďŽƌĂƚŽƌŝ Ěŝ
>ĂďŽƌĂƚŽƌŝĚŝŝƚŽŐĞŶĞƚŝĐĂ
'ĞŶĞƚŝĐĂ ŵŽůĞĐŽůĂƌĞͿ͕ ĐŽŶĨĞƌŝƐĐĞ Ăůů͛njŝĞŶĚĂ ƵŶ ƌƵŽůŽ ,Ƶď ƉĞƌ ůĂ
Ͳ^ĞƌǀŝnjŝĐůŝŶŝĐŝĚŝ'ĞŶĞƚŝĐĂ
ĚŝĂŐŶŽƐŝĚŝŵĂůĂƚƚŝĞƌĂƌĞ͕ĂƚƚƌĂǀĞƌƐŽůĂƐƚƌƵƚƚƵƌĂĚŝ'ĞŶĞƚŝĐĂŵĞĚŝĐĂ͕
DĞĚŝĐĂĞĚŝ'ĞŶĞƚŝĐĂ
ŝůĐƵŝďĂĐŝŶŽƚĞƌƌŝƚŽƌŝĂůĞƐŝĞƐƚĞŶĚĞĂůůĞƉƌŽǀŝŶĐĞĚŝWĞWZ͘
KŶĐŽůŽŐŝĐĂ
^ĞƌǀŝnjŝĚŝ'ĞŶĞƚŝĐĂ
DĞĚŝĐĂ
'ĞŶĞƚŝĐĂDĞĚŝĐĂͲ
>ĂďŽƌĂƚŽƌŝĚŝ'ĞŶĞƚŝĐĂ
DŽůĞĐŽůĂƌĞ
^ŝƐƚĞŵĂĞŶƚƌĂůŝ
KƉĞƌĂƚŝǀĞ;ϭϭϴͿ͕
ŵĞƌŐĞŶnjĂ
dĞƌƌŝƚŽƌŝĂůĞ
>Ă ƌĞƚĞ ğ ĐŽƐƚŝƚƵŝƚĂ ĚĂůůĂ 'ƵĂƌĚŝĂ DĞĚŝĐĂ͕ ĚĂů ϭϭϴ Ğ ĚĂů WƌŽŶƚŽ
ŝƉĂƌƚŝŵĞŶƚŽŵĞƌŐĞŶnjĂͲ
^ŽĐĐŽƌƐŽ͕ Ğ ĐŽŵƉƌĞŶĚĞ ƚƵƚƚĞ ůĞ ƐƐŽĐŝĂnjŝŽŶŝ Ěŝ ǀŽůŽŶƚĂƌŝĂƚŽ
hƌŐĞŶnjĂ
ŝŵƉĞŐŶĂƚĞ ĐŽŶ ůĞ ƉƌŽƉƌŝĞ ĂŵďƵůĂŶnjĞ ŶĞůůĂ ƉƵďďůŝĐĂ ĂƐƐŝƐƚĞŶnjĂ͘ /ů
ďĂĐŝŶŽĚΖƵƚĞŶnjĂğůĂƉƌŽǀŝŶĐŝĂĚŝWĂƌŵĂ
hŶŝƚăKƉĞƌĂƚŝǀĞ
,ƵďKhWĂƌŵĂ
ůƚĞƐƉĞĐŝĂůŝƚăƌŝĂďŝůŝƚĂƚŝǀĞ͗
hŶŝƚăKƉĞƌĂƚŝǀĞ
^ƉŽŬĞKhWĂƌŵĂ
ZĞƚĞ
ZŝĂďŝůŝƚĂnjŝŽŶĞŐƌĂǀŝ
ŵŝĞůŽůĞƐŝŽŶŝ
ZŝĂďŝůŝƚĂnjŝŽŶĞŐƌĂǀŝ
ĐĞƌĞďƌŽůĞƐŝŽŶŝ
ĂĐƋƵŝƐŝƚĞ
ZŝĂďŝůŝƚĂnjŝŽŶĞŐƌĂǀŝ
ĚŝƐĂďŝůŝƚă
ŶĞƵƌŽŵŽƚŽƌŝĞĞƚă
ĞǀŽůƵƚŝǀĂ
DĞĚŝĐŝŶĂZŝĂďŝůŝƚĂƚŝǀĂ
DĞĚŝĐŝŶĂZŝĂďŝůŝƚĂƚŝǀĂ
ĞŶƚƌŽ^ƉŝŶĂŝĨŝĚĂ
ĂĐŝŶŽĚΖƵƚĞŶnjĂƐĞĐŽŶĚŽ'ZŶ͘ϭϮϲϳĚĞůůƵŐůŝŽϮϬϬϮĞĞůŝďĞƌĂnjŝŽŶŝ
ƐƵĐĐĞƐƐŝǀĞ
>͛njŝĞŶĚĂKƐƉĞĚĂůŝĞƌŽͲhŶŝǀĞƌƐŝƚĂƌŝĂĚŝWĂƌŵĂĞŶƚƌĂŶĞůůĂƌĞƚĞŝŶƚĞŐƌĂƚĂ
ĚĞŝ ƐĞƌǀŝnjŝ ĂŶĐŚĞ ĐŽŶ ĨƵŶnjŝŽŶĞ Ěŝ ϮΣ ůŝǀĞůůŽ ;ƐƉŽŬĞͿ͕ ƌĞůĂƚŝǀĂŵĞŶƚĞ ĂůůĂ
ƌŝĂďŝůŝƚĂnjŝŽŶĞ ĚĞůůĞ ƉĞƌƐŽŶĞ ĐŽŶ ŐƌĂǀĞ ĐĞƌĞďƌŽůĞƐŝŽŶĞ ĂĐƋƵŝƐŝƚĂ
;ƉƌŽŐĞƚƚŽ 'ZZͿ Ğ ĚĞůůĞ ƉĞƌƐŽŶĞ ĂĨĨĞƚƚĞ ĚĂ ŐƌĂǀŝ ŵŝĞůŽůĞƐŝŽŶŝ͕
ĨƵŶnjŝŽŶĞƌĞĂůŝnjnjĂƚĂĚĂƐƚƌƵƚƚƵƌĞƌŝĂďŝůŝƚĂƚŝǀĞĚŝƚŝƉŽŝŶƚĞŶƐŝǀŽ;DĞĚŝĐŝŶĂ
ZŝĂďŝůŝƚĂƚŝǀĂͿ͘/ŶŽůƚƌĞ͕ƉĂƌƚĞĐŝƉĂƋƵĂůĞWŽůŽƚĞĐŶŽůŽŐŝĐŽŵƵůƚŝĨƵŶnjŝŽŶĂůĞ
;ĞŶƚƌŝ ,ͬ^Ϳ ƉĞƌ ůĞ ĚŝƐĂďŝůŝƚă ŝŶĨĂŶƚŝůŝ͕ ĂůůĂ ƉƌĞƐĂ ŝŶ ĐĂƌŝĐŽ ĚĞůůĞ ŐƌĂǀŝ
ĚŝƐĂďŝůŝƚă ŵŽƚŽƌŝĞ ĚĞůů͛Ğƚă ĞǀŽůƵƚŝǀĂ ĂƚƚƌĂǀĞƌƐŽ ŝů ĞŶƚƌŽ ƌĞŐŝŽŶĂůĞ ƉĞƌ
ůĂ^ƉŝŶĂŝĨŝĚĂ͘
DĂůĂƚƚŝĞZĂƌĞ͗ů͛KhĚŝWĂƌŵĂğŝŶƐĞƌŝƚĂŶĞůůĂƌĞƚĞƌĞŐŝŽŶĂůĞƉĞƌů͛ĂƐƐŝƐƚĞŶnjĂĚĞůůĞŵĂůĂƚƚŝĞƌĂƌĞ͕ĂƚƚƌĂǀĞƌƐŽŝĞŶƚƌŝĚŝƌŝĨĞƌŝŵĞŶƚŽŝĚĞŶƚŝĨŝĐĂƚŝĚĂůůĂ
ZĞŐŝŽŶĞŵŝůŝĂͲZŽŵĂŐŶĂƉĞƌůĂĚŝĂŐŶŽƐŝĞůĂĐƵƌĂĚĞůůĞŵĂůĂƚƚŝĞƌĂƌĞ;ů͛ĞůĞŶĐŽŶĂnjŝŽŶĂůĞŶĞƉƌĞǀĞĚĞĐŝƌĐĂϲϬϬͿ
>ĂƌĞƚĞƉĞƌ
ůΖĂƐƐŝƐƚĞŶnjĂĂ
ďĂŵďŝŶŝĞ
ĂĚŽůĞƐĐĞŶƚŝĐŽŶ
ŵĂůĂƚƚŝĂƌĂƌĂ
dƌĂƐǀĞƌƐĂůĞƐƵůůĞhŶŝƚă
KƉĞƌĂƚŝǀĞĂƵƚŽƌŝnjnjĂƚĞĂůůĂ
ŐĞƐƚŝŽŶĞĞƉƌĞƐĂŝŶĐĂƌŝĐŽ
ĚĞůůĞƉĂƚŽůŽŐŝĞƌĂƌĞ
ƉĞĚŝĂƚƌŝĐŚĞ;ĚŝĐƵŝ
Ăůů͛ĂůůĞŐĂƚŽĚĞůůĂ'Z
ϭϴϵϳͬϮϬϭϭͿ
ŵŽĨŝůŝĂĞDĂůĂƚƚŝĞ
ŵŽƌƌĂŐŝĐŚĞ
ŽŶŐĞŶŝƚĞ
ĞŶƚƌŽŵŽƐƚĂƐŝ͕
hKDĞĚŝĐŝŶĂ/ŶƚĞƌŶĂ
ĂĚ/ŶĚŝƌŝnjnjŽ
ŶŐŝŽůŽŐŝĐŽͲ
ŽĂŐƵůĂƚŝǀŽ
&ŝďƌŽƐŝŝƐƚŝĐĂ
ůŝŶŝĐĂWĞĚŝĂƚƌŝĐĂͲ
^ƚƌƵƚƚƵƌĂ^ĞŵƉůŝĐĞƉĞƌ
ůĂ&ŝďƌŽƐŝŝƐƚŝĐĂ
ŝƉĂƌƚŝŵĞŶƚŽdĞƐƚĂͲŽůůŽ
;h͘K͘KZ>Ϳ
^ĐŝĞŶnjĞZĂĚŝŽůŽŐŝĐŚĞ
WĂƚŽůŽŐŝĂĞDĞĚŝĐŝŶĂĚŝ
>ĂďŽƌĂƚŽƌŝŽ
ůŝŶŝĐĂWŶĞƵŵŽůŽŐŝĐĂ
^ŝŶĚƌŽŵĞĚŝ
DŽĞďŝƵƐ
ŝƉĂƌƚŝŵĞŶƚŽdĞƐƚĂͲ
ŽůůŽ;h͘K͘/
ŚŝƌƵƌŐŝĂDĂdžŝůůŽͲ
&ĂĐĐŝĂůĞͿ
&RQWHVWRGLULIHULPHQWR
EĞůϮϬϭϭ;͘'͘Z͘ϯϲϰϬͬϮϬϭϭͿǀŝĞŶĞĂŐŐŝŽƌŶĂƚĂůĂƌĞƚĞƌĞŐŝŽŶĂůĞƉĞƌůĂ
ƉƌĞǀĞŶnjŝŽŶĞ͕ ƐŽƌǀĞŐůŝĂŶnjĂ͕ ĚŝĂŐŶŽƐŝ Ğ ƚĞƌĂƉŝĂ ĚĞůůĞ ŵĂůĂƚƚŝĞ ƌĂƌĞ Ğ
ů͛KhĚŝWĂƌŵĂ͕&ĂĐĐŝĂůĞǀŝĞŶĞŝŶĚŝǀŝĚƵĂƚĂĐŽŵĞĞŶƚƌŽĂƵƚŽƌŝnjnjĂƚŽƉĞƌ
ů͛ƌĞĂsĂƐƚĂŵŝůŝĂEŽƌĚ;sEͿ
>Ă'ZϭϴϵϳͬϮϬϭϭƐƚĂďŝůŝƐĐĞůĂƌĞĂůŝnjnjĂnjŝŽŶĞĚĞůůĂƌĞƚĞĚŝĂƐƐŝƐƚĞŶnjĂĂŝ
ƉĂnjŝĞŶƚŝĐŽŶŵĂůĂƚƚŝĞƌĂƌĞŝŶĞƚăĞǀŽůƵƚŝǀĂĚŝĐƵŝĨŽƌŶŝƐĐĞƵŶĚĞƚƚĂŐůŝĂƚŽ
ĞůĞŶĐŽ͕ ƉĞƌ ůĞ ƋƵĂůŝ ů͛Kh Ěŝ WĂƌŵĂ ğ ƐƚĂƚĂ ŝŶĚŝǀŝĚƵĂƚĂ ƋƵĂůĞ ĐĞŶƚƌŽ
^ƉŽŬĞ Ăůů͛ŝŶƚĞƌŶŽ ĚĞůůĂ ƌĞƚĞ ƐƉĞĐŝĨŝĐĂ ƉĞƌ ů͛ĂƐƐŝƐƚĞŶnjĂ Ăŝ ŵŝŶŽƌŝ ĐŽŶ
ŵĂůĂƚƚŝĂ ƌĂƌĂ͘ ^ŝ ƚƌĂƚƚĂ Ěŝ ϭϵϳ ƉĂƚŽůŽŐŝĞ ĐŚĞ ƌŝŐƵĂƌĚĂŶŽ ů͛ĂƉƉĂƌĂƚŽ
ĚŝŐĞƌĞŶƚĞ͕ ů͛ĂƉƉĂƌĂƚŽ ƐĐŚĞůĞƚƌŝĐŽ͕ ů͛ŽĐƵůŝƐƚŝĐĂ͕ ůĂ ĚĞƌŵĂƚŽůŽŐŝĂ͕ ŝ ĚŝĨĞƚƚŝ
ĐƌŽŵŽƐŽŵŝĐŝ͕ůĞŵĂůĨŽƌŵĂnjŝŽŶŝĐŽŶŽƐĞŶnjĂƌŝƚĂƌĚŽŵĞŶƚĂůĞ͕ŝůƐŝƐƚĞŵĂ
ŶĞƌǀŽƐŽ͘
>ĂŶŽƐƚƌĂnjŝĞŶĚĂƐǀŽůŐĞƵŶƌƵŽůŽ,h;ƵŶŝĐŽŝŶƚƵƚƚĂůĂƌĞŐŝŽŶĞͿƉĞƌŝů
ĐŽŽƌĚŝŶĂŵĞŶƚŽ ĚĞůůĂ ƌĞƚĞ ƉĞƌ ůĞ ŵĂůĂƚƚŝĞ ĞŵŽƌƌĂŐŝĐŚĞ ĐŽŶŐĞŶŝƚĞ͘
ĞŶƚƌŽ Ěŝ ƌŝĨĞƌŝŵĞŶƚŽ ƌĞŐŝŽŶĂůĞ ğ ŝů ĞŶƚƌŽ ŵŽĨŝůŝĂ ĚĞůůĂ ŶŽƐƚƌĂ
njŝĞŶĚĂ ĐŚĞ ĐŽŽƌĚŝŶĂ ů͛Ăƚƚŝǀŝƚă Ěŝ ͞ĞŶƚƌŝ ŵŽĨŝůŝĂ͟ ƉĞƌ ŐĂƌĂŶƚŝƌĞ ůĂ
ƚĞŵƉĞƐƚŝǀĂĚŝĂŐŶŽƐŝĞů͛ĂƉƉƌŽƉƌŝĂƚĂƚĞƌĂƉŝĂ͘/ůĞŶƚƌŽĚŝWĂƌŵĂŐĞƐƚŝƐĐĞ
ŝů ΗZĞŐŝƐƚƌŽ ƌĞŐŝŽŶĂůĞ ĚĞůůDzĞŵŽĨŝůŝĂ Ğ ĚĞůůĞ ŵĂůĂƚƚŝĞ ĞŵŽƌƌĂŐŝĐŚĞ
ĐŽŶŐĞŶŝƚĞΗ͘ >DzĂƚƚŝǀŝƚă ĚĞŝ ĞŶƚƌŝ ŵŽĨŝůŝĂ ĐŽŶƐŝƐƚĞ ŶĞůůDzĂƐƐŝƐƚĞŶnjĂ ĂŐůŝ
ĂŵŵĂůĂƚŝŝŶƚƵƚƚĞůĞĨĂƐŝĚĞůůĂŵĂůĂƚƚŝĂ͖ŶĞůůĂŐĞƐƚŝŽŶĞĚŝƉĞƌĐŽƌƐŝŝĚŽŶĞŝ
ƉĞƌ ůDzĂƐƐŝƐƚĞŶnjĂ ŝŶ ĂŵďŝƚŽ ůŽĐĂůĞ͕ Ğ Ěŝ ƉĞƌĐŽƌƐŝ ĚĞĚŝĐĂƚŝ ƉĞƌ ŝ ƌŝĐŽǀĞƌŝ
ŽůƚƌĞĐŚĞƉĞƌůĞĞŵĞƌŐĞŶnjĞ͘
ŽŶ ĚĞůŝďĞƌĂnjŝŽŶĞ ƐƵĐĐĞƐƐŝǀĂ Ă ƋƵĞůůĂ ĚĞů WŝĂŶŽ ^ĂŶŝƚĂƌŝŽ ZĞŐŝŽŶĂůĞ
ϭϵϵϵͲϮϬϬϭ͕ŶĞůŵĂƌnjŽĚĞůϮϬϬϲ;'ZϯϵϱͬϮϬϬϲͿ͕ů͛njŝĞŶĚĂKƐƉĞĚĂůŝĞƌŽͲ
hŶŝǀĞƌƐŝƚĂƌŝĂ Ěŝ WĂƌŵĂ ǀŝĞŶĞ ƌŝĐŽŶŽƐĐŝƵƚĂ ĞŶƚƌŽ ŚƵď ƉĞƌ ůĂ
ƉƌĞǀĞŶnjŝŽŶĞ͕ůĂĚŝĂŐŶŽƐŝĞůĂĐƵƌĂĚĞůůĂĨŝďƌŽƐŝĐŝƐƚŝĐĂ͕ŵĂůĂƚƚŝĂŐĞŶĞƚŝĐĂ
ĐŚĞ ƉƌĞƐĞŶƚĂ ƵŶĂ ŶŽƚĞǀŽůĞ ƌŝůĞǀĂŶnjĂ ƐŽĐŝĂůĞ Ğ ĐŚĞ ĐŽŵƉŽƌƚĂ ƵŶ
ƚƌĂƚƚĂŵĞŶƚŽ ƚĞƌĂƉĞƵƚŝĐŽ ĞƐƚƌĞŵĂŵĞŶƚĞ ĐŽŵƉůĞƐƐŽ Ğ ĐŽŶƚŝŶƵĂƚŝǀŽ͘ /Ŷ
ƌĞůĂnjŝŽŶĞĂƋƵĞƐƚĂĨƵŶnjŝŽŶĞŚƵď͕ůĂ^ƚƌƵƚƚƵƌĂƐĞŵƉůŝĐĞĚŝ&ŝďƌŽƐŝŝƐƚŝĐĂ
ĚĞůůĂ ůŝŶŝĐĂ ƉĞĚŝĂƚƌŝĐĂ ĚĞůů͛njŝĞŶĚĂ Ɛŝ ĂǀǀĂůĞ ĚĞůůĂ ĐŽůůĂďŽƌĂnjŝŽŶĞ
ŝŶƚĞƌŶĂ Ěŝ ĂůƚƌĞ hŶŝƚă ŽƉĞƌĂƚŝǀĞ ĐŽŶ ĨƵŶnjŝŽŶĞ Ěŝ ƐƉŽŬĞ ;KZ>͕ ^ĐŝĞŶnjĞ
ZĂĚŝŽůŽŐŝĐŚĞ͕ WĂƚŽůŽŐŝĂ Ğ DĞĚŝĐŝŶĂ Ěŝ >ĂďŽƌĂƚŽƌŝŽ Ğ ůŝŶŝĐĂ
ƉŶĞƵŵŽůŽŐŝĐĂͿ͘/ůďĂĐŝŶŽĚŝƌŝĨĞƌŝŵĞŶƚŽğƌĂƉƉƌĞƐĞŶƚĂƚŽĚĂŝƚĞƌƌŝƚŽƌŝĚŝ
WZ͕W͕ZĞK͘
&RQWHVWRGLULIHULPHQWR
3HUTXDQWRULJXDUGDLQILQHJOLLQGLFDWRULXWLOLDGHVFULYHUHORVWDWRGLVDOXWHGHOODSRSROD]LRQHUHVLGHQWHHD
YDOXWDUH OD GLVWULEX]LRQH H O¶DQGDPHQWR QHO WHPSR GHOOH YDULH SDWRORJLH FKH FRVWLWXLVFRQR LO TXDGUR
HSLGHPLRORJLFR GHO WHUULWRULR VX FXL LQVLVWH O¶$]LHQGD 2VSHGDOLHUR8QLYHUVLWDULD GL 3DUPD VL ULPDQGD DO
SDUDJUDIR GHOOH 2VVHUYD]LRQL HSLGHPLRORJLFKH FRQWHQXWR QHO %LODQFLR GL 0LVVLRQH GHOO¶$]LHQGD $86/ GL
3DUPDGRYHqSRVVLELOHWURYDUHXQ¶DPSLDHVSRVL]LRQHGHVFULWWLYDFRUUHGDWDGDJUDILFLHWDEHOOHUHODWLYLDJOL
LQGLFDWRUL SURSRVWL GDOOR VFKHPD UHJLRQDOH 6HFRQGR O¶DFFH]LRQH SL WUDGL]LRQDOH GL HSLGHPLRORJLD JOL
LQGLFDWRUL ULSRUWDWL LQ TXHVWD VH]LRQH HVSOLFLWDQR LQ PRGR GLUHWWR OD IUHTXHQ]D OD GLVWULEX]LRQH H L
GHWHUPLQDQWL GL VDOXWH H PDODWWLD GHOOD SRSROD]LRQH UHVLGHQWH LQ SDUWLFRODUH ULVSHWWR DJOL DPELWL GHOOD
PRUWDOLWjSULQFLSDOLFDXVHGLPRUWHHGHOODPRUERVLWjSDWRORJLHHPDODWWLHSLGLIIXVH
>OLQNDOODSDJLQDGHOVLWRGHOO¶$]LHQGD86/GL3DUPDGHGLFDWDDL%LODQFLGLPLVVLRQHKWWSZZZDXVOSULW@
7DOL LQIRUPD]LRQL ULJXDUGDQR LQ PRGR GLUHWWR OH SULRULWj GL SURJUDPPD]LRQH GHOOD D]LHQGD VDQLWDULD
WHUULWRULDOH LQ PHULWR DOO¶LGHQWLILFD]LRQH GHL ELVRJQL DVVLVWHQ]LDOL H DOOD IRUPXOD]LRQH GL LQWHUYHQWL
DSSURSULDWL
3URILORD]LHQGDOH
4XHVWR FDSLWROR GHOLQHD FDUDWWHULVWLFKH H VSHFLILFLWj FKH
FRQWUDGGLVWLQJXRQRO¶$]LHQGDQHOVLVWHPDUHJLRQDOH
Ê XQD UDSSUHVHQWD]LRQH GHOO¶$]LHQGD VRWWR O¶RWWLFD
HFRQRPLFRILQDQ]LDULD H VRWWR TXHOOD GHOO¶DWWLYLWj
LVWLWX]LRQDOH
,OFDSLWRORqDUWLFRODWRVXFLQTXHDPELWL
•
6RVWHQLELOLWjHFRQRPLFDILQDQ]LDULDH
SDWULPRQLDOH
•
,PSDWWRVXOFRQWHVWRWHUULWRULDOH
•
&RQWULEXWRDOODFRSHUWXUDGHLOLYHOOLHVVHQ]LDOL
GLDVVLVWHQ]D
•
5LFHUFDHGLGDWWLFD
•
$VVHWWRRUJDQL]]DWLYR
Profilo aziendale
2.1 Sostenibilità economica, finanziaria e patrimoniale
La sostenibilità economica
Le politiche sanitarie dell’Azienda Ospedaliero-Universitaria di Parma in questi ultimi anni sono state
vincolate dalle scelte dettate dalle disposizioni del Governo e della Regione relative all’analisi e alla
revisione della spesa pubblica, al fine di razionalizzare la stessa, garantendo nel contempo l’invarianza dei
servizi ai cittadini.
Questa sezione analizza gli indicatori per l’analisi della sostenibilità economica, finanziaria e patrimoniale
al fine di poter rilevare:
•
le precise cause gestionali che hanno portato alla determinazione del pareggio di bilancio,
•
l’incidenza dei costi dei vari fattori produttivi sui ricavi aziendali,
•
il recupero di efficienza e produttività dei processi caratteristici.
Rispetto del vincolo di bilancio assegnato dalla programmazione regionale
Nell’ambito di una maggiore attenzione alla gestione delle risorse pubbliche, negli ultimi anni per le
aziende sanitarie si è manifestata, in tutta la sua importanza strategica, la sfida della massima efficienza
nell’utilizzo delle risorse economiche a disposizione.
Considerare questo vincolo è quindi indispensabile per comprendere le ragioni di alcune scelte
strategiche, nonché gli indispensabili compromessi costo/beneficio alla base delle modalità di erogazione
di qualsiasi servizio. Il perdurare della crisi economica, continua a tenere al centro del dibattito
istituzionale la sostenibilità finanziaria anche se la nostra Azienda non ha trascurato l’importanza della
salute per la qualità della vita della persona e per lo sviluppo della società.
La nostra sfida è quella di far fronte alle nuove problematiche della medicina, i cui contesti scientifici ed
epidemiologici sono cambiati, promuovendo la salute mediante investimenti quindi innovazioni necessarie
per mantenere e aumentare l’efficienza tecnica. Il tema degli investimenti è ritenuto quindi fondamentale
per la promozione di azioni per lo sviluppo delle politiche sanitarie di questa Azienda.
Verifica del rispetto della condizione di equilibrio
Anno 2011
Risultato netto d'esercizio
-10.500
Anno 2012
Anno 2013
6
6
Nota: i valori sono espressi in migliaia di euro.
25
2. Profilo aziendale
La modalità di verifica del risultato di esercizio delle Aziende sanitarie e del Consolidato regionale, definita
dal Tavolo di verifica degli adempimenti (ex articolo 12 dell’Intesa 23 marzo 2005, istituito presso il MEF),
comporta la necessità di garantire nell’esercizio 2013 una situazione di pareggio. Il sistema sanitario
regionale deve quindi assicurare il finanziamento degli ammortamenti non sterilizzati, di competenza
dell’esercizio 2013, riferiti a tutti i beni ad utilità pluriennale utilizzati per l’attività produttiva.
Tale modalità comporta la necessità di assicurare a livello regionale una situazione di pareggio di
bilancio, da determinarsi sulla base dei criteri civilistici: a partire dall’anno 2012 all’interno dell’equilibrio
dovranno essere interamente ricompresi gli ammortamenti netti di competenza dell’anno (DGR
653/2012).
L’Azienda ha chiuso l’esercizio con un utile pari a euro 5.828; situazione analoga al 2012. Tale valore
risulta in linea rispetto al risultato atteso dalla programmazione regionale e dalle disposizioni nazionali del
D.Lgs. 118/2011.
Grafico 1 Risultato netto dell’esercizio, anni 2011-2013
2012
2013
2011
Nota: i valori sono espressi in migliaia di euro.
Contributo della gestione caratteristica e della gestione non caratteristica
nella formazione del risultato netto
2. Profilo aziendale
L’indicatore permette di analizzare la gestione caratteristica e non caratteristica dell’Azienda ovvero i
costi e i ricavi tipici istituzionali; immobilizzazioni per lavori interni, costi sanitari, amministrativi e
generali determinati dalla gestione caratteristica mentre la gestione non caratteristica comprende tutti i
costi e tutti i ricavi non collegati direttamente all’attività specifica dell’Azienda (componenti di reddito
finanziarie, straordinarie e le imposte).
Da un confronto degli indicatori degli anni di riferimento, nel 2013 si evidenzia che la gestione
caratteristica ha una incidenza di segno negativo sul risultato netto. Le componenti tipiche evidenziano
nel 2013 un decremento generale nei ricavi disponibili, in particolare dei contributi regionali. Nell’ambito
dei costi si registra una riduzione dei costi di beni strumentali e dei costi amministrativi e generali mentre
si evidenzia un incremento dei costi dei beni di consumo e dei servizi sanitari e non sanitari. La gestione
non caratteristica rappresenta, invece, il contributo a carattere episodico alla formazione del bilancio di
esercizio e il risultato migliore compare nel dato del 2013. Risultano infatti in calo gli interessi di mora
dalle ditte fornitrici di beni e servizi e gli oneri addebitati dall’Istituto Cassiere per l’anticipazione corrente.
In relazione alla voce “Contributi in conto esercizio”, la motivazione tra le risultanze consuntive e i valori
di preventivo, si piega principalmente con i seguenti motivi:
•
assegnazione regionale del contributo relativo al valore degli ammortamenti (al netto della
sterilizzazione) relativa ai beni entrati in inventario al 31 Dicembre 2009 per un importo di euro
7,589 milioni;
•
assegnazione regionale del contributo di euro 2,238 milioni in base alla rideterminazione del
riparto per l’anno 2013;
•
assegnazioni regionali per i Programmi di Ricerca Regione-Università per euro 0,870 milioni;
•
contabilizzazione di euro 3,592 mil., a titolo di utilizzo fondi per quote di contributi vincolati di
esercizi precedenti.
Tabella 1 Valori assoluti dei risultati della gestione caratteristica, non caratteristica e risultato
medio (trend anni 2011 – 2013)
2011
2012
2013
Risultato Gestione Caratteristica
-7.871
874
-2.733
Risultato Gestione non Caratteristica
-2.629
-868
2.739
Risultato Netto
-10.500
6
6
Nota: i valori sono espressi in migliaia di euro.
26
Grafico 2 Incidenza dei risultati della gestione caratteristica e non caratteristica,
anni 2011-2013
4000
3000
2000
1000
0
-1000
-2000
-3000
-4000
-5000
-6000
-7000
-8000
-9000
Risultato Gestione
Caratteristica
Risultato Gestione
non Caratteristica
2011
2012
2013
Trend della performance della gestione caratteristica dell’Azienda a
confronto con il trend regionale
L’analisi permette di valutare in quale misura i ricavi disponibili, ossia le risorse utilizzate dall’Azienda per
lo svolgimento dell’attività tipica, riescono a coprire i costi derivanti dalla gestione caratteristica.
Dal grafico 3 si evidenzia il costo del lavoro come il dato di maggior impatto sui principali aggregati di
fattori produttivi; i beni di consumo hanno subito un lieve incremento rispetto al 2012 dovuto
essenzialmente ai prodotti farmaceutici (farmaci ad altissimo costo). I costi amministrativi subiscono una
riduzione passando dal 4% del 2012 al 2,1% del 2013; il costo dei servizi subisce un aumento dello 0,5%
in parte legato a contributi in conto esercizio vincolati e in parte relativo all’entrata in funzione del
Padiglione Pietro Barilla (Nuovo Ospedale dei Bambini).
Grafico 3 Principali aggregati di fattori produttivi/Ricavi disponibili, anno 2013
52,3
23,5
3,5
Beni di
Beni
consumo/Ricavi d. strumentali/Ricavi d.
2,1
Servizi/Ricavi d.
27
Costi amministrativi e
generali/Ricavi d.
Costo del
lavoro/Ricavi d.
2. Profilo aziendale
19,5
Grafico 4 Risultati della gestione caratteristica (ROC)/ricavi disponibili, confronto anni 20112013
180
160
140
120
2013
100
2012
80
2011
60
40
20
0
Assorbimento di risorse per aggregazione di fattori direttamente impiegati
nel processo di produzione aziendale, nell’ultimo triennio e rispetto ai
corrispondenti valori medi regionali
Il trend osservato è correlato in particolare ad una diminuzione degli accordi di fornitura con la AUSL di
Parma e le AUSL regionali oltre che ad un perfezionamento continuo dell’allocazione di alcuni costi comuni
tra le diverse tipologie assistenziali (ad esempio costi del personale o di servizi non sanitari), altresì al
processo di trasferimento di attività dal regime di ricovero diurno (day hospital, day surgery) al regime
ambulatoriale. Nel corso del 2013 sono state poste in essere, infatti, ulteriori azioni propedeutiche al
trasferimento di attività nel setting ambulatoriale di attività che non richiede necessariamente la
“condizione di ricovero” e tale processo è stato supportato dall’attivazione di diversi Day Service
Ambulatoriali e dalla ridefinizione delle modalità organizzative ed operative correlate al trasferimento di
regime di erogazione.
Grafico 5 Principali aggregati di fattori produttivi/ricavi disponibili, a confronto con regione,
anni 2011–2013
60
2011
50
2012
40
2013
30
20
10
0
2. Profilo aziendale
AOPR
RER
Beni di
consumo/RD
2011
23
22
AOPR
RER
Beni
strumentali/RD
5
4
AOPR
RER
Servizi/RD
19
20
AOPR
RER
Costi amm. e
generali e
accant./RD
3
3
AOPR
RER
Costo del
lavoro/RD
53
52
2012
22
20
5
4
19
22
4
4
50
50
2013
23,5
21,5
3,5
4,5
19,5
20,6
2,1
3,2
52,3
50,4
28
Struttura dei costi aziendali
L’analisi descrive l’incidenza dei costi di produzione aziendale suddivisi per macroaree rispetto ai costi
complessivi. Dal grafico 6 si evidenzia il costo del lavoro come il dato di maggior impatto sui principali
aggregati di costi complessivi. Si segnala comunque un allineamento col 2012. Tale risultato è correlato
agli effetti positivi di alcune politiche quali il contenimento dei costi variabili, perseguito anche attraverso
un uso più attento dei materiali di consumo, attraverso una maggiore attenzione al rapporto qualità
prezzo e mediante un massiccio ricorso alle gare.
Grafico 6 Composizione dei costi di esercizio, anno 2013
60
51,9%
50
40
30
23,3%
20
11,3%
10
4,3%
3,4%
3,7%
Beni strumentali
Manutenzioni
1,7%
0,4%
0
Consumo beni acquistati
Servizi sanitari
Servizi non sanitari
Costi Accantonamenti Costo del lavoro
amministrativi e generali
29
2. Profilo aziendale
Grafico 7 Composizione percentuale dei costi d’esercizio annuali sul totale costi, confronto con
RER, anni 2011-2013
L’acquisto dei servizi sanitari registra un’incidenza inferiore alla media regionale così come l’acquisto dei
servizi non sanitari è in linea col 2012 e inferiore alla media regionale.
I beni di consumo presentano un dato superiore all’incidenza media; i beni strumentali indicano una
flessione rispetto all’anno precedente e comunque inferiore alla media regionale.
Il costo delle manutenzioni e i costi amministrativi registrano un’incidenza inferiore rispetto all’anno
precedente.
Nel rispetto alle indicazioni contenute nella deliberazione di Giunta Regionale n. 199/2013, l’Azienda ha
contribuito attivamente al raggiungimento degli obiettivi di Area Vasta operando in collaborazione con le
altre aziende associate affinché potessero essere raggiunti i risultati attesi. In particolare è stata
garantita la piena adesione alle convenzioni di Intercent-ER.
La sostenibilità finanziaria
L’analisi fornisce un quadro, in forma sintetica, della situazione finanziaria che ha caratterizzato la
gestione aziendale; non vi è dubbio che la sostenibilità della gestione da un punto di vista finanziario è
una componente fondamentale dell’equilibrio dell’Azienda.
La sostenibilità finanziaria viene indagata attraverso l’analisi del Rendiconto finanziario di liquidità, e
attraverso indici atti a esprimere la durata media (tempi medi di pagamento) dei debiti verso i fornitori.
Dinamica dei flussi monetari - modalità di finanziamento e tipologia di
impiego delle fonti – relativi all’esercizio
Il rendiconto finanziario di liquidità esprime la dinamica finanziaria dell’azienda nell’anno di riferimento e
ha l’obiettivo di rappresentare i movimenti in entrata ed in uscita intervenuti nelle risorse finanziarie
aziendali, così da evidenziarne la variazione intervenuta nel periodo di riferimento.
La gestione finanziaria dell’anno è contraddistinta dal ricevimento di rimesse straordinarie di cassa da
parte della Regione a seguito del DL n. 35/2013, “Disposizioni urgenti per il pagamento dei debiti scaduti
della pubblica amministrazione”, che ha portato ad una significativa diminuzione dei debiti verso fornitori
di beni e servizi (per circa 56 milioni di euro).
Come mostra la tabella, le disponibilità liquide di fine esercizio dovrebbero permettere il mantenimento,
se non un leggero miglioramento, dei tempi di pagamento dei fornitori di beni e servizi.
Tabella 2 Rendiconto finanziario
2011
2012
2013
Disponibilità liquide iniziali
3.793.253
1.484.417
-11.153.001
Net cash gestione corrente
15.633.640
-3.670.710
1.172.647
-17.942.476
-8.966.709
-24.844.176
0
0
63.804.010
1.484.417 -11.153.002
28.979.480
Net cash gestione extracorrente
Contributi per perdite
2. Profilo aziendale
Disponibilità liquide finali
30
Grafico 8 Rendiconto finanziario di liquidità
Durata media dell’esposizione verso fornitori
L’indicatore della tabella mostra la durata media dell’esposizione verso fornitori; esprime cioè il tempo
che intercorre tra il sorgere del debito e il suo effettivo pagamento.
La durata dell’esposizione verso i fornitori intesa come debiti medi per forniture in conto esercizio è
passata nel biennio 2011-2013 tra i 260 e i 185 giorni dalla data di ricevimento della fattura. Al 31
dicembre 2013 il ritardo nel mandato dei pagamenti era a 90 giorni data fattura.
Le disponibilità liquide di fine esercizio dovrebbero comunque permettere il mantenimento, se non un
leggero miglioramento, dei tempi di pagamento dei fornitori di beni e servizi.
Grafico 9 Tempi medi di pagamento in giorni
300
250
200
260
214
100
185
50
0
Anno 2011
Anno 2012
31
Anno 2013
2. Profilo aziendale
150
La sostenibilità patrimoniale
Gli indicatori per l’analisi della sostenibilità patrimoniale sono volti a misurare la solidità patrimoniale
dell'Azienda attraverso l'esame della struttura degli investimenti, delle dinamiche che caratterizzano gli
stessi, dei finanziamenti aziendali e delle relazioni che intercorrono tra investimenti e finanziamenti
nonché le dinamiche di investimento in atto, con particolare riferimento ai tassi di rinnovamento e al
grado di obsolescenza delle immobilizzazioni strumentali.
Riclassificazione delle poste dell’attivo e del passivo patrimoniale sulla base
della scansione temporale dei realizzi/rimborsi delle operazioni di
investimento/finanziamento
La situazione di equilibrio strutturale è rappresentata da un patrimonio immobilizzato coperto da
finanziamenti a medio/lungo termine e dal patrimonio netto.
Analizzando le voci nel dettaglio, rispetto al biennio precedente, il 2013 vede per l’attivo un andamento
sostanzialmente stabile. Per il passivo si rileva una riduzione significativa dei debiti a breve termine,
dovuto alla riduzione dei debiti verso Aziende Sanitarie e verso fornitori. Diminuiscono anche i debiti a
medio/lungo termine ed aumenta invece il patrimonio netto.
La struttura patrimoniale relativa agli ultimi tre esercizi viene proposta, di seguito, in termini percentuali
ed espressa graficamente.
Liquidità immediate e differite
ATTIVITA'
2011
2012
32%
35%
PASSIVITA'
2011
2012
46%
47%
Finanziamenti a breve
Finanziamenti a medio lungo termine
Scorte
3%
2%
13%
12%
Immobilizzazioni
65%
63%
41%
41%
Patrimonio netto
TOTALE ATTIVITA' 100%
100%
100%
100%
TOTALE PASSIVITA'
PASSIVITA'
ATTIVITA'
2013
Liquidità immediate e differite
Scorte
Immobilizzazioni
TOTALE ATTIVITA'
33%
3%
65%
100%
29%
11%
60%
100%
Finanziamenti a breve
Finanziamenti a medio lungo termine
Patrimonio netto
TOTALE PASSIVITA'
Grado di copertura degli investimenti attraverso contributi pubblici
2. Profilo aziendale
Si rappresentano gli investimenti effettuati nel triennio e la loro copertura attraverso contributi pubblici.
L’analisi descrive in che misura i contributi in conto capitale erogati all’Azienda coprono gli investimenti
realizzati nell’anno.
Totale investimenti
% Copertura investimenti attraverso contributi
pubblici
2011
2012
2013
21.645.000 30.698.000 33.278.000
36%
32
53%
15%
Grafico 10 Copertura investimenti attraverso contributi pubblici, anni 2011-2013
Copertura investimenti attraverso contributi pubblici
60%
53%
50%
40%
36%
30%
20%
15%
10%
0%
2011
2012
2013
Rappresentazione dei nuovi investimenti effettuati nell’esercizio: loro
ammontare complessivo e per singola tipologia
Le politiche di programmazione degli investimenti destinati all’ammodernamento del patrimonio
strutturale e tecnologico dell’Azienda hanno seguito strettamente, specie nell’ultimo triennio, l’andamento
delle politiche generali di riqualificazione dell’offerta assistenziale, segnate da un necessario processo di
crescente attenzione a una allocazione sempre più efficace ed efficiente degli investimenti, ai fini del
contenimento della spesa sanitaria pubblica.
Tabella 3 Valore assoluto nuovi investimenti, anni 2011-2013
2012
2013
562.421
2.474.231
3.629.655
649.215
409.939
10.977.023
414.398
18.000
6.520.597
392.534
7.521.261
1.988.505
371.688
13.194.563
706.914
2.000
26.735.429
127.110
2.080.453
281.817
247.386
3.433.361
318.588
53.671
Totale
19.134.882
30.698.061
33.278.000
Il valore degli investimenti in valore assoluto per l’anno 2013 è in aumento rispetto al triennio; in
particolare si evidenzia un picco alla voce fabbricati indisponibili per effetto del completamento del
Poliblocco IV Lotto (l’edificio ospiterà le funzioni attualmente ubicate nel Padiglione Nefrologia che sarà
restituito all’Università degli Studi di Parma proprietaria dell’immobile, e parte delle attività attualmente
collocate nel Padiglione Rasori) e l’entrata in inventario del NOB (Nuovo Ospedale dei Bambini).
33
2. Profilo aziendale
2011
Fabbricati indisponibili
Impianti e macchinari
Attrezzature sanitarie e scientifiche
Mobili e arredi
Altre immobilizzazioni materiali
Immobilizzazioni materiali in corso e acconti
Altre immobilizzazioni immateriali
Migliorie su beni di terzi
Grafico 11 Valore degli investimenti in valore assoluto, anni 2011-2013
30000000,00
25000000,00
20000000,00
2011
15000000,00
2012
2013
10000000,00
5000000,00
0,00
Fabbricati indisponibili Attrezzature sanitarie e Altre immobilizzazioni Altre immobilizzazioni
scientifiche
materiali
immateriali
2. Profilo aziendale
Grafico 12 Percentuale degli investimenti trend, anni 2011-2013
34
Grado di rinnovo del patrimonio aziendale
I nuovi investimenti in immobilizzazioni rapportati al totale del patrimonio aziendale, immobiliare e
mobiliare, mettono in evidenza il grado di rinnovo del patrimonio stesso. Maggiore è il valore
dell’indicatore, maggiore è il grado di rinnovo del patrimonio.
Come si può notare il grado di rinnovo del patrimonio è più elevato nel 2013 rispetto al 2011 e al 2012
grazie al nuovo Ospedale dei Bambini e al Poliblocco IV Lotto.
Grafico 13 Grado di rinnovo del patrimonio aziendale, anni 2011-2013 (nuovi investimenti in
immobilizzazioni immateriali e materiali/totale investimenti lordi)
12,6%
12,0%
15,00%
7,3%
10,00%
5,00%
0,00%
1
2
3
Grado di obsolescenza del patrimonio aziendale
L’indicatore descrive il grado di obsolescenza del patrimonio aziendale, determinato dal rapporto tra il
valore residuo dei beni durevoli e il totale degli investimenti lordi.
Valore residuo immobilizzazioni immateriali e materiali /
totale investimenti lordi beni durevoli
35
58%
2012
53%
2013
52%
2. Profilo aziendale
2011
Grafico 14 Grado di obsolescenza del patrimonio aziendale, anni 2011-2013
58%
53%
52%
Anno 2011
Anno 2012
Anno 2013
L’indicatore come si evince dal grafico 14, registra un valore decrescente passando dal 58% del 2011 al
52% del 2013 per effetto del grado di rinnovo del patrimonio aziendale, infatti maggiore è il livello di
rinnovo del patrimonio dell’Azienda, minore è la tendenza all’obsolescenza dei beni durevoli. Questo
dimostra quindi come l’Azienda abbia saputo far fronte all’invecchiamento del proprio patrimonio
attraverso un costante rinnovo di esso e la realizzazione di nuovi investimenti.
2.2 Impatto sul contesto territoriale
Il contributo dell’Azienda all’economia del territorio, anche dal punto di vista occupazionale, e la trama
delle relazioni con il contesto concorrono a definire il profilo aziendale, ad integrazione del quadro
economico dell’Azienda (delineato nel paragrafo precedente) e del ruolo dell’Azienda nel sistema sanitario
regionale (di cui al successivo paragrafo 2.3), con particolare riferimento alla copertura dei livelli
essenziali di assistenza e alla qualità delle prestazioni erogate.
Impatto economico
2. Profilo aziendale
La prima dimensione su cui si focalizza l’analisi dell’impatto sul contesto territoriale è la dimensione
economica, che evidenzia appunto il contributo dell’Azienda all’economia del territorio come realtà
occupazionale e per i rapporti di fornitura.
Considerando le tipologie contrattuali tempo indeterminato e tempo determinato, la popolazione
lavorativa dell’Azienda è passata, nel 2013, a 3.727, con una lieve contrazione complessiva rispetto
all’anno precedente. Il dettaglio sull’evoluzione nel tempo e sulle caratteristiche del personale è
presentato nel capitolo 4 del presente volume.
Tra il personale dipendente a tempo indeterminato l’87,3% del personale risiede sul territorio provinciale
(+0,5% rispetto al 2012), mentre il 7,6% proviene da altre regioni e il 5% ha la residenza in regione.
Tale rilevazione non prende in considerazione i dati relativi al domicilio che probabilmente porterebbero
un incremento delle persone che effettivamente “vivono” il territorio, pur non avendo ancora deciso di
stabilirvisi.
36
Tabella 1 Dipendenti suddivisi per ruolo e per tipologia contrattuale, anno 2013
Dipendenti a
tempo
indeterminato*
Dipendenti a
tempo
determinato
2447
104
118
47
4
151
134
Ruolo sanitario
Ruolo professionale
Altro personale
8
Ruolo tecnico
2
947
Ruolo amministrativo
174
Totale
10
3576
* per questa tipologia contrattuale la rilevazione è stata effettuata secondo i criteri del conto annuale
Si conferma un ruolo di rilievo per l’Azienda nel mercato del lavoro locale, come evidenziato dal grafico 1
che evidenzia, in istogramma, l’andamento negli anni, in valori assoluti, della popolazione lavorativa
aziendale (intesa come personale dipendente a tempo indeterminato e a tempo determinato) e,
attraverso la linea spezzata, l’incidenza percentuale degli occupati in AOU sul totale degli occupati della
provincia di Parma negli stessi anni.
Dal grafico si evince che l’incidenza percentuale sugli occupati della provincia si attesta nel 2013
sull’1,84% presentando una lieve flessione rispetto agli anni precedenti (-0,03 sul 2012), in particolare il
2010 quando l’incidenza è arrivata quasi al 2%. Nel 2011 e nel 2012, secondo i dati a disposizione
[Fonte: Occupati e tasso di occupazione Serie storica 2004-2013 dal Portale per la statistica della
provincia di Parma – rilevazione Istat campionaria sulle forze di lavoro], il numero degli occupati in
provincia di Parma è aumentato rispetto all’anno precedente, a fronte di una sostanziale stabilità della
popolazione lavorativa aziendale. Nel 2013 entrambe le popolazioni considerate (occupati in provincia e
occupati in AOU) presentano una riduzione contenuta, appena più marcata in ambito aziendale.
Grafico 1 Andamento della popolazione lavorativa in AOU (personale dipendente a tempo
indeterminato e a tempo determinato) e incidenza percentuale sugli occupati della provincia di
Parma
Dipendenti AOU (valori assoluti)
% su occupati provincia di Parma
2,00%
4000
3900
1,90%
3800
1,80%
3700
3600
1,70%
3500
1,60%
3400
1,50%
3300
1,40%
3200
1,30%
3100
3000
1,20%
2010
Anno
2011
2012
2013
Per quanto riguarda la provenienza dei professionisti impiegati nella nostra Azienda, si segnala che 86
lavoratori sono stranieri; di questi, 59 provengono da paesi dell’Unione Europea (in maggioranza dalla
Romania), mentre 20 lavoratori di provenienza extra-europea sono paraguaiani.
Lavoratori
stranieri
Intra UE
Extra UE
Totale
31.12.2010
31.12.2011
31.12.2012
31.12.2013
54
31
85
54
33
87
57
28
85
59
27
86
37
2. Profilo aziendale
2009
I lavoratori appartenenti alle categorie protette sono ulteriormente incrementati, passando da 98 nel
2011 a 105.
31.12.2009 31.12.2010 31.12.2011 31.12.2012 31.12.2013
68
93
98
100
105
Gli universitari in convenzione con l’Ospedale sono ulteriormente diminuiti di 2 unità, passando da 219 a
217, prevalentemente concentrati nel ruolo sanitario.
Tabella 2 Universitari suddivisi per ruolo, anno 2013
Universitari in
convenzione
Ruolo
Ruolo sanitario
188
Ruolo tecnico
Ruolo
amministrativo
Totale
6
23
217
Frequentano l’area ospedaliera 3.917 studenti (A.A. 2012-2013), fra corsi di laurea e post-laurea di area
sanitaria. I medici in formazione specialistica, iscritti nell’A.A. 2012-2013 alle Scuole di specializzazione di
Area Sanitaria della Facoltà di Medicina e Chirurgia dell’Università di Parma, sono 574. Nel complesso il
numero di persone iscritte a corsi di laurea e post-laurea della Facoltà di Medicina e Chirurgia di Parma si
mantiene stabile e si aggira intorno a circa 5.000 studenti.
Nel successivo paragrafo 2.4 del presente capitolo, dedicato a ricerca e didattica, è possibile trovare il
dettaglio della distribuzione della popolazione studentesca fra i diversi corsi di laurea programmati dalla
Facoltà di Medicina e Chirurgia della Università degli studi di Parma, nonché l’articolazione delle Scuole di
specialità mediche, dei corsi di Dottorato post-laurea e dei Master. Il paragrafo 1.2 è invece dedicato al
sistema delle relazioni con l’Università con una sintetica presentazione della programmazione didattica.
Il dato economico relativo agli emolumenti corrisposti ai dipendenti e ai relativi oneri previdenziali e
assistenziali evidenzia ulteriormente il ruolo di rilievo dell’Azienda nel mercato del lavoro. Nel 2013 il
costo complessivo sostenuto per il personale è pari € 167.899 (valore in migliaia). A questi, devono
essere aggiunti 7.507 migliaia di € per il costo sostenuto dall’Azienda per tutto il personale universitario
in convenzione.
Di seguito, nelle tabelle 3 e 4, sono riportati gli importi erogati dall’Università degli Studi per il personale
in convenzione negli anni 2011-2013, il cui andamento è da mettere in relazione alla variazione di
personale rilevata sopra:
Tabella 3 Valori degli emolumenti corrisposti dall’Università a ricercatori e docenti
convenzionati, anni 2011-2013
Anno
Lordo
Oneri riflessi
Totale
Netto
2011
8.423,6
3.158,5
11.582,1
5.067,6
2012
8.074,3
3.012,2
11.086,4
4.838,6
2013
7.826,6
2.915,8
10.742,4
4.768,3
2. Profilo aziendale
I valori sono espressi in migliaia di euro
Tabella 4 Valore degli emolumenti corrisposti dall’Università a personale tecnicoamministrativo in convenzione, anni 2011-2013
Anno
2011
Lordo
2.355,3
Oneri riflessi
910,7
Totale
3.266,1
Netto
1.611,3
2012
2.290,9
887,2
3.178,2
1.553,7
2013
2.068,9
802,5
2.871,4
1.474,2
I valori sono espressi in migliaia di euro
Passando a considerare i rapporti di fornitura che l’Azienda intrattiene con il territorio, si conferma nel
2013 che oltre un quinto (20,9%) dei beni e servizi acquistati (nelle classi di bilancio: acquisto di beni,
38
acquisto di servizi sanitari, acquisto di servizi non sanitari, godimento di beni di terzi, oneri diversi di
gestione) ha interessato il territorio provinciale.
Tabella 5 Volume dei beni e servizi acquistati da aziende dell'ambito territoriale e della
regione, anni 2011-2013
Anno 2011
Anno 2012
Anno 2013
Ambito territoriale di Parma
€ 35.120,8
€ 33.020,6
€ 34.145,8
Resto della Regione Emilia-Romagna
€ 10.717,6
€ 9.825,6
€ 10.292,7
Totale Regione
€ 45.838,4
€ 42.846,2
€ 44.438,5
Non sono comprese le sopravvenienze passive
I valori sono espressi in migliaia di euro
L'importo complessivo del 2013 relativo alle classi di beni e servizi indicate ammonta a 163.377,0
migliaia di euro, complessivamente considerato, l'ambito regionale rappresenta circa il 27,20% del
totale, mentre era 26,6% nel 2012.
Impatto sociale e culturale
La dimensione sociale del ruolo svolto dall’Azienda nel contesto territoriale viene rilevata attraverso
indicatori indiretti, come, ad esempio, i lasciti e le donazioni che possono essere assunti come segnali del
riconoscimento della funzione sociale che i cittadini e le realtà economiche del territorio riconoscono
all’Ospedale.
Nel corso dell’anno 2013, l’Azienda ha ricevuto 112 contributi tra donazioni e lasciti. Il numero maggiore
di donazioni (69) proviene da singoli cittadini. Trenta sono invece le donazioni pervenute da associazioni,
1 da scuole e 13 da imprese, fondazioni o enti.
Il valore economico della generosità di tante persone si aggira intorno ai 812 mila euro, cui vanno
aggiunte donazioni di attrezzature sanitarie, di arredi ed attrezzature informatiche per un valore
complessivo di 446.340 euro, da parte di singoli cittadini, associazioni ed imprese.
Il legame tra Azienda e tessuto sociale si esprime nelle varie iniziative provenienti dal contesto territoriale
e dal volontariato che contribuiscono a creare continuità tra tempi di vita e tempi di cura. Si tratta di una
fitta e intensa rete di relazioni e iniziative. Vi sono a riguardo diversi spunti in tutto il volume, in
particolare richiamiamo la collaborazione con il Comitato Unico di Garanzia sia per la formazione degli
operatori sanitari in tema di accoglienza alle donne vittime di violenza sia per l’approfondimento sui temi
della medicina di genere (di cui si tratta in modo più approfondito nei capitoli 3, 4 e 5), il Giardino dei
sorrisi la “Biblioteca Trova Pensieri” e il “Giardino riabilitativo dell’Ospedale”, iniziative presentate nel
capitolo 5 del volume. Inoltre, l’Azienda partecipa attivamente alle iniziative della Prefettura di Parma per
la revisione del protocollo di intesa per la prevenzione e il contrasto della violenza di genere.
Tuttavia per dare adeguata evidenza a questa ricca trama non sarebbero probabilmente sufficienti le
pagine di questo volume.
Considerato il contesto specifico e il fine istituzionale di questa rendicontazione si evidenzia, anche per il
2013, l’impegno della Scuola in ospedale, punto di riferimento e di continuità che testimonia azioni,
iniziative e sinergie che si situano sul crinale fra dimensione sociale e culturale.
La Scuola in Ospedale
L’anno scolastico 2012/2013 ha visto l’inaugurazione del Nuovo Ospedale dei Bambini e quindi il trasloco
anche della Scuola in Ospedale nella nuova struttura.
Nell’anno scolastico 2012-2013 la Scuola in Ospedale ha impegnato 4 docenti di scuola primaria e 4
docenti di scuola secondaria di primo grado, tutti appartenenti all’Istituto Comprensivo “G. Ferrari”.
39
2. Profilo aziendale
Oltre a strumentazioni sanitarie di vario genere, le donazioni riguardano anche aspetti meno tangibili
come il mettere a disposizione risorse di tipo relazionale, o le iniziative per rendere meno difficili periodi
particolari come le feste di Natale (con la distribuzione di doni ai piccoli ricoverati cui ha contribuito la
Fondazione Cassa di Risparmio o con gli auguri portati dalla squadra di rugby delle Zebre) e le varie
attività ludiche e ricreative proposte ai giovani pazienti in diversi momenti. Non è, comunque, possibile
misurare attraverso questi dati il reale valore, in termini di fiducia e di impegno, del coinvolgimento di
tante persone verso l’ospedale cittadino.
L’attività è ufficialmente riconosciuta dal Ministero della Pubblica Istruzione e permette ai bambini, in
particolare a quelli costretti a lunghi periodi di degenza, di non perdere anni scolastici, né il contatto con
la classe di appartenenza e di esercitare appieno il diritto costituzionale relativo all’assolvimento
dell’obbligo scolastico. Le insegnanti della Scuola in Ospedale operano infatti in collegamento con i
docenti della classe di appartenenza del bambino, cercando il più possibile di evitare che il piccolo
ammalato subisca anche gli aspetti secondari della malattia, tra cui quello di essere allontanato dalla sua
classe e dai compagni che, nel frattempo, hanno continuato a svolgere un regolare percorso educativo.
La Scuola in Ospedale nel corso dell’anno scolastico 2012-2013 ha seguito 326 alunni di scuola
secondaria di 1° e 2° grado degenti presso i reparti pediatrici: in particolare 278 bambini e ragazzi con
degenza breve (1-7 giorni), 38 con degenza media (8–15 giorni) e 10 con un periodo di degenza
superiore ai 15 giorni. I bambini della scuola primaria sono stati 352 con degenza breve, 38 con
degenza media e 16 con degenza protratta, per un totale di 406 bambini. Complessivamente, tra
scuola primaria e scuola secondaria, è stato reso un servizio scolastico a 732 alunni.
Per la scelta della metodologia e per i contenuti sono state confermate le linee guida già sperimentate. In
particolare si è cercato di procedere a un’attenta analisi dei bisogni educativi e formativi dell’utenza, in
particolare per i lungodegenti, di adattare continuamente la didattica alle condizioni psico-fisiche
dell’alunno, di utilizzare anche strumenti alternativi al libro di testo (uso del computer, giochi didattici,
schede, eccetera), di contenere in tempi piuttosto brevi le lezioni
frontali a vantaggio di attività pratiche (ricerche su Internet,
fotocopie, visione di filmati, eccetera), di proporre attività
laboratoriali coinvolgenti, di mantenere contatti regolari con le
scuole di appartenenza.
L’attivazione della Scuola non riguarda solo i reparti pediatrici. Le
richieste di intervento arrivano anche da altri reparti specialistici in
cui i bambini sono ricoverati per la patologia che li ha colpiti (tra i
quali la Medicina Riabilitativa, la Rianimazione). I contatti con il
bambino malato e la sua famiglia si stabiliscono immediatamente
dopo il ricovero, in modo da garantire un inserimento nella struttura
ospedaliera meno traumatico possibile, in quanto tra i compiti
principali della scuola ospedaliera vi è quello di favorire
l’accoglienza, presupposto fondamentale per instaurare una
relazione positiva con la struttura, i suoi professionisti e i suoi meccanismi di funzionamento.
Istruzione domiciliare
Nel corso del 2013, è proseguita l’attività del progetto di domiciliazione: la Scuola in Ospedale ha dato il
supporto e l’informazione necessari per l’attivazione e di conseguenza 7 alunni di scuola secondaria di
primo grado, 5 alunni di scuola secondaria di secondo grado e 7 alunni di scuola primaria sono stati
seguiti in Istruzione Domiciliare direttamente dalle scuole di appartenenza.
2. Profilo aziendale
Il progetto è pensato per garantire il diritto allo studio dei ragazzi ospedalizzati e per migliorarne, nel
contempo, la qualità di vita durante la degenza (C.M. 353/98), attenuando l’isolamento degli alunni e
mantenendo il contatto con i compagni e gli insegnanti della scuola di appartenenza. Per questo
particolare aspetto del progetto è fondamentale la cooperazione del personale sanitario nel fornire le
conoscenze utili al fine di ottimizzare l’intervento scolastico domiciliare. La collaborazione si realizza
anche grazie a specifici incontri di équipe medico-psico-pedagogica (primario, medici, caposala, psicologa
di reparto, personale infermieristico e ausiliario, assistente sociale, insegnanti d’Ospedale).
Musica per l’Ospedale dei Bambini
Da alcuni anni la Scuola in Ospedale organizza, in
collaborazione con i reparti dell’area pediatrica, una serata
a ricordo della nascita dell’Ospedale del Bambino,
avvenuta il giorno 9 dicembre 1900. Per l’occasione sono
coinvolti cori, musicisti cittadini e della provincia e, quando
possibile, alunni ospedalizzati. La manifestazione nasce
con l’intento di festeggiare la ricorrenza della fondazione
dell’Ospedale dei bambini, ma soprattutto con lo scopo di
sensibilizzare la cittadinanza alla realtà dei bambini
ospedalizzati. Ogni anno giungono numerose richieste da
40
parte di studenti di scuole esterne per poter partecipare in qualità di artisti. La data della serata
commemorativa di quest’anno è stata il 14 dicembre all’Auditorium
Paganini di Parma. Alla manifestazione musicale ha partecipato Martina
D., un’alunna della Sezione Scolastica Ospedaliera, che si è esibita in una
canzone; inoltre alla serata hanno partecipato anche i ragazzi della
sezione musicale dell’I.C. Ferrari e altre realtà artistiche delle nostre
scuole di Parma. Sponsor della manifestazione è stata l’Associazione VOB
(Volontari Ospedale dei Bambini). La serata è stata organizzata dall’
insegnante di Educazione Musicale Marzia Fusi.
La comunicazione che ci cura
La Scuola in Ospedale si è fatta promotrice, insieme a tutto l’I.C. Ferrari e al Comune di Parma con il suo
Ufficio Stranieri, del Progetto “La comunicazione che ci cura”: una serie di incontri tra operatori di Scuola
in Ospedale, mediatori culturali e realtà ospedaliera.
Molto interessanti e coinvolgenti sono risultate le quattro sessioni dedicate alle varie culture dei paesi
d’origine dei mediatori.
Comenius Regio – Progetto MCS “L’uso significativo, Creativo e sicuro delle Tecnologie nella
didattica”
Anche quest’anno, come negli anni scolastici precedenti, l’Istituto Comprensivo “Ferrari” di Parma e la
sua sezione di Scuola in Ospedale hanno partecipato al progetto di scambi europei Comenius.
Il progetto Comenius mira a contribuire alla costruzione dell’Europa e ad accrescere il senso di
appartenenza all’Unione Europea attraverso lo scambio di informazioni, il confronto metodologico e la
mobilità dei docenti. Gli studenti coinvolti nel progetto saranno incoraggiati a migliorare l’apprendimento
delle lingue straniere attraverso gli scambi culturali e i contatti con le diverse scuole partner.
Il Progetto Comenius Regio MCS (Uso significativo, creativo e sicuro delle tecnologie nella didattica) è un
progetto di cooperazione europea in ambito scolastico, finalizzato allo scambio di esperienze
relativamente all’utilizzo delle nuove tecnologie nella didattica quotidiana.
Il percorso è coordinato dalla Provincia di Parma e dalla Comunidad de Madrid (Spagna), partecipano
anche, oltre alla scuola “Ferrari”, la Direzione Didattica di Fidenza, l’I.C. di Fontanellato e l’I.C. di San
Secondo e alcune scuole spagnole.
In corso d’anno sono stati ospitati docenti delle scuole spagnole partner del progetto, con le quali sono
state realizzate uscite e attività didattiche inerenti al tema.
Progetto “Concordia Magistra Vitae ”
Visto il numero sempre più elevato di ragazzi e ragazze di scuola secondaria di secondo grado, la sezione
scolastica ospedaliera ha realizzato un progetto che coinvolge docenti volontari provenienti dalle diverse
scuole superiori di Parma, provincia e altre città limitrofe, al fine di rispondere a tutte le esigenze
scolastiche dei ragazzi relativamente alle materie ad indirizzo specifico. Attraverso una comunicazione
inviata a tutti i Dirigenti Scolastici delle scuole Superiori di Parma e Provincia, si è arrivati a creare un
elenco di docenti volontari disponibili per l’insegnamento di diverse discipline quali: Latino e Greco,
Chimica, Diritto, Scienze Naturali, Storia e Filosofia, Matematica, Discipline giuridiche ed economiche,
Elettrotecnica, Fisica, Storia dell’Arte.
E’ proseguito anche quest’anno il progetto CONCORDIA MAGISTRA VITAE che ha visto il coinvolgimento
di docenti di Scuola Secondaria di Secondo grado. Nell’anno scolastico 2012/2013 sono stati coinvolti
41
2. Profilo aziendale
Progetto Rigoletto
E’ proseguita anche quest’anno la bella collaborazione con il Teatro Regio di Parma con il Progetto
Rigoletto, un progetto artistico-musicale nato con l’intento di avvicinare e far conoscere l’opera lirica sia
nel contesto musicale sia in tutti quegli aspetti più nascosti legati alla produzione. L’opera protagonista
del progetto è stata “Rigoletto” di Giuseppe Verdi. Sono stati coinvolti, in vari incontri, ragazzi del reparto
di Oncoematologia Pediatrica e una ragazza della Clinica. Due uscite pomeridiane finalizzate alla scoperta
dei luoghi non sempre accessibili al pubblico e legati alla messa in scena di un’opera ( buca dell’orchestra,
sala scenografia, sala trucco, sala attrezzisti ed elettricisti, sartoria, eccetera) e all’incontro con il baritono
Leo Nucci e conoscenza del personaggio Rigoletto
Il progetto si è concluso con la visione dell’opera Rigoletto di G. Verdi inserita nel cartellone per i ragazzi
“ Imparo l’Opera ”.
circa cinque dei docenti in elenco per accompagnare il percorso di studi di sette studenti degenti presso
il reparto di Oncoematologia Pediatrica e di Clinica Pediatrica. Il progetto, coordinato dalla Scuola in
ospedale, si è rivelato un prezioso contributo all’attività didattica svolta dai docenti della Sezione
Secondaria di Primo Grado. I risultati conseguiti dagli alunni sono stati apprezzati dai docenti delle
rispettive scuole di appartenenza, per due di questi la preparazione di quest’anno era finalizzata agli
esami (di maturità classica e di maturità professionale).
Impatto ambientale
L’impatto ambientale e le modifiche all’ambiente derivanti dalle attività, dai prodotti e dai servizi
dell’organizzazione, sia per quanto attiene al prelievo e all’utilizzo di risorse sia in riferimento alla
gestione dei rifiuti, sono sempre più temi di rilievo e di attenzione per le aziende sanitarie.
Le tipologie di interventi messi in atto sono diversificate e riguardano, ad esempio, i rapporti di fornitura,
il patrimonio immobiliare, le politiche del personale (sia con interventi informativi per massimizzare i
comportamenti virtuosi in tema di consumi, mobilità e gestione dei rifiuti, sia con indagini mirate), oltre a
realizzazioni specifiche come il magazzino AVEN per la gestione dei farmaci (presentato nel bilancio di
missione 2009), un progetto di logistica integrata che presenta una grande attenzione al tema della
sicurezza e dell’impatto ambientale.
Politiche per l’uso razionale dell’energia e la corretta gestione ambientale
Politiche per l’uso razionale dell’energia
Si riportano di seguito, in sintesi, le azioni attuate nel corso del 2013 per il perseguimento degli obiettivi
fissati in tema di politiche energetiche.
L’Azienda ha aderito alla gara espletata da Intercent-ER per la fornitura di Energia Elettrica che ha
portato il costo dell’energia elettrica a:
€ 5.411.433,03 nel 2009
€ 5.695.309,36 nel 2010
€ 6.305.493,60 nel 2011
€ 7.730.553,14 nel 2012
€ 7.852.515,02 nel 2013
a fronte di una spesa di € 6.520.762 sostenuta nel 2008.
La tariffa media ponderata dell’energia elettrica ha avuto un calo di circa l’11,47% nel 2013 rispetto al
2012, grazie al nuovo metodo di fornitura a prezzo fisso adottato con la nuova gara.
Sono tuttavia aumentati tutti gli oneri di dispacciamento e distribuzione. Tali oneri, incrementati del
22,75% rispetto al 2012 hanno comportato da soli un incremento di costo di quasi € 450.000,00 su base
annua.
2. Profilo aziendale
È proseguito per tutto il 2013 il monitoraggio mensile dei consumi di acqua potabile e di energia elettrica.
Con riferimento al monitoraggio di energia elettrica nel 2013 si evidenzia un incremento dei consumi dello
4,57% rispetto all’anno precedente, che possiamo ritenere fisiologico conseguentemente all’apertura del
nuovo Ospedale dei Bambini - Pietro Barilla e ai forti carichi di condizionamento estivo.
L’incremento dei consumi elettrici rispetto al 2012 è riferibile prevalentemente ai mesi di gennaio dove si
sono effettuati i collaudi agli impianti dell’Ospedale dei Bambini e ai mesi aprile, luglio, agosto, settembre
e ottobre.
Relativamente ai consumi d’acqua, nel 2013 si è registrato un decremento rispetto al 2012 del 18,5%. La
riduzione dei consumi è attribuibile alla riparazione di perdite occulte avvenute in precedenza.
A seguito dell’aggiudicazione della gara per il “Multiservizio Manutentivo e Servizio Energia per gli
immobili di pertinenza dell’Azienda Ospedaliero-Universitaria di Parma”, sono stati eseguiti i seguenti
interventi di efficientamento:
sono stati installati n. 42 lampioni a led in sostituzione dei vecchi lampioni a vapori di mercurio
sul viale centrale;
sono stati installati degli inverter a servizio delle Torri evaporative della centrale frigorifera per
ottimizzarne i consumi nelle mezze stagioni;
42
è stata prevista l’installazione di contatori dell’acqua fredda su tutti i padiglioni per tenere sotto
controllo i consumi padiglione per padiglione e accertare, per differenza, la presenza di perdite
significative sulla rete di distribuzione. L’installazione è iniziata nel 2013 ed è in fase di
perfezionamento.
Inoltre sono stati effettuati interventi di rimodulazione delle luci negli spazi comuni del Poliblocco per
ridurre il consumo energetico.
È poi prevista nel 2014 l’installazione di contatori sull’acqua calda.
Sono inoltre allo studio ulteriori misure per la riduzione dei consumi, quali:
l’utilizzo di un pozzo per il raffreddamento della centrale frigorifera con acqua di falda, senza
utilizzare acqua del pubblico acquedotto;
l’eliminazione dei ventilatori a servizio delle UTA del padiglione Centrale, piano terra.
Relativamente ai consumi di metano, nel 2013 si è registrato un incremento dei consumi rispetto al 2012,
pari al 7,5%, riportando i consumi ai valori del 2010.
L’incremento è dovuto per il 63% al mese di marzo in cui la temperatura media è stata di circa 7 gradi
inferiore a quella del 2012.
Tabella riepilogativa delle temperature medie mensili e dei corrispettivi consumi di metano dal
2011 al 2013
PERIODO DI RIFERIMENTO
2011
2012
2013
Var. 2012-2013
Tmedia Consumi Tmedia Consumi Tmedia Consumi
DTm Dconsumi
ANNO
14,13
5.433.882
15,04
6.018.541
13,27 6.503.569
485.028
MEDIA GEN
1,72
1.013.074
3,06
1.024.878
2,19
1.114.311 -0,87
89.433
MEDIA FEB
4,51
754.963
1,74
1.035.320
1,92
917.994
0,18
-117.326
MEDIA MAR
8,95
644.062
13,32
548.323
6,52
834.858 -6,80 286.535
MEDIA APR
15,52
360.896
13,31
464.819
13,68
508.450
0,36
43.631
MEDIA MAG
19,78
283.409
18,86
309.366
16,19
333.434
-2,68
24.068
MEDIA GIU
22,18
219.442
25,04
198.887
22,06
220.861
-2,98
21.974
MEDIA LUG
23,60
195.236
26,88
175.537
25,72
225.841
-1,17
50.304
MEDIA AGO
26,21
220.968
27,78
180.155
23,90
233.144
-3,88
52.989
MEDIA SETT
22,17
222.824
20,41
221.878
19,93
257.401
-0,48
35.523
MEDIA OTT
13,47
343.699
15,49
364.720
14,44
378.604
-1,05
13.884
MEDIA NOV
7,09
516.859
10,68
548.026
8,30
575.946
-2,38
27.920
MEDIA DIC
3,78
658.450
2,89
946.632
3,50
902.725
0,60
-43.907
43
2. Profilo aziendale
È stata data applicazione alla normativa nazionale e regionale in materia di rendimento energetico del
patrimonio immobiliare delle Aziende Sanitarie con l’obiettivo di minimizzare l’impatto tecnico economico
e di massimizzare il risparmio energetico.
È stata aggiudicata la gara per il “Multiservizio Manutentivo e Servizio Energia per gli immobili di
pertinenza dell’Azienda Ospedaliero-Universitaria di Parma”. L’appalto ha per oggetto tra l’altro la
progettazione definitiva/esecutiva, la realizzazione e la successiva manutenzione di un impianto di
cogenerazione “chiavi in mano”, progettato per funzionare in servizio continuativo con gas naturale,
idoneo per il funzionamento in parallelo alla rete elettrica. La potenza elettrica nominale complessiva del
progetto presentato è di 2.826 kW elettrici e prevede una produzione elettrica minima da cogeneratore di
19.000 MWh/annui, pari a quasi il 45% del fabbisogno dell’azienda.
È stata garantita la costante partecipazione al Gruppo Regionale Energia e la compilazione del sistema del
monitoraggio AEM regionale.
È proseguita la campagna sensibilizzazione, informazione e orientamento rivolta agli operatori
dell’Azienda ponendo particolare attenzione alle segnalazioni e suggerimenti da parte dei dipendenti
trasmessi con l’indirizzo e-mail [email protected] .
Allo scopo è stato anche organizzato un seminario di formazione relativamente alle politiche per l’uso
razionale dell’energia e il rispetto ambientale (16 e 21 ottobre 2013 – 21 novembre 2013).
In occasione della XXII Conferenza Internazionale tenutasi a Barcellona (23-25 aprile 2014) promossa
dalla rete Health Promoting Hospital dell'Organizzazione Mondiale della Sanità è stata presentata
l’esperienza “Interventi di efficientamento energetico dell’Azienda Ospedaliero-Universitaria di Parma”
(Energy efficiency measures into the University Hospital of Parma).
2. Profilo aziendale
Gestione rifiuti
La gestione dei rifiuti all’interno del sistema ospedale rappresenta argomento di particolare rilevanza
sia per le implicazioni in termini di sicurezza degli operatori ed utenti, sia di impatto ambientale sul
territorio (estensione dell'area ospedaliera, numero di accessi, prestazioni e servizi erogati, alta
specializzazione, numero di presenze di personale sanitario e non impiegato nei vari reparti e servizi,
eccetera) e, soprattutto, di costi gestionali sostenuti per la raccolta e smaltimento.
I dati di produzione annuale, uniti alle importanti dimensioni della nostra realtà aziendale, determinano
la necessità di un presidio costante di tale articolata e complessa tematica, al centro delle politiche
interne gestionali, in piena sintonia con le linee di indirizzo regionale per la Gestione dei Rifiuti e degli
scarichi idrici nelle aziende sanitarie dell’Emilia-Romagna (D.G.R. 27 luglio 2009, n. 1155).
Risultati raggiunti
Nel corso del 2013, tra le attività di vigilanza poste in essere, in tema di sicurezza igienica ambientale,
particolare rilevanza riveste la gestione dei rifiuti prodotti in ambito aziendale, intesa come presidio di
tutte le fasi, dalla produzione allo smaltimento del rifiuto.
In tale ambito, è stata assicurata la partecipazione costante dei Referenti aziendali agli incontri
periodici del Gruppo Regionale Rifiuti Sanitari, al fine di allineare la programmazione locale, attuata
tramite il Gruppo Aziendale Gestione Ambientale, alle linee di indirizzo regionali.
Si è provveduto a diffondere la procedura aziendale “La gestione dei rifiuti sanitari e/o provenienti da
attività sanitarie” redatta sulla base del D.G.R. 1155/2009, in cui sono state affrontate le modalità di
gestione di tutti i rifiuti derivanti dalle attività in essere nella nostra Azienda.
E’ proseguito il monitoraggio e la verifica delle attività legate alla corretta gestione dei rifiuti. Sono
44
45
2. Profilo aziendale
stati realizzati 110 sopralluoghi, sia presso le unità operative/servizi, sia nei punti di raccolta
centralizzati. In esito alle verifiche sono state effettuate le relative segnalazioni delle eventuali “non
conformità” rilevate ai servizi competenti aziendali, alle unità operative e alle Ditte coinvolte nella
gestione dei rifiuti, nel rispetto dei vincoli contrattuali in essere.
E’ stato dato ulteriore impulso alla raccolta capillare di alcune matrici oggetto di raccolta
differenziata (es. carta e plastica), incrementando sia le postazioni per la raccolta decentrata sia
quelle centralizzate. Non è possibile fornire dati precisi sulle quantità raccolte rispetto a tali matrici,
in quanto il ritiro è effettuato nell’ambito della raccolta urbana, a cura della ditta incaricata
sull’intero territorio comunale. Pur non disponendo dei dati precisi, si ritiene opportuno precisare
che nel corso del 2013 è stato riscontrato un aumento delle quantità conferite, in quanto è stato
necessario richiedere il potenziamento della vuotatura dei contenitori posizionati sul territorio
aziendale ampliando le frequenze di intervento previste originariamente (da tri-settimanale a
quotidiana).
Sempre per quanto concerne la raccolta differenziata, sono stati implementati ulteriori punti di
raccolta decentrati per toner, pile e batterie esauste, eccetera.
Il controllo e monitoraggio della quantità di rifiuti prodotti, del loro destino e dei costi sostenuti è
stato mantenuto e consolidato. Si è provveduto a garantire l’invio in Regione dei dati di produzione
dell’anno 2012, per singolo CER prodotto, tramite inserimento nell’apposito programma informatico
predisposto da CUP 2000- Monitoraggio AEM (Ambiente Energia e Mobilità) – nel rispetto dei
tempistiche declinate a livello regionale. I dati inseriti nel 2013 sono relativi alla produzione
dell’anno 2012 e quelli dell’anno 2013 saranno disponibili a breve, al termine della dichiarazione
MUD.
Nel corso dell’anno è avvenuta l’assegnazione della nuova gara per la raccolta, trasporto e
smaltimento dei rifiuti sanitari non a rischio infettivo, pericolosi e non.
Si è reso pertanto necessario regolamentare, con la nuova Ditta assegnataria, le modalità di
gestione delle tipologie di rifiuti ricomprese nel capitolato di gara. Sono state pertanto realizzate
diverse attività correlate (incontri per definire tipologie di contenitori, mappatura delle UO oggetto
di produzione, sopralluoghi, redazione procedure ed istruzioni operative, comunicazione percorsi
aziendali, comunicazione interna nuove modalità di gestione, eccetera) utili all’implementazione
della raccolta puntuale a livello aziendale. A completamento della documentazione aziendale già in
essere, sono state realizzate apposite procedure per la gestione e lo smaltimento dei pace-maker,
neurostimolatori e RAEE. Nell’ambito della contratto di fornitura del servizio, si è provveduto ad
aggiornare il “Protocollo aziendale in caso di contaminazione ambientale accidentale da sostanze
chimiche” ed ad adeguare il relativo Kit di pronto intervento, in collaborazione con il SPPA.
L’apertura del nuovo Ospedale dei Bambini P. Barilla e la ricollocazione dei Reparti/Servizi pediatrici
all’interno della nuova struttura hanno richiesto la definizione dei percorsi “pulito-sporco”, dei punti
di stoccaggio rifiuti all’interno delle UUOO e a piè di Padiglione, l’organizzazione della gestione delle
tipologie di rifiuti prodotti nella struttura e le attività di controllo e verifica, soprattutto in fase
iniziale, delle disposizioni gestionali impartite. L’occasione ha permesso di ridefinire all’interno delle
singole UUOO il processo di gestione dei rifiuti e di incrementare la raccolta differenziata dei rifiuti,
con particolare riferimento a carta, plastica, pile.
In collaborazione con i Referenti Regionali, sono stati realizzati alcuni incontri interaziendali (AOSP,
l’AUSL di Parma ed il Comune) ai fini di promuovere la collaborazione fra Aziende Sanitarie ed Enti
locali e confrontarsi sui temi legati alle politiche di gestione ambientale (rifiuti, energia, e mobilità
sostenibile) sul territorio.
Dai vari Referenti Aziendali, sono state presentate una serie di proposte, tra cui per la nostra azienda,
l’installazione di sistemi di trattamento al punto d’uso di acqua di rete refrigerata in alternativa alla
bottiglie di acqua minerale. Tale proposta ha trovato la sua realizzazione, nell’ambito del contratto di
Ristorazione Collettiva e la Ditta fornitrice del servizio. Il sistema è stato installato nella mensa
aziendale ed è in funzione dal mese di agosto. Il gradimento dell’iniziativa da parte del personale è
stato buono.
La nostra Azienda, unitamente all’AUSL di Piacenza, è stata selezionata in ambito AVEN per la
realizzazione di un audit specifico sulle metodologie e procedure di gestione dei rifiuti adottate nelle
Strutture Sanitarie. L’audit è stato realizzato nei mesi di ottobre-novembre, in collaborazione con i
Professionisti di Marsh Consulting SpA.. Nell’ambito delle attività di Risk Management, è stata
realizzata la valutazione dei metodi e delle procedure di gestione dei rifiuti, l’individuazione di eventuali
“non conformità” alle disposizioni di legge vigenti e la formalizzazione di proposte di adeguamento alle
“best practices” di settore. La relazione sull’esito delle verifiche effettuate è stato complessivamente
soddisfacente.
2. Profilo aziendale
In linea con le politiche regionali, per il contenimento e la riduzione della produzione di RSPRI, per
l’anno in corso si è privilegiata la formazione del personale. A tal proposito, tra ottobre e dicembre
2013, sono stati effettuati 3 corsi di aggiornamenti dal titolo “La gestione dei rifiuti sanitari –
Approfondimenti”, rivolti al personale dipendente (sanitario, tecnico ed amministrativo) ma aperti
anche agli esterni, con il fine di diffondere i contenuti della procedura aziendale “La gestione dei rifiuti
sanitari e/o provenienti da attività sanitarie”, di approfondire le problematiche dei rifiuti chimici e
radioattivi ed illustrare nel dettaglio le politiche di Mobility ed Energy management in essere. Al corso
hanno partecipato 300 operatori sanitari.- Complessivamente, tra 2010 ed il 2013, sono stati formati
oltre 780 Professionisti.
Dal 1 Ottobre 2013 il sistema SISTRI (Sistema Informatizzato sulla tracciabilità dei Rifiuti) è entrato
nell’operatività per i Gestori (trasportatori, smaltitori, recuperatori), con l’implementazione del
cosiddetto “sistema binario” e cioè l’inizio di un periodo transitorio di adeguamento tra gli adempimenti
cartacei, tuttora in vigore, ed nuovi adempimenti informatici. A proposito, è stato predisposto il
controllo delle “nuove schede”, compilate dal trasportatore, ed organizzata l’archiviazione. Per quanto
riguarda invece l’applicazione del SISTRI per i Produttori iniziali, quali le Aziende Sanitarie, ha subito
nell’anno continui rinvii, sino ad essere protratto al 3 marzo 2014.
Il continuo aggiornamento dei Manuali di Riferimento, sul sito del Ministero dell’Ambiente, ha
comportato la revisione periodica delle procedure per l’implementazione del sistema a livello aziendale
e la partecipazione a giornate di informazione/formazione per approfondire le implicazioni
organizzativo-gestionali, e gli aspetti sanzionatori per mancata/incompleta adesione alle disposizioni
legislative.
Per quanto riguarda le politiche aziendali volte a favorire l’acquisizione di dispositivi medici riutilizzabili
vs quelli monouso, l’Azienda ha ritenuto di valutare caso per caso, rispetto a un’attenta analisi
costi/benefici.
Interventi in fase di sviluppo o in corso
Eventuali problematiche
In linea con la normativa di riferimento, D.M. 17 dicembre 2009 e ss.mm.ii., riscontrate
si è provveduto a predisporre le azioni necessarie per rendere operativo Normativa
SISTRI
l’adeguamento, a livello aziendale, del Sistema informatizzato del controllo particolarmente
e tracciabilità dei rifiuti – SISTRI. In particolare sono in fase di sviluppo le complessa. Si rimane in
seguenti attività:
attesa di ricevere dal
partecipare ai corsi di aggiornamento sulla tematica ed agli incontri Ministero
presso l’Agenzia Sanitaria e Sociale Regionale per chiarire e approfondire aggiornamenti
tutti gli aspetti legati all’introduzione e all’impiego del nuovo sistema,
migliorativi.
aggiornamento del dispositivo USB per il collegamento al sistema
SISTRI,
La prevista adesione
realizzare incontri con le ditte che gestiscono i rifiuti in ambito aziendale alla gara Intercenter
per risolvere le criticità correlate all’applicazione del sistema, con per lo smaltimento dei
particolare riguardo ai nuovi adempimenti amministrativi legati alle rifiuti pericolosi non a
modalità di ritiro, movimentazione e smaltimento dei rifiuti sanitari rischio
infettivo
pericolosi (schede movimentazione, area registro cronologico, eccetera) richiederà
una
che andranno progressivamente a sostituire la documentazione cartacea riorganizzazione
del
(FIR – Registro di carico/scarico),
servizio di raccolta dei
predisporre un deposito idoneo per la raccolta temporanea dei rifiuti rifIuti
chimici:
sarà
sanitari pericolosi a rischio chimico,
infatti
necessario
realizzare le specifiche procedure per consentire la messa a regime del implementare
la
sistema, aggiornate più volte nell’arco dell’anno alla luce delle continue raccolta dalle UUOO
modifiche apportate a livello centrale,
attualmente ricompresa
formare / aggiornare gli operatori amministrativi delegati all’inserimento nei nostri contratti in
dei dati nel sistema SISTRI,
essere e non presenti
predisporre apposita documentazione riguardante i dati utili alla nel nuovo capitolato
compilazione delle schede di movimentazione dei rifiuti, in collaborazione intercent-ER.
con le Ditte coinvolte, in modo da agevolare gli operatori incaricati
dell’inserimento dati.
Risulta
indispensabile
Stanno proseguendo le attività correlate alla gestione degli scarichi idrici, prevedere
la
con particolare riferimento ai reflui prodotti dai laboratori. Si ipotizza di realizzazione di un’isola
svolgere analisi sui reflui di laboratorio smaltiti come rifiuti per verificare la ecologica aziendale, in
classificazione, ai fini dello smaltimento. Tale attività risulta particolarmente cui convogliare tutti i
complessa anche in relazione all’elevato numero di apparecchiature di rifiuti in attesa dello
laboratorio in dotazione, ai continui cambiamenti, dovuti al rinnovo del parco smaltimento, al fine di
46
attrezzature e ai nuovi contratti in essere (in service). I Referenti aziendali,
nell’ambito del Gruppo Rifiuti RER, hanno dato la loro disponibilità a
partecipare ad un gruppo di lavoro che si occuperà di approfondire tale
tematica.
decongestionare
gli
attuali punti di raccolta
decentrati a piè di
Padiglione
Tenendo contro delle scadenze contrattuali relative al Global Service
Economale, si sta valutando la possibilità di sostituzione dei contenitori
monouso con quelli riutilizzabili, per il contenimento della produzione di
RSPRI.
E’ in corso in Azienda il processo di riduzione del consumo di carta attraverso
la dematerializzazione e la revisione della modulistica.
2.3 Contributo alla copertura dei livelli essenziali di
assistenza
Costo pro-capite per livello di assistenza
Per valutare il livello di efficienza e l’allocazione delle risorse vengono effettuate elaborazioni dei costi
pro-capite per livello di assistenza calcolati come rapporto tra il costo per livello e sub livello e la
popolazione di riferimento per la determinazione del finanziamento del livello stesso (ossia la popolazione
nel contesto territoriale opportunamente pesata).
I costi pro-capite sono l'espressione delle risorse destinate al soddisfacimento dei bisogni sanitari della
popolazione, la loro analisi è finalizzata a produrre informazioni sulle performance delle Aziende USL e ad
un confronto fra le Aziende stesse e la media regionale.
A partire dal costo pro-capite 2011 i costi delle Aziende Usl sono stati integrati con la quota di costo
eccedente il valore del ricavo derivante dalla produzione delle Aziende Ospedaliere al fine di evitare la
sottostima dei costi complessivi del sistema regionale, che con la precedente metodologia si evidenziava
soprattutto negli ambiti provinciali, come quello di Parma, nel cui territorio è presente l’Azienda
Ospedaliera.
Dall’analisi dei dati (tabella 1), emerge un lieve incremento dei valori economici rispetto al 2011 (0,68%)
del sistema provinciale di Parma. Il costo pro-capite è in linea con la media regionale.
I livelli di assistenza ai quali l’Azienda Ospedaliero-Universitaria di Parma ha fornito, nel 2012, il suo
contributo nell’erogazione delle prestazioni sono da riferirsi a:
degenza ospedaliera, con il 75% dei posti letto per acuti pubblici della provincia;
assistenza distrettuale, sub livello assistenza specialistica, con l’erogazione del 60% del valore
complessivo della produzione provinciale;
assistenza distrettuale, sub livello emergenza extraospedaliera, con la gestione della Centrale
Operativa 118.
Anno 2011
Anno 2012
Var. %
costi
Azienda Costi livello Popolazione Costo pro- Costi livello Popolazione Costo pro- livello
2012/
(K€)
pesata
capite
(K€)
pesata
capite
2011
Usl Pr
Var. %
Var. %
Diff. costo
pop.
costo propro-capite
pesata
capite
2012/
2012/
2012/
2011
2011
2011
824.660
446.091
1.848,64
830.277
448.693
1.850,43
0,68
0,58
0,10
1,80
Media RER 8.227.437
4.432.439
1.856,19
3.232.032
4.459.246
1.846,06
0,06
0,60
-0,55
-10,13
Fonte: Area riservata BdM
Assistenza collettiva in ambiente di vita e di lavoro
Nel corso del 2013 l’Azienda Ospedaliero-Universitaria ha contribuito allo sviluppo dei programmi
regionali di screening per la prevenzione del tumore della mammella, del tumore del collo dell’utero e del
tumore del colon retto.
47
2. Profilo aziendale
Tabella 1 Costo pro-capite ponderato, confronto con costo pro-capite medio regionale - anni
2011-2012 (con quota parte del finanziamento erogato alle Aziende Ospedaliere del territorio)
Assistenza distrettuale
Assistenza farmaceutica
L’andamento dei consumi e dei costi relativi per farmaci suddivisi per categoria terapeutica, come da
classificazione ATC (Classificazione Anatomico Terapeutica Chimica), è presentato nel confronto tra 2012
e 2013 (tabella 2). In particolare la categoria dei farmaci “Antineoplastici ed Immunomodulatori” (ATC L)
ha fatto registrare nel 2013 un aumento della spesa del 4% rispetto a quella del 2012. Tale incremento è
in parte correlato all’immissione in commercio di farmaci oncoematologici innovativi ad alto costo per
stadi avanzati/metastatici della malattia, ad un aumento della casistica e a trattamenti di più lungo
periodo.
La categoria dei “Farmaci del sangue” (ATC B) ha fatto registrare un aumento della spesa rispetto al 2013
con particolare riferimento al trattamento di pazienti emofilici critici.
La categoria dei farmaci per “Organi di senso” (ATC S) ha registrato un forte aumento di spesa derivante
dai trattamenti intravitreali con Lucentis (ranibizumab) in seguito alle disposizioni di AIFA che hanno
sostanzialmente modificato l’orientamento prescrittivo di fatto escludendo la terapia intravitreale con
Avastin (bevacivumab) a costi rilevantemente più bassi.
Si sono registrati risparmi nelle categorie dei farmaci del “Sistema nervoso” (ATC N) e del “Sistema
muscolo scheletrico” (ATC M) anche come conseguenza delle scadenze brevettuali e dell’immissione in
commercio di farmaci generici con una complessiva riduzione dei costi.
Tabella 2 Costi e consumi medicinali e altri prodotti terapeutici classificati in base all’ATC,
confronto anni 2012 e 2013
ATC
L
J
B
Descrizione
Farmaci antineoplastici e
immunomodulatori
Antimicrobici generali per
uso sistemico
Sangue e organi
emopoietici
S
Organi di senso
V
Vari
N
A
M
Sistema nervoso
Apparato gastrointestinale
e metabolismo
Sistema muscoloscheletrico
R
Sistema respiratorio
C
Sistema cardiovascolare
H
G
Preparati ormonali
sistemici, esclusi gli
ormoni sessuali
Sistema genito-urinario e
ormoni sessuali
diff. % unità
2013-2012
2013
2012
267.626
279.029
1.662.623
Valore economico
diff. %
valore 20132012
2013
2012
-4%
15.629.709
14.853.084
5%
1.732.161
-4%
9.774.456
9.771.320
0%
2.713.549
2.692.666
1%
4.506.077
4.025.500
12%
65.255
88.332
-26%
1.461.295
602.928
142%
165.796
165.562
0%
926.604
982.719
-6%
1.200.491
1.139.018
5%
691.198
874.458
-21%
1.418.087
1.455.152
-3%
590.106
894.689
-34%
368.836
370.848
-1%
423.773
614.315
-31%
290.659
273.835
6%
342.768
342.426
0%
1.536.331
1.529.721
0%
173.917
179.923
-3%
405.084
397.863
2%
127.787
151.681
-16%
80.936
82.493
-2%
118.881
147.425
-19%
D
Dermatologici
51.683
40.555
27%
89.363
70.038
28%
P
Farmaci antiparassitari,
insetticidi e repellenti
44.426
42.780
4%
33.113
25.106
32%
10.271.382
10.140.834
0%
34.889.047
33.535.612
4%
Totale
2. Profilo aziendale
Numero unità
Non sono presenti i farmaci privi di classificazione ATC (es. farmaci galenici, farmaci esteri)
N.B.: i valori economici sono al netto dell’IVA
Nel 2013 l’attività di prescrizione ed erogazione di farmaci a pazienti in dimissione dai reparti e dai servizi
dell’Azienda si è ulteriormente consolidata e ha raggiunto un numero di pazienti assistiti pari a 20.026
con 1.844.851 unità posologiche erogate. L’attività ha generato la virtuosa induzione della prescrizione
sul territorio secondo le regole di appropriatezza d’uso dei farmaci consolidate ed affermate all’interno
della struttura ospedaliera.
Per il 2013 il risparmio del SSN è compreso nell’intervallo tra 1.160.732 € e 1.057.517 € (l’intervallo tra i
valori min-max è stimato in relazione alle differenti tipologie di farmacie sul territorio/fatturato secondo i
parametri di scontistica pubblicati da Federfarma).
48
Per quanto riguarda i farmaci in compensazione, l’importo complessivo erogato è stato nel 2013 pari a
24.124.918 € iva compresa.
Assistenza specialistica ambulatoriale
L’Azienda Ospedaliero-Universitaria di Parma è uno dei fornitori di prestazioni di specialistica
ambulatoriale a livello provinciale (pubblico e privato accreditato). Nel 2013 il contributo dell’Azienda alla
produzione provinciale è stato pari al 60%.
L’attività erogata in regime ambulatoriale ha subito una lieve flessione rispetto all’anno precedente
(-2%).
Per quanto riguarda le prestazioni di laboratorio, il contributo dell’Azienda è complessivamente pari al
69%. In tali prestazioni è compresa l’attività di assorbimento dei punti prelievo cittadini dell’Azienda
Territoriale, la cui attività nel 2013 ha registrato una riduzione in termini di numero di prestazioni e di
valore economico.
Tabella 3 Valori e volumi della produzione dell’Azienda sul totale del valore e volumi della
produzione provinciale (pubblico e privato accreditato), anno 2010
Vedi appendice capitolo - 2 pag. III
Tabella 4 Valori e volumi della produzione dell’Azienda sul totale del valore e volumi della
produzione provinciale (pubblico e privato accreditato), anno 2011
Vedi appendice capitolo - 2 pag. IV
Tabella 5 Valori e volumi della produzione dell’Azienda sul totale del valore e volumi della
produzione provinciale (pubblico e privato accreditato), anno 2012
Vedi appendice capitolo - 2 pag. V
Grafico 1 Incidenza % delle prestazioni AOU sul numero totale provinciale, anni 2011-2013
80%
70%
60%
50%
2011
40%
2012
30%
2013
20%
10%
0%
Diagnostica
Laboratorio
Riabilitazione
Prestazioni
Terapeutiche
Visite
49
2. Profilo aziendale
Fonte: Banca Dati ASA - RER
Grafico 2 Incidenza % del valore economico prestazioni AOU sul totale provinciale, anni 20112013
90%
80%
70%
60%
50%
2011
40%
2012
30%
2013
20%
10%
0%
Diagnostica
Laboratorio
Riabilitazione
Prestazioni
Terapeutiche
Visite
Fonte: Banca Dati ASA - RER
Valore e volumi delle prestazioni critiche (su totale produzione provinciale)
Relativamente alle prestazioni critiche, l’Azienda nel 2013 ha mantenuto intorno al 30% il proprio
contributo alla produzione provinciale in relazione al volume delle prestazioni erogate. L’Azienda è infatti
impegnata a garantire un alto livello di offerta di prestazioni ad elevata complessità, oltre che nella
continua e fattiva collaborazione con l’Azienda territoriale su temi quali l’appropriatezza prescrittiva.
Tabella 6 Volumi e valore delle prestazioni critiche e % sul totale della produzione provinciale,
anni 2011-2013
Prestazioni erogate
Azienda OspedalieroUniversitaria Parma
Valore della produzione
% sul totale
della
produzione
provinciale
Totale
aziendale
% sul totale della
produzione
provinciale
2011
145.761
31%
7.155.672
39%
2012
186.475
31%
8.860.592
37%
2013
178.559
30%
8.629.656
35%
Totale
aziendale
Fonte: Area riservata BdM
Grafico 3 Percentuale prestazioni critiche erogate sul totale provinciale (volumi e valori), anni
2011-2013
Prestazioni
erogate
45%
40%
Valore della
produzione
2. Profilo aziendale
35%
30%
25%
20%
15%
10%
5%
0%
2011
2012
2013
Fonte: Area riservata BdM
50
Percorsi di Day Service (DSA1 e DSA2)
L’Azienda, al fine di razionalizzare i percorsi dei pazienti e ottimizzare le risorse a disposizione, in
adesione alle disposizioni regionali e a quanto programmato nel Piano Attuativo Locale, ha attivato anche
nel 2013 percorsi di Day Service Ambulatoriale di diverso livello e specifici per patologia per un totale di
44.061 prestazioni.
Indice di performance effettivo per visite e diagnostica (prestazioni
programmabili)
L’indice di performance delle prestazioni programmabili nel triennio 2011-2013 presenta delle differenze
per le diverse tipologie di aggregazioni (grafici 4 e 5, tabella 10).
Diagnostica: l’indice di performance per le prestazioni erogate garantisce il 69% delle prestazioni
entro i 60 giorni, in linea con la media regionale (69,36%).
Laboratorio: l’indice di performance nel 2013 è in incremento rispetto all’anno precedente sia per le
prestazioni erogate entro i 30 giorni che per quelle erogate entro i 60 giorni.
Riabilitazione: nel triennio, l’indice per le prestazioni di riabilitazione ha subito un decremento
registrando nel 2013 valori del 41% entro i 30 giorni dalla prenotazione e il 73% per le prestazioni
erogate entro i 60 giorni.
Terapeutiche: nel 2013 si è assistito ad un decremento dell’indice di performance per le prestazioni
terapeutiche entro i 30 e i 60 giorni;
Visite: l’indice di performance 2013, sia per le visite erogate entro i 30 giorni dalla prenotazione che
per quelle erogate entro i 60 giorni, registra una flessione rispetto all’anno precedente.
Tabella 7 Casistica programmata a carico del S.S.N. - escluso PS e OBI, anno 2011
Vedi appendice capitolo 2 - pag. VI
Tabella 8 Casistica programmata a carico del S.S.N. - escluso PS e OBI, anno 2012
Vedi appendice capitolo 2 - pag. VI
Tabella 9 Casistica programmata a carico del S.S.N. - escluso PS e OBI, anno 2013
Vedi appendice capitolo 2 - pag. VI
Tabella 10 Tempi di attesa effettivi per le prestazioni ambulatoriali programmabili a carico del
SS.N. - % prestazioni erogate da Azienda Ospedaliero-Universitaria di Parma, anni 2011-2013
2011
2012
2013
Tipologia prestazioni % entro % entro % entro % entro % entro % entro
1-30 gg 1-60 gg 1-30 gg 1-60 gg 1-30 gg 1-60 gg
Totale diagnostica
50,6
74,39
49,57
74,42
49,17
68,67
Totale laboratorio
87,01
92,72
88,35
93,53
89,26
94,7
Totale riabilitazione
55,93
82,76
41,98
75,22
41,27
72,62
Totale terapeutiche
64,49
81,96
69,76
83,08
65,52
79,87
Totale visite
55,35
78,62
56,21
78,95
48,23
73,77
51
2. Profilo aziendale
Fonte: Banca Dati ASA
Grafico 4 Azienda Ospedaliero-Universitaria di Parma tempi di attesa % prestazioni
entro 30 giorni, anni 2011-2013
Diagnostica
100%
90%
80%
Laboratorio
Riabilitazione
70%
60%
50%
Terapeutiche
Visite
40%
30%
20%
10%
0%
2011
2012
2013
Fonte: Banca Dati ASA
Grafico 5 Azienda Ospedaliero-Universitaria tempi di attesa % prestazioni entro 60 giorni,
anni 2011-2013
Diagnostica
100%
Laboratorio
90%
Riabilitazione
80%
70%
Terapeutiche
60%
Visite
50%
40%
30%
20%
10%
0%
2011
2012
2013
Fonte: Banca dati ASA
Contributo alla copertura dei Livelli essenziali di assistenza
2. Profilo aziendale
Nel corso del 2013 in Azienda sono state erogate 37.531 prestazioni ambulatoriali in regime di libera
professione intramoenia che rappresentano l’1% del volume complessivo di prestazioni specialistiche. Il
valore percentuale dell’attività ambulatoriale resa in regime libero professionale si mantiene
sostanzialmente stabile rispetto al 2012.
52
Tabella 11 Volumi della produzione in istituzionale e in libera professione, anno 2012
Azienda Ospedaliero-Universitaria di Parma
N°
N° prestazioni % prestazioni
prestazioni
SSN
SSN
LP
Dipartimento Emergenza
Urgenza
Dipartimento Onco-Ematologico
Internistico
Dipartimento Medico
Polispecialistico
Dipartimento Geriatrico e
Riabilitativo
Dipartimento Neuroscienze
% prestazioni
LP
Totale
prestazioni
108.048
99%
834
1%
108.882
290.693
98%
5.480
2%
296.173
113.588
99%
1.426
1%
115.014
34.728
98%
832
2%
35.560
32.378
93%
2.592
7%
34.970
Dipartimento Chirurgico
109.393
94%
6.396
6%
115.789
Dipartimento Testa-Collo
100.317
95%
5.706
5%
106.023
Dipartimento Materno-Infantile
Dipartimento Cardio-NefroPolmonare
Dipartimento Radiologia e
Diagnostica per immagini
Dipartimento Patologia e
Medicina di Laboratorio
Totale
127.756
94%
8.527
6%
136.283
88.152
96%
3.776
4%
91.928
140.615
99%
836
1%
141.451
2.818.700
100%
2.713
0%
2.821.413
3.964.368
99%
39.118
1%
4.003.486
Fonte: Banca dati aziendale, attività specialistica ambulatoriale
Tabella 12 Volumi della produzione in istituzionale e in libera professione, anno 2013
Azienda Ospedaliero-Universitaria di Parma
N°
N° prestazioni % prestazioni
prestazioni
SSN
SSN
LP
Dipartimento Emergenza
Urgenza
Dipartimento Onco-Ematologico
Internistico
Dipartimento Medico
Polispecialistico
Dipartimento Geriatrico e
Riabilitativo
Dipartimento Neuroscienze
% prestazioni
LP
Totale
prestazioni
108.076
99%
844
1%
108.920
283.343
98%
5.344
2%
288.687
91.506
99%
1.022
1%
92.528
38.374
98%
894
2%
39.268
32.401
92%
2.641
8%
35.042
Dipartimento Chirurgico
110.766
94%
6.427
6%
117.193
Dipartimento Testa-Collo
104.007
95%
5.635
5%
109.642
Dipartimento Materno-Infantile
Dipartimento Cardio-NefroPolmonare
Dipartimento Radiologia e
Diagnostica per immagini
Dipartimento Patologia e
Medicina di Laboratorio
Totale
132.198
94%
7.464
6%
139.662
96.321
96%
3.929
4%
100.250
141.834
99%
981
1%
142.815
2.777.701
100%
2.350
0%
2.780.051
3.916.527
99%
37.531
1%
3.954.058
Assistenza ospedaliera
Struttura dell’offerta: posti letto per acuti, lungodegenza e riabilitazione
Nella provincia di Parma le necessità di ricovero della popolazione residente sono assolte dalla presenza
di una Azienda Ospedaliero-Universitaria, 2 presidi ospedalieri territoriali e 3 Case di Cura convenzionate.
La dotazione provinciale di posti letto per acuti è di 1.723, di cui 1.366 presenti in strutture pubbliche e
357 in Case di Cura private.
L’Azienda Ospedaliero-Universitaria di Parma, garantisce una percentuale rilevante di posti letto per acuti
pubblici della provincia corrispondente al 75%. Ovviamente, essendo dotata di strutture Hub e di funzioni
53
2. Profilo aziendale
Fonte: Banca dati aziendale, attività specialistica ambulatoriale
di eccellenza, una quota rilevante dei posti letto è utilizzata per il trattamento di pazienti provenienti da
fuori provincia e da altre regioni. Il contributo dell’Azienda Ospedaliero-Universitaria alla dotazione
provinciale di posti letto è passato da un valore dell’indicatore di 2,76 nel 2011 ad un valore pari a 2,58
nel 2013 confermando un trend in diminuzione, così come indicato dalla Legge 135/2013, cosiddetta
"Spending review", che ha aggiornato lo standard a 3,7 posti letto per 1.000 abitanti, di cui 0,7 per
riabilitazione. Tale indicatore per la provincia di Parma è pari a 4,99, mentre a livello regionale è 4,25.
Tabella 13 Assistenza Ospedaliera – struttura dell’offerta: posti letto pubblici e privati al
31/12/2010
Vedi appendice capitolo 2 - pag.
Tabella 14 Assistenza Ospedaliera–struttura dell’offerta: posti letto pubblici e privati al
31/12/2011
Vedi appendice capitolo 2 - pag.
Tabella 15 Assistenza Ospedaliera–struttura dell’offerta: posti letto pubblici e privati al
31/12/2013
Posti letto pubblici
Aziende
Posti letto privati
Indicatori
Acuti(*)
Acuti
Riabili
tazione
LD
Totale
Post-acuti
LD
Totale
accredita accreditati
Non
Riabilitazio
Accreditati
ti e non
accreditati
ne
accredita
accreditati
ti
Acuti
LD+ Riabilita
Riab.
zione
LD
Totale
AUSL Parma
335
6
54
395
357
-
245
85
682
-
-
-
-
-
AOU Parma
1.031
15
108
1.154
-
-
-
-
-
2,31
0,28
0,03
0,24
2,58
Tot. Parma
Tot. Regione
1.366
21
162
1.549
357
-
245
85
682
3,85
1,14
0,59
0,54
4,99
12.523
674
1.245
14.442
2.862
233
890
853
4.574
3,44
0,81
0,35
0,46
4,25
Fonte - Elaborazione da Flussi Informativi Ministero della Salute (HSP 12/13), www.regione.emilia-romagna.it/SIS;
La popolazione di riferimento per gli indicatori è la popolazione per azienda, residente in Emilia Romagna al 1.01.2013 4.471.104
(*) La colonna dei posti letto acuti (accreditati e non) è generata sulla base di quanto previsto dall'Accordo AIOP parte II B1 accreditamento in base all'utilizzo - Per il calcolo dell'indicatore PL*1000 abitanti si sono utilizzati solo quelli accreditati.
Grafico 6 Confronto provincia di Parma-RER e obiettivo della Conferenza Stato-Regioni su
dotazione PL/1000 abitanti
AUO
PR Provincia
Regione
Lineare (Regione)
7
6
5
4
3
2
1
0
2011
2012
2013
2. Profilo aziendale
Fonte - Elaborazione da Flussi Informativi Ministero della Salute (HSP 12/13), www.regione.emilia-romagna.it/SIS;
La tabella 16 illustra le percentuali di posti letto per funzioni hub dell’Azienda Ospedaliero-Universitaria di
Parma che rappresentano complessivamente l’11% della dotazione totale dei posti letto ordinari.
54
Tabella 16 Percentuale posti letto hub definiti a livello regionale
posti letto
ufficiali al
31/12/2013
20
8
8
14
40
3
6
99
930
Discipline di ricovero
7
Cardiochirurgia
47
Centro Ustioni
48
Nefrologia / Trapianti
49
Terapia intensiva (1° Anestesia e Rianimazione)
30
Neurochirurgia
18
Centro Trapianti Midollo Osseo
73
Neonatologia T.I.
Totale Funzioni hub
Totale posti letto ordinari al 31/12/2013*
% posti letto
sul totale
ordinari
2%
1%
1%
2%
4%
0%
1%
11%
100%
Con l’esclusione dei posti letto di lungodegenza e dei posti letto pensionanti. Fonte Banca Dati Posti letto- RER
Attività Hub
Nel 2013, dei 3.066 ricoveri effettuati presso l’Azienda Ospedaliero-Universitaria di Parma nei reparti con
funzione Hub, il 28% ha riguardato pazienti provenienti dalle altre province dell’Emilia-Romagna, mentre
nel 12% dei casi si è trattato di cittadini residenti in altre regioni.
La maggior quota di ricoveri extra-provincia viene trattata presso il Centro Ustioni (46%), e presso la
Cardiochirurgia (40%), mentre l’attrazione dei residenti fuori regione è prevalentemente esercitata dalle
funzioni di Nefrologia/Trapianti (36%) e dal centro Trapianti Midollo Osseo (21%), confermando il ruolo
preminente che tali reparti di alta specializzazione svolgono sia in ambito regionale che extra regionale.
Tabella 17 Percentuale ricoveri extraprovincia ed extraregione su funzioni hub,
regime ordinario, anno 2013
di cui
Discipline di ricovero
Ricoveri
in AOU
residenti
extra
provincia
%
residenti
ricoveri
extra
extra
RER
provincia
% ricoveri
extra RER
7
Cardiochirurgia
716
286
40%
31
4%
47
Centro Ustioni
149
68
46%
23
15%
48
Nefrologia / Trapianti
226
42
19%
82
36%
49
Terapia intensiva (1° Anestesia e
Rianimazione)
546
113
21%
34
6%
30
Neurochirurgia
1.266
315
25%
197
16%
18
Centro Trapianti Midollo Osseo
29
1
3%
6
21%
73
Neonatologia T.I.
134
33
25%
5
4%
3.066
858
28%
378
12%
Totale Funzioni hub
Nota:Il numero di ricoveri considera il reparto di transito
Fonte: Banca Dati SDO - RER
Tabella 18 Percentuale ricoveri extraprovincia ed extraregione su funzioni non hub,
regime ordinario, anno 2013
di cui
Ricoveri in
AOU
residenti
extra
provincia
119
8
Cardiologia
3.160
9
Chirurgia Generale
3.020
188
6%
264
9%
10
Maxillo-Facciale
743
217
29%
293
39%
11
Chirurgia Pediatrica
939
345
37%
157
17%
12
Chirurgia Plastica
995
153
15%
140
14%
13
Chirurgia Toracica
494
32
6%
72
15%
14
Chirurgia Vascolare
642
31
5%
41
6%
18
Ematologia
185
7
4%
24
13%
21
Geriatria
1.729
15
1%
34
2%
55
4%
166
% ricoveri
extra RER
5%
2. Profilo aziendale
Discipline di ricovero
(codice e descrizione)
%
residenti
ricoveri
extra
extra
RER
provincia
24
Malattie Infettive
26
Medicina Generale
29
Nefrologia
32
Neurologia
34
Oculistica
36
Ortopedia e Traumatologia
37
Ostetricia e Ginecologia
3.620
228
6%
145
4%
38
Otorinolaringoiatria
1.142
154
13%
230
20%
39
Pediatria
2.356
352
15%
167
7%
43
Urologia
1.385
97
7%
177
13%
49
Terapie Intensive (*)
1.329
23
2%
9
1%
50
UTIC
1.230
42
3%
49
4%
51
Astanteria Med. d'Urgenza
2.167
56
3%
127
6%
52
Dermatologia
447
15
3%
46
10%
56
Riabilitazione
159
0
0%
1
1%
58
Gastroenterologia
170
4
2%
15
9%
60
Lungodegenza
2.160
2
0%
0
0%
62
Neonatologia
536
46
9%
12
2%
64
Oncologia
710
33
5%
83
12%
65
Pediatria e Oncoematologia
404
165
41%
22
5%
68
Pneumologia
Totale Funzioni non hub
810
32
4%
52
6%
7.950
139
2%
276
3%
386
18
5%
27
7%
195
13
7%
17
9%
843
163
19%
217
26%
3.188
138
4%
284
9%
770
53
7%
53
7%
43.864
2.880
7%
3.200
7%
Nota: Il numero di ricoveri considera il reparto di transito
(*) Fisiopatologia respiratoria, Terapia Intensiva Post-Chirurgica e Terapia Intensiva Cardiochirurgia
Fonte: Banca Dati SDO- RER
Per ciò che concerne i ricoveri di residenti extra-provincia ed extra-regione presso reparti che non
esercitano a livello regionale funzione hub, si segnalano alcune Unità Operative che possiedono alte
percentuali di ricoveri di pazienti provenienti da fuori provincia e regione, quali ad esempio la Chirurgia
Maxillo-Facciale, la Chirurgia Pediatrica e la Oncoematologia Pediatrica, con quote rispettivamente pari al
69%, 53% e 46%, indicative di un’attrazione elevata per la qualificata attività svolta.
Indicatori di attività dei centri hub
2. Profilo aziendale
Alle funzioni Hub ufficialmente riconosciute, si affiancano, nella realtà dell’Azienda, unità operative
d’eccellenza, così definite per la loro capacità di attrarre e trattare casistica complessa. La capacità di
attrazione di queste unità operative è un indicatore proxy della qualità percepita e del prestigio della
struttura.
Nelle tabelle che seguono viene riportato il valore, in termini assoluti e relativi, dei casi provenienti da
altre province della regione e da altre regioni, rispettivamente per le funzioni Hub e per le funzioni di
eccellenza dell’AOU di Parma. Il dato è stato analizzato, in particolare, per le due province limitrofe,
Reggio Emilia e Piacenza, e per la regione Lombardia, dalla quale proviene la maggior quota di pazienti
residenti fuori regione. E’ importante sottolineare che entrambe le funzioni, Hub e di eccellenza, hanno
complessivamente un indice di attrazione di oltre il 45%, di cui circa il 30% per pazienti provenienti da
altre province della Regione Emilia Romagna e, per quanto riguarda in modo specifico le funzioni di
eccellenza, più del 20% da altre Regioni.
56
Tabella 19 Mobilità attiva - Bacino d’utenza per funzioni Hub Azienda OspedalieroUniversitaria di Parma (regime ordinario), anno 2013
Province della Regione Emilia-Romagna
Funzioni HUB
Reggio Emilia
Piacenza
N
%
N
%
Altre
province RER
N
Totale
Attrazione
Lombardia Altre Regioni
%
N
%
N
%
N
%
11
2%
26
4%
323
45%
07
Cardiochirurgia
85
12%
168
23%
33
5%
47
Centro Ustioni
33
22%
14
9%
21
14%
8
5%
18
12%
94
63%
48
Nefrologia/Trapianti
21
9%
3
1%
18
8%
20
9%
63
28%
125
55%
30
Neurochirurgia
131
10%
167
13%
17
1%
73
6%
130
10%
518
41%
73
Neonatologia
Terapia Intensiva
18
13%
14
10%
1
1%
2
1%
3
2%
38
28%
288
12%
366
15%
90
4%
114
5%
240
10%
1098
44%
Totale
Fonte: Banca Dati SDO - RER
Tabella 20 Mobilità attiva - Bacino d’utenza per funzioni di eccellenza Azienda OspedalieroUniversitaria di Parma (regime ordinario), anno 2013
Funzioni di eccellenza
Province della Regione
Emilia-Romagna
Lombardia Altre Regioni
Altre province
Reggio Emilia Piacenza
RER
N
%
N
%
N
%
N
%
N
%
Totale
Attrazione
N
%
10
Maxillo Facciale
136
18%
42
6%
39
5%
69
9%
235
32%
521
70%
11
Chirurgia Pediatrica
227
24%
64
7%
54
6%
58
6%
103
11%
506
54%
65
Oncoematologia
Pediatrica
130
32%
34
8%
1
0%
7
2%
16
4%
188
47%
12
Chirurgia Plastica
Totale
91
9%
24
2%
45
5%
58
6%
90
9%
308
31%
584
19%
164
5%
139
5%
192
6%
444
14%
1523
49%
Fonte: Banca Dati SDO - RER
Un altro indicatore di interesse, speculare al precedente, è l’indice di fuga dai bacini d’utenza dai quali le
funzioni Hub e di eccellenza dell’Azienda Ospedaliero-Universitaria di Parma “dipendono”; nelle tabelle
che seguono è stato analizzato il ricorso ad altre strutture, fuori provincia e fuori regione, da parte di
pazienti residenti nelle province di Reggio Emilia e Piacenza relativamente alle funzioni Hub e di
eccellenza dell’AUO di Parma
Tabella 21 Mobilità passiva dei residenti della provincia di Reggio Emilia per disciplina
Hub dell'AOU di Parma - regime ordinario, anno 2013
Anno 2013
AOU Parma
Altri Presidi
R.E.R.*
Lombardia
Altre Regioni
Indice di
fuga
Residenti
Reggio E.
ricoverati
nella
disciplina
7 Cardiochirurgia
85
18%
62
13%
25
5%
7
2%
179
39%
462
47 Centro Ustioni
Nefrologia/
48
Trapianti
30 Neurochirurgia
33
83%
1
3%
0
0%
2
5%
36
90%
40
21
57%
12
32%
0
0%
2
5%
35
95%
37
131
32%
99
24%
23
6%
47
12%
300
74%
406
73 Neonatologia TI
18
10%
30
17%
0
0%
9
5%
57
32%
177
288
26%
204
18%
48
4%
67
6%
607
54%
1122
Totale
*Esclusi i ricoveri presso i presidi di Reggio Emilia
NB: l’indice di fuga è calcolato sul totale dei pazienti residenti di Reggio-Emilia ricoverati in quella disciplina
Fonte: Banca Dati SDO - RER
57
2. Profilo aziendale
Funzioni Hub
Totale
fuga
Tabella 22 Mobilità passiva dei residenti della provincia di Reggio Emilia per disciplina
di eccellenza dell'AOU di Parma - regime ordinario
Anno 2013
Funzioni di eccellenza
Altri Presidi
R.E.R.*
AOU Parma
Totale
fuga
Altre
Regioni
Lombardia
Indice
di fuga
Residenti
Reggio E.
ricoverati
nella
disciplina
10 Maxillo Facciale
136
70%
35
18%
16
8%
4
2%
191
98%
194
11 Chirurgia Pediatrica
Oncoematologia
65
Pediatrica
12 Chirurgia Plastica
227
64%
71
20%
6
2%
18
5%
322
90%
357
130
70%
41
22%
0
0%
4
2%
175
94%
187
91
55%
45
27%
15
9%
9
5%
160
97%
165
584
65%
192
21%
37
4%
35
4%
848
94%
903
Totale
*Esclusi i ricoveri presso i presidi di Reggio Emilia
NB: l’indice di fuga è calcolato sul totale dei pazienti residenti di Reggio-Emilia ricoverati in quella disciplina
Fonte: Banca Dati SDO - RER
Dall’analisi delle tabelle precedenti si evince che la maggior parte di ricoveri, nelle discipline considerate,
relativi ai residenti nella provincia di Reggio Emilia, afferisce alle strutture dell’AOU di Parma. A parte la
casistica relativa al Centro Ustioni con l’83% dei casi trattati presso la nostra Azienda, sono in particolare
le funzioni di eccellenza ad esercitare attrazione, e tra queste emergono in modo significativo la Chirurgia
Maxillo-Facciale e l’Oncoematologia Pediatrica con il 70% dei casi trattati.
Tabella 23 Mobilità passiva dei residenti della provincia di Piacenza per disciplina Hub
dell'AOU di Parma - regime ordinario
Anno 2013
Funzioni Hub
7 Cardiochirurgia
47 Centro Ustioni
48 Nefrologia/Trapianti
30 Neurochirurgia
73 Neonatologia T.I.
Totale
Altri Presidi
R.E.R.*
AOU Parma
Lombardia
Totale
fuga
Altre
Regioni
Indice
di fuga
Residenti
Piacenza
ricoverati
nella
disciplina
168
46%
36
10%
98
27%
5
1%
307
85%
362
14
88%
0
0%
1
6%
1
6%
16
100%
16
3
12%
16
62%
4
15%
1
4%
24
92%
26
167
48%
22
6%
117
34%
11
3%
317
92%
345
14
25%
1
2%
34
60%
1
2%
50
88%
57
366
45%
75
9%
254
32%
19
2%
714
89%
806
*Esclusi i ricoveri presso i presidi di Piacenza.
NB: l’indice di fuga è calcolato sul totale dei pazienti residenti di Piacenza ricoverati in quella disciplina
Fonte: Banca Dati SDO – RER
Tabella 24 Mobilità passiva dei residenti della provincia di Piacenza per disciplina di
eccellenza dell'AOU di Parma - regime ordinario
Anno 2013
2. Profilo aziendale
Funzioni di eccellenza
AOU Parma
Altri Presidi
R.E.R.*
Lombardia
Altre Regioni
10
Maxillo Facciale
42
64%
1
3%
6
16%
1
11
Chirurgia Pediatrica
64
67%
4
2%
33
27%
65
Oncoematologia Pediatrica
34
11%
0
0%
20
50%
Chirurgia Plastica
24
24%
6
9%
52
164
47%
11
3%
111
12
Totale
Totale
fuga
7%
50
10
4%
0
4%
53%
6
35%
17
94%
53
111
91%
122
54
90%
60
8%
88
98%
90
5%
303
93%
325
*Esclusi i ricoveri presso i presidi di Piacenza
NB: l’indice di fuga è calcolato sul totale dei pazienti residenti di Piacenza ricoverati in quella disciplina
Fonte: Banca Dati SDO - RER
58
Residenti
Piacenza
Indice
ricoverati
di fuga
nella
disciplina
Relativamente ai residenti nella provincia di Piacenza, dall’analisi delle tabelle sopra riportate, si evince
che la quota maggiore di ricoveri afferisce alle strutture dell’AOU di Parma, anche se per alcune funzioni
si rileva una “fuga” importante verso le province limitrofe della Lombardia.
Infine, l’analisi dei dati contenuti nelle due tabelle che seguono consente di evidenziare che il numero di
pazienti residenti nella provincia di Parma che non afferisce alle strutture Hub e di eccellenza dell’AOU di
Parma è esigua, ad eccezione della Cardiochirurgia e della Neurochirurgia per le quali si osserva una
“fuga” principalmente verso i presidi della Lombardia.
Tabella 25 Mobilità passiva dei residenti della provincia di Parma per disciplina Hub dell'AOU
di Parma - regime ordinario
Anno 2013
Funzioni Hub
Altri Presidi
R.E.R.*
Lombardia
Altre Regioni
Totale
Fuga
Indice di
Fuga
Residenti
Parma
ricoverati
nella
disciplina
7
Cardiochirurgia
9
2%
57
14%
4
1%
70
17%
411
47
Centro Ustioni
0
0%
0
0%
1
2%
1
2%
43
48
Nefrologia/Trapianti
30
Neurochirurgia
73
Neonatologia TI
Totale
0
0%
2
2%
2
2%
4
4%
107
42
7%
68
11%
29
5%
139
22%
640
9
8%
9
8%
1
1%
19
17%
115
60
5%
136
10%
37
3%
233
18%
1316
*Esclusi i ricoveri presso i presidi di Parma
NB: l’indice di fuga è calcolato sul totale dei pazienti residenti di Parma ricoverati in quella disciplina
Fonte: Banca Dati SDO – RER
Tabella 26 Mobilità passiva dei residenti della provincia di Parma per disciplina di eccellenza
dell'AOU di Parma - regime ordinario
Residenti
Anno 2013
Parma
Totale
Indice di
Funzioni di eccellenza
ricoverati
Altri Presidi
Fuga
Fuga
Lombardia
Altre Regioni
nella
R.E.R.*
disciplina
10
Maxillo Facciale
4
2%
6
3%
5
2%
15
6%
231
11
Chirurgia Pediatrica
4
1%
17
4%
25
6%
46
11%
414
65
Oncoematologia Pediatrica
214
12
Chirurgia Plastica
Totale
6
3%
0
0%
1
0%
7
3%
10
1%
25
3%
9
1%
44
6%
748
24
1%
48
3%
40
2%
112
7%
1607
Oltre agli indicatori sopra citati, vengono di seguito presentati alcuni dati relativi alle attività erogate da
due funzioni Hub dell’Azienda Ospedaliero-Universitaria di Parma, il Trauma Center e la Fibrosi Cistica.
L’attività relativa al Trauma Center della nostra Azienda si inserisce nel Sistema Integrato di Assistenza ai
Traumi (SIAT) dell’Emilia Occidentale, e copre un Bacino d’utenza pari a 1.274.086 di abitanti
(popolazione residente nelle province di Parma, Reggio Emilia e Piacenza a gennaio 2013 - Statistica
regione Emilia-Romagna).
Dalla tabella 27 risulta evidente la funzione Hub esercitata dalla nostra Azienda, che tratta
complessivamente il 30% dei casi di traumi dell’area dell’Emilia occidentale, con punte significative
relativamente alle ustioni (78%), alla traumatologia addominale (42%) e alla traumatologia intracranica
(36%). Relativamente a quest’ultima tipologia di casi, va specificato che una significativa percentuale di
casi (21%) viene trattata presso l’Azienda Ospedaliera di Reggio Emilia grazie ad un accordo, stipulato tra
le due Aziende Ospedaliere di Parma e Reggio, in base al quale i neurochirurghi di Parma operano a
Reggio per assicurare gli interventi necessari ai pazienti traumatizzati.
59
2. Profilo aziendale
*Esclusi i ricoveri presso i presidi di Parma
NB: l’indice di fuga è calcolato sul totale dei pazienti residenti di Parma ricoverati in quella disciplina.
Per il calcolo dell'indice di fuga non si è considerata la disciplina 49, in quanto presso le diverse Aziende di ricovero tale
disciplina identifica genericamente (seppur con diversi progressivi) Unità operative di Terapia intensiva e non necessariamente
quelle di Anestesia e Rianimazione.
Fonte: Banca Dati SDO - RER
Casi
%
Casi
1765
185
27%
12%
19%
747
92
Casi
%
Casi
%
Casi
%
19%
6464
36%
934
200
14%
14%
1789
344
28%
10%
1229
135
21%
Traumi toracici
35
18%
956
22
11%
14
7%
57
29%
72
36%
Traumi addominali
26
200
22%
3
3%
9
8%
49
42%
31
26%
Ferite
118
24
12%
22
11%
25
13%
42
22%
81
42%
194
Ferite arti superiori
73
28%
22
8%
49
19%
101
39%
17
6%
262
Ferite arti inferiori
26
29%
9
10%
11
12%
37
41%
8
9%
91
Traumi vasi sanguigni
6
21%
2
7%
3
10%
11
38%
7
24%
29
Traumi superficiali
Traumi da
schiacciamento
Ustioni
Traumi nervi e midollo
Totale
13
21%
7
11%
22
36%
11
18%
8
13%
61
6
26%
1
4%
3
13%
6
26%
7
30%
23
23
5
2187
11%
10%
25%
3
7
937
1%
13%
11%
8
15
1523
4%
29%
18%
168
16
2631
78%
31%
30%
14
9
1388
6%
17%
16%
216
52
8666
Fratture
Traumi intracranici
%
Totale
Tabella 27 Dati epidemiologici sulle patologie traumatiche nel SIAT Emilia occidentale Tipologie di trauma che hanno determinato il ricovero presso le strutture pubbliche e private
nel territorio del SIAT Occidentale della Regione ER, anno 2013
AOSP
Azienda USL
Azienda USL Azienda USL
AOU Parma
Reggio
Reggio
Tipologia di
Piacenza
Parma
(hub)
Emilia
Emilia
trauma
Fonte Banca Dati SDO - RER
Per quanto riguarda la fibrosi cistica, la Regione stabilisce quale Centro hub (delibera 395/2006) per la
rete dell’area emiliana la struttura di Fibrosi Cistica della Clinica Pediatrica della nostra Azienda, con
copertura dei bacini territoriali di Reggio, Piacenza e Bologna. Presso questi ultimi centri si collocano le
funzioni Spoke, in stretto collegamento con l’Hub. Nella tabella seguente viene descritta l’attività erogata
nell’ultimo triennio dal Centro hub dell’Azienda Ospedaliero-Universitaria di Parma. I ricoveri hanno subito
nel corso del 2013 un calo significativo in relazione alla presa in carico prevalentemente ambulatoriale di
questa tipologia di pazienti.
Tabella 28 Ricoveri per fibrosi cistica Azienda Ospedaliero-Universitaria di Parma
2011
Residenza
2012
2013
5
% sul
totale
6%
5
% sul
totale
9%
1
11%
Parma
28
33%
21
37%
3
33%
Reggio Emilia
11%
Piacenza
Ricoveri
Ricoveri
Ricoveri
% sul totale
16
19%
12
21%
1
Modena
1
1%
3
5%
0
0%
Bologna
13
15%
3
5%
2
22%
Rimini
-
0%
1
2%
0
0%
Imola
1
1%
3
5%
1
11%
20
84
24%
100%
9
57
16%
100%
1
9
11%
100%
Fuori Regione
Totale
Fonte Banca Dati SDO – RER
2. Profilo aziendale
Attività ospedaliera
Il ricovero ospedaliero si può realizzare in regime ordinario, modalità attraverso la quale il paziente
permane alcuni giorni in ospedale, e in regime diurno o di day hospital (DH), medico e chirurgico (day
surgery), che rappresenta un modello assistenziale e organizzativo caratterizzato da un numero di accessi
ospedalieri programmati, limitati alle sole ore diurne.
Il tasso di ospedalizzazione rappresenta, invece, il rapporto tra il numero di pazienti dimessi residenti
nella provincia di Parma e la popolazione residente per 1.000 abitanti. Al fine di eliminare l’effetto che la
diversa distribuzione dell’età nella popolazione può avere sul tasso di ospedalizzazione, significativamente
associato all’età, viene utilizzato il tasso di ospedalizzazione standardizzato per età, che consente di
effettuare confronti fra aree geografiche diverse.
60
Nella provincia di Parma il tasso di ospedalizzazione standardizzato, dopo l’incremento verificatosi nel
2012 registra una flessione nel 2013, per quanto concerne il regime ordinario, il valore infatti passa da
128 per 1.000 abitanti a un valore pari a 113,2 per 1000 abitanti
In regime di day hospital il tasso di ospedalizzazione standardizzato complessivo della provincia evidenzia
un trend in decremento, passando dal 47,47 per 1000 abitanti del 2011 al 38,1 del 2013. Tale
decremento è probabilmente riconducibile allo sforzo comune delle due Aziende sanitarie della provincia
di Parma, Azienda Ospedaliero-Universitaria e Azienda USL, di veicolare alcune attività sanitarie, prima
effettuate in regime di DH, verso forme assistenziali più appropriate. Tale decremento è infatti in gran
parte dovuto ai DH medici che passano da 22,52 a 16,9 per mille abitanti.
Il contributo dell’Azienda Ospedaliero-Universitaria alla composizione del tasso di ospedalizzazione è del
58,1% nel 2013, per il regime ordinario. Questo valore si attesta su livelli più alti rispetto alla media
regionale (41,2%), e conferma come l’Azienda costituisca l’ospedale di riferimento dell’intera provincia,
accogliendo il maggior numero di casi, con la più elevata complessità.
Tabella 29 Tasso di ospedalizzazione standardizzato per età e contributo percentuale delle
aziende ospedaliere, anno 2013
Regime ordinario
DH medici
DH chirurgici
Azienda di residenza
Tot.
Parma
Reggio Emilia
Modena
Bologna
Ferrara
Totale E R
113,2
103,8
107,4
117,1
105,2
110,5
di cui AOU
Tot.
58,1
16,9
45,9
28,8
37,5
47,1
41,2
17,5
15,6
16,5
16,0
16,8
di cui AOU
Tot.
62,3
65,2
34,8
48,4
65,1
52,5
di cui AOU
32,5
41
27
31,5
44,8
34,2
21,2
20,9
17,4
16,3
18,3
17,4
Fonte: Area riservata BdM
Tabella 30 Tasso di ospedalizzazione standardizzato per età nella provincia di Parma
Regime ordinario
DH medici
DH chirurgici
Azienda di residenza - Parma
Tot.
2011
2012
2013
126
128,34
113,2
di cui AOU
57,2
58,2
58,1
Tot.
22,52
19,94
16,9
di cui AOU
Tot.
58,2
64,5
62,3
di cui AOU
24,95
23,86
21,2
38
36
32,5
Nota: Sono esclusi dal calcolo i neonati sani. *Sono comprese le schede di mobilità passiva extraregionale 2012
in contestazione. I tassi specifici sono stati calcolati utilizzando la popolazione E.R. residente al 01/01/2012.
La popolazione tipo utilizzata per standardizzare i tassi è quella E.R. residente al 01/01/2012. Fonte: Area riservata BdM
Grafico 7 Contributi % delle Aziende Ospedaliere ai tassi di ospedalizzazione standardizzati
per età: confronto tra le Aziende Ospedaliere della Regione Emilia Romagna, anno 2013.
Ricoveri in regime ordinario e in day hospital
Regime Ordinario
70
65
DH Medico
60
DH Chirurgico
55
50
45
35
30
25
Parma
Reggio Emilia
Modena
Bologna
Ferrara
R.E.R.
Nel 2013 nell’AOU di Parma sono stati effettuati 50.666 ricoveri, di cui il 20% in regime di DH. Una parte
dei ricoveri è stata erogata in regime di libera professione ma, come è evidente nelle tabelle che
seguono, si tratta di una quota esigua (complessivamente 160 ricoveri nel 2013). Tale quota rappresenta
lo 0,3% della casistica complessiva. Nell’ultimo triennio i valori percentuali di ricoveri in libera professione
61
2. Profilo aziendale
40
hanno registrato un trend in decremento attestandosi al di sotto della media regionale (0,95%) e sono da
attribuire quasi interamente (95% dei casi) a ricoveri di tipo chirurgico.
Tabella 31 Azienda Ospedaliero-Universitaria di Parma: riepilogo e confronto con la situazione
regionale, anni 2011-2013
Tutti i DRG
DRG chirurgici
% casi chirurgici
Azienda di ricovero
Totale
ricoveri
AOU Parma
2011
51.343
Totale Aziende
Ospedaliere RER
Totale Aziende
Ospedaliere RER
2.915
115.633
2.613
42,4%
89,6%
52.674
175
22.276
156
42,3%
89,1%
262.992
2.416
110.015
2.177
41,8%
90,1%
50.666
160
20.919
153
41,3%
95,6%
257.356
2.448
109.512
2.248
42,6%
91,8%
AOU Parma
2013
Totale Aziende
Ospedaliere RER
% casi
Ricoveri in chirurgici sul sul totale ricoveri
in libera
libera
totale ricoveri
professione
professione
22.190
193
43,2%
94,6%
Totale
ricoveri
272.512
AOU Parma
2012
Ricoveri in
libera
professione
204
Fonte: Banca dati SDO, Regione Emilia-Romagna.
Nota: l'estrazione dei dati è stata effettuata dopo il 13° invio dei dati
Tabella 32 Riepilogo Azienda Ospedaliera di Parma, anni 2011-2013
Regime ordinario
AOU Parma
Day hospital
Totale
%
Totale
dimessi
Libera
profess.
Totale
dimessi
Libera
profess.
Totale
dimessi
Libera
profess.
% DO
% DH
% LP
2011
39.881
190
11.462
14
51.343
204
77,68
22,32
0,40
2012
41.335
151
11.339
24
52.674
175
78,47
21,53
0,33
2013
40.497
139
10.169
21
50.666
160
79,93
20,07
0,32
Fonte: Banca dati SDO, Regione Emilia-Romagna.
Nota: l'estrazione dei dati è stata effettuata dopo il 13° invio dei dati
Tabella 33 Riepilogo Regione Emilia-Romagna, anni 2011-2013
Regime ordinario
Day hospital
Totale
%
Totale
dimessi
Libera
profess.
Totale
dimessi
Libera
profess.
Totale
dimessi
Libera
profess.
% DO
% DH
% LP
2011
202.843
2.628
69.669
287
272.512
2.915
74,43
25,57
1,07
2012
197.536
2.215
65.456
201
262.992
2.416
75,11
24,89
0,92
2013
194.231
2.207
63.125
241
257.356
2.448
75,47
24,53
0,95
Fonte : Banca dati SDO
Nota: l'estrazione dei dati è stata effettuata dopo il 13° invio di consolidamento dei dati.
2. Profilo aziendale
Complessità della casistica espressa in peso medio DRG
Il sistema di classificazione DRG dei ricoveri (Diagnosis Related Groups) esprime l’assorbimento di risorse
e, quindi, il suo valore è direttamente proporzionale alla complessità dell’attività di ricovero svolta.
Il peso medio, che viene calcolato per disciplina di dimissione, è il rapporto tra i punti DRG prodotti nella
specifica disciplina della struttura ospedaliera considerata e i dimessi dalla stessa. Dall’analisi dei pesi
medi di ricovero delle diverse discipline dell’Azienda Ospedaliero-Universitaria, si evidenzia una
sostanziale stabilità del punto DRG medio nella maggior parte delle discipline di dimissione.
L'indice di case-mix (ICM) rappresenta invece il rapporto tra il peso medio per disciplina, calcolato in una
struttura, e un valore di riferimento, che è il peso medio per disciplina calcolato sull'intera regione. Presso
l’AOU di Parma tutte le discipline (67%) presentano un indice di case-mix uguale ad 1 (cfr. tabella 34).
Tabella 34 Peso Medio del ricovero e ICM in regime ordinario, anni 2010-2012
Vedi appendice capitolo 2 - pag. VII
62
Per quanto riguarda i ricoveri ad alta complessità con peso medio superiore a 2,5 dalla tabella seguente si
osserva che, i valori percentuali di questa tipologia di ricoveri, si mantengono nel triennio al di sopra dei
valori medi regionali.
Tabella 35 Percentuale di casi ordinari di peso superiore a 2,5 sul totale dei casi ordinari
% ricoveri
Totale
Ricoveri
di peso >
Aziende di ricovero
ricoveri ordinari di
2.5 sul
ordinari peso > 2.5
totale
2011
2012
2013
AOU Parma
Totale Aziende
Ospedaliere RER
AOU Parma
Totale Aziende
Ospedaliere RER
AOU Parma
Totale Aziende
Ospedaliere RER
39.881
3.198
8,0%
202.843
13.915
6,9%
41.335
3.215
7,8%
197.536
13.698
6,9%
40.497
2.996
7,4%
194.231
13.681
7,0%
Fonte: Banca Dati SDO, dati aggiornati con il 13° invio (dalle pagine riservate al BdM)
Ricoveri potenzialmente inappropriati
Possono essere definiti “inappropriati” i casi trattati in regime di ricovero ordinario o di day hospital che le
strutture sanitarie avrebbero potuto trattare in un regime diverso (rispettivamente in day hospital o in
regime ambulatoriale) con identico beneficio per il paziente e con minore impiego di risorse.
L’elenco dei DRG ad elevato rischio di inappropriatezza organizzativa a cui viene fatto riferimento è
definito nel Patto per la Salute 2010-2012 – All. B e comprende i casi di degenza ordinaria di più di un
giorno attribuiti a DRG potenzialmente inappropriati. Il riferimento all’Allegato-B del Patto per la Salute,
modifica in modo significativo la numerosità della casistica rispetto agli anni precedenti, estratta in base
ai criteri esplicitati nella D.G.R. 1890/2010. Per tale ragione si ritiene di indicare, per un possibile
confronto, i dati ricalcolati con i medesimi criteri anche per gli anni 2011 e 2012.
Tabella 36 Percentuale di casi attribuiti a DRG ad alto rischio di inappropriatezza individuati
sul totale dei dimessi (valori assoluti e percentuali)
Aziende di ricovero
2011
2012
2013
AOU Parma
Aziende Ospedaliere RER
AOU Parma
Aziende Ospedaliere RER
AOU Parma
Aziende Ospedaliere RER
Dimessi in regime
ordinario con
durata della
degenza > 1
giorno e con DRG
potenzialmente
inappropriati
8.376
44.632
8.639
41.869
8.250
41.249
Totale dimessi
49.116
261.496
50.540
252.152
48.604
246.970
% casi attribuiti a
DRG
potenzialmente
inappropriati su
totale dimessi
17,1%
17,1%
17,1%
16,6%
17,0%
16,7%
Fonte: Area riservata del BdM
L’Intesa sancita dalla Conferenza Stato-Regioni del 28 ottobre 2010, poi ripresa dalla Delibera regionale
numero 925 del 26.06.2011 - Piano regionale di governo dei tempi di attesa per il triennio 2010-2012,
contenente accordi sulle modalità di accesso alle prestazioni diagnostiche e terapeutiche e indirizzi
applicativi sulle liste di attesa, ha aggiornato il monitoraggio dei tempi di attesa per il ricovero nel caso di
determinate patologie/prestazioni, fissando gli obiettivi da rispettare. È stata stabilita la percentuale di
casi da effettuare entro un predefinito periodo di attesa (periodo che intercorre tra il momento della
prenotazione della prestazione e il momento del ricovero, espresso in giorni).
In modo particolare vengono individuate alcune aree prioritarie, di cui sono stati fissati gli obiettivi da
raggiungere.
63
2. Profilo aziendale
Tempi di attesa
1. Area oncologica
in ricovero ordinario
interventi chirurgici per tumore della mammella: 100% dei pazienti entro 30 giorni
dall’indicazione all’intervento
interventi chirurgici per tumori colon-retto: 100% dei pazienti entro 30 giorni
dall’indicazione all’intervento,
interventi chirurgici per tumore della prostata: 100% dei pazienti entro 30 giorni
dall’indicazione all’intervento,
interventi ginecologici per tumori dell’utero: 100% dei pazienti entro 30 giorni
dall’indicazione all’intervento,
Interventi chirurgici tumore polmone: 100% dei pazienti entro 30 giorni dall’indicazione
all’intervento;
in day hospital/day surgery
chemioterapia: entro 30 giorni dal momento indicato da parte dello specialista
(Conferenza Stato-Regioni seduta 11 luglio 2002).
2. Area cardiovascolare
in ricovero ordinario
by pass aorto-coronarico: 90% dei pazienti entro 60 giorni,
angioplastica coronarica (PTCA): 90% dei pazienti entro 60 giorni,
endoarteriectomia carotidea: 90% dei pazienti entro 90 giorni,
in day hospital/day surgery
coronarografia: 50% dei pazienti entro 60 giorni, 100% dei pazienti entro 180 giorni
3. Area non oncologica
in ricovero ordinario
intervento protesi d’anca: 90% dei pazienti entro 180 giorni, 50% entro 90 gg,
tonsillectomia: 90% dei pazienti entro 180 giorni, 50% entro 90 gg;
in day hospital/day surgery
riparazione ernia inguinale: 90% dei pazienti entro 180 giorni, 50% entro 90 gg,
emorroidectomia: 90% dei pazienti entro 60 giorni,
biopsia percutanea del fegato: 90% dei pazienti entro 30 giorni;
2. Profilo aziendale
Per gli interventi oggetto di monitoraggio regionale dell’area oncologica (grafico 8), nel corso del 2013,
sono stati realizzati numerosi sforzi per avvicinarsi allo standard di riferimento regionale, che prevede la
realizzazione delle prestazioni entro 30 giorni per il 100% dei pazienti.
Per quanto riguarda, ad esempio, gli interventi sul tumore della prostata nel 2013 il 77% dei pazienti
sono trattati entro 30 giorni, a fronte di una media regionale con valori inferiori intorno al 53% dei casi.
Buoni i risultati relativamente alla patologia tumorale maligna del polmone che viene trattata nel rispetto
dei tempi d’attesa nel 94% della casistica, valore decisamente superiore a quello della media regionale
(paria all’82%).
Per il tumore del colon-retto la percentuale di pazienti trattati entro 30 giorni è dell’88%.
Per quanto riguarda il tumore dell’utero e il tumore della mammella (limitatamente alle mastectomie) nel
2013 si è intervenuti chirurgicamente entro 30 giorni, rispettivamente nell’85% e nel 87% delle pazienti
in lista di attesa, a fronte di una media regionale decisamente inferiore (rispettivamente 67% e 74%).
Occorre inoltre considerare che l’80% degli interventi di patologia tumorale della mammella vengono oggi
effettuati in regime di day surgery o one-day surgery con tempi di attesa inferiori.
64
Grafico 8 Rispetto dei tempi d’attesa - valori percentuali. Confronto Parma e Regione Emilia
Romagna. Area Oncologica, anno 2013
100
97
98
85
77
80
94
87
81
77
88
74
67
53
60
40
20
Chemioterapia (DH)
Tumore Utero
(RO)
Tumore Colon Retto
(RO)
Tumore Prostata
(RO)
AOU Parma
Tumore Mammella Mastectomia
(RO)
Tumore polmone
(RO)
Regione ER
Fonte banca Dati SDO - RER
Rispetto all’area cardiovascolare, ottimi sono i risultati per tutte le procedure oggetto di monitoraggio
con valori superiori a quelli fissati dall’obiettivo regionale che definisce quale standard la realizzazione
delle prestazioni, entro 60 o 90 giorni, nel 90% dei casi.
Grafico 9 Rispetto dei tempi d’attesa- valori percentuali. Confronto Parma e Regione Emilia
Romagna. Area Cardiovascolare, anno 2013
99
98
100
94
91
94
85
80
60
40
20
Angioplastica Coronarica
Endoarteriectomia Carotidea
AOU Parma
By pass aortocoronarico
Regione ER
Fonte banca Dati SDO - RER
65
2. Profilo aziendale
Per l’area non oncologica la Regione pone come obiettivo la realizzazione del 50% degli interventi entro
90 giorni e del 90% entro 180 giorni. Gli interventi di protesi d’anca nel 2013, presso la nostra Azienda,
rispettano lo standard regionale nell’81% dei casi, valore superiore a quello della media regionale (79%)
anche se inferiore all’obbiettivo fissato.
Il riferimento dello standard per le altre tipologie di intervento relative a quest’area è ricavato in base allo
storico regionale (D.G.R. 1532/2006) rispetto al quale, l’Azienda Ospedaliero-Universitaria di Parma si
pone di poco al di sotto della media regionale. La variabilità dei tempi di realizzazione di tale casistica è
anche determinata dalla mancanza di uno specifico standard da parte della Regione.
Grafico 10 Rispetto dei tempi d’attesa - valori percentuali. Confronto Parma e Regione Emilia
Romagna. Area Non Oncologica, anno 2013
100
81
79
80
69
84
79
78
85
71
60
49
47
40
20
Protesi Anca (RO)
Tonsillectomia (RO)
Emorroidectomia (DH)
AOU Parma
Ernia Inguinale (DH)
Biopsia del fegato (DH)
Regione ER
Fonte banca Dati SDO - RER
Nella tabelle 37 e 38 vengono riportati in dettaglio i dati relativi alle prestazioni monitorate nel 2013.
Tabella 37 Piano regionale sul contenimento dei tempi di attesa, D.G.R. 925/2011 Parma e
provincia, anno 2013
Vedi appendice capitolo 2 - pag. VIII
Tabella 38 Piano regionale sul contenimento dei tempi di attesa, D.G.R. 925/2011 Regione
Emilia-Romagna, anno 2013
Vedi appendice capitolo 2- pag. IX
Accessi in Pronto Soccorso dell’Azienda Ospedaliero-Universitaria di Parma
Il Pronto Soccorso dell’Azienda continua a registrare un trend in incremento del numero di accessi
(89.487 accessi nel 2013, ossia il 2% in più rispetto all’anno 2012). Il dato relativo al flusso di pronto
soccorso presentato nella tabella 39 include, per il 2013, anche i dati pediatrici, presentando quindi un
incremento più importante.
Parallelamente è aumentato anche il numero di ricoveri, a fronte però di un indice di filtro del 18%.
Per quanto riguarda la valenza provinciale, il Pronto Soccorso dell’Azienda assorbe circa il 73% di tutti gli
accessi al Pronto Soccorso della provincia, quota in incremento negli ultimi tre anni.
Tabella 39 Accessi in PS, anni 2011-2013
2. Profilo aziendale
Disciplina
AOU Parma
AUSL Parma
Totale
Regione ER
% accessi
AOU Parma
Accessi
2011
Ricoveri
%
84.425
38.886
123.311
1.864.847
13.936
5.546
19.482
259.499
16,5
14,3
15,8
13,9
2013
2012
Accessi
88.014
39.632
127.646
1.821.086
68,47
14.912
6.009
20.921
243.767
16,9
15,2
16,4
13,4
68,95
Fonte: Area riservata BdM
66
102.686
38.718
141.404
1.821.564
Ricoveri
%
18.446
6.361
24.807
276.082
18,0
16,4
17,5
15,2
72,62
Grafico 11 Percentuali di ricovero sugli accessi in PS: confronto AOU di Parma, provincia di
Parma e Regione, anni 2010-2012
25
20
15
10
5
0
AOU PARMA
TOTALE PROVINCIA PARMA
2011
2012
TOTALE AZIENDE RER
2013
Fonte: Area riservata BdM
Dall’analisi dei dati del 2013, in base alla suddivisione per codice colore, ossia il grado di urgenza del caso
(grafico 12), si evince come il 70,57% della casistica sia rappresentato dai codici verdi, seguito dai codici
gialli (17,80%), dai codici bianchi (8,35%) e infine dai codici rossi (3,28%), dato sovrapponibile a quello
del 2012, con la persistente prevalenza dei codici verdi rispetto agli altri codici, in linea con i dati regionali
e nazionali.
Esaminando gli accessi al Pronto Soccorso dell’AOU di Parma da parte della popolazione straniera, si
osserva come nel 2013 il 16,38% degli accessi totali al PS dell’Azienda è rappresentato da stranieri
(16.858), in aumento rispetto allo scorso anno (+ 24% per la presenza degli accessi pediatrici). La
suddivisione della casistica per codice colore vede una diversa distribuzione percentuale dei codici colore
rispetto a tutti gli accessi in PS, con una quota maggiore per i codici a più bassa complessità (bianchi e
verdi, pari al 88%), mentre con una percentuale minore per i codici gialli e rossi (pari al 12%), a più
elevata gravità. Rispetto allo scorso anno, la distribuzione per codice colore è perfettamente
sovrapponibile. Esaminando i reparti di ricovero, si evidenzia come il 32% di tutti i ricoveri di popolazione
straniera è stato effettuato verso i reparti pediatrici, il 26% nei reparti del Dipartimento di EmergenzaUrgenza.
Grafico 12 Accessi in PS, codice colore, anno 2013
7%
1%
4%
11%
74%
70%
Codice bianco
Codice verde
Codice rosso
Codice giallo
14%
Fonte: Applicativo di PS aziendale
Codice bianco
Codice verde
Codice rosso
Codice giallo
Fonte: Applicativo di PS aziendale
Osservazione Breve Intensiva (OBI)
L’Osservazione Breve Intensiva è un’attività assistenziale svolta in aree funzionali annesse al Pronto
Soccorso e/o alla Medicina d’Urgenza con finalità di rapido inquadramento diagnostico e terapeutico del
paziente, di norma non inferiore alle 6 ore e non superiore alle 24 ore, per identificare l’appropriatezza
del ricovero e della sua sede o della dimissione.
67
2. Profilo aziendale
19%
Grafico 13 Accessi in PS, stranieri, anno 2013
Le funzioni dell’OBI consistono, per quanto riguarda le patologie urgenti, nella valutazione diagnostica,
nell’osservazione longitudinale e terapia a breve termine; di conseguenza la permanenza in OBI migliora
l’appropriatezza dei ricoveri.
Tutti gli indicatori dell’attività in OBI rispettano gli standard regionali; infatti il numero di pazienti che
sono stati inseriti nell’OBI nel 2013 rappresenta il 7% di tutti gli accessi in PS (lo standard di riferimento
è compreso tra 3 e 8%); la percentuale di dimissione dopo il periodo di osservazione è del 77%, ben oltre
i riferimenti minimi della Regione (60%).
Tabella 40 Attività in OBI presso il PS dell’Azienda Ospedaliero-Universitaria di Parma,
anno 2013
2013
Atteso
Numero pazienti inseriti in OBI nell'anno
6.780
Pazienti in OBI sul totale accessi PS
7%
3 - 8%
Percentuale dei dimessi dopo il periodo di osservazione in OBI
77,21%
>60%
Contributo percentuale al numero di accessi ai PS provinciali
72,62%
Fonte: Banca Dati PS - RER
2. Profilo aziendale
Piano sangue e Plasma Regionale per il triennio 2013-2015
La deliberazione del Piano Sangue e Plasma Regionale per il triennio 2013-2015 (D.G.R. 121 del
18/6/2013), ha istituito definitivamente l’organizzazione del sistema trasfusionale regionale delle Aree
Vaste. L’Area Vasta costituisce l’ambito territoriale di riferimento per l’attuazione del programma
annuale predisposto dal Centro Regionale Sangue e il contesto organizzativo che consenta ai SIMT di
attuare le funzioni specifiche previste. L’organizzazione della rete delle Strutture Trasfusionali per Aree
Vaste consente inoltre di sviluppare al meglio le attività che prevedano rapporti con interlocutori
comuni (per esempio l’Azienda incaricata della produzione di plasmaderivati), o che possano trarre
giovamento da logiche di economia di scala. Ne sono obiettivi e vantaggi:
il mantenimento di un sistema qualità di alto livello;
i rapporti inerenti alla consegna del plasma con l’Azienda di frazionamento industriale;
la gestione delle scorte di emocomponenti;
la formazione e preparazione del personale, pubblico e associativo, addetto alla raccolta;
la gestione economica ed amministrativa dei processi e delle relazioni tra Aziende Sanitarie
dell’Area Vasta tra loro e con le Associazioni e Federazioni dei donatori;
l’informatizzazione delle attività necessarie al funzionamento della organizzazione;
la programmazione di adeguati progetti di ricerca e sviluppo nella disciplina della Medicina
Trasfusionale.
Il nuovo Piano Sangue e Plasma Regionale ha identificato il SIMT (Servizio Immuno-Trasfusionale)
dell’Azienda Ospedaliero-Universitaria di Parma come sede di Officina Trasfusionale nell’ambito
dell’Area Vasta Emilia Nord.
Nel nuovo Piano Sangue si sottolinea ancora una volta l’esigenza di un controllo dell’appropriatezza
nell’utilizzo degli emocomponenti da conseguirsi mediante l’attività del COBUS. Un ulteriore aspetto
che viene fortemente evidenziato è quello relativo alla qualità ed alla sicurezza delle attività
trasfusionali, ponendo l’accento sull’accreditamento e sulla risposta ai requisiti da questo richiesti quale
mezzo per ottenere tale fine.
Risultati raggiunti
Nel corso del 2013 il SIMT dell’Azienda Ospedaliero-Universitaria di Parma e l’UdR (Unità di Raccolta)
Associativa, che opera in convenzione e sotto la direzione tecnica del SIMT, hanno superato la visita di
accreditamento istituzionale, risultando pertanto adeguati rispetto ai requisiti richiesti entro il
31/12/2014. Questo traguardo ha innescato un meccanismo che porterà ad un riordino della rete della
raccolta nell’ambito provinciale. La nuova organizzazione in Area Vasta ha visto quale protagonista il
SIMT di Parma nella costituzione del CPSP (Comitato di Programma Sangue e Plasma) di AV. E’ iniziata
l’attività propedeutica alla attivazione dell’OT, mediante incontri e confronti con tutti i protagonisti
coinvolti. Si è ulteriormente sviluppata l’attività di Medicina Trasfusionale, soprattutto nella
collaborazione con l’Ematologia, nell’attività trapiantologica di cellule staminali. La Medicina
Rigenerativa tramite l’uso di emocomponenti per uso topico si è ulteriormente sviluppata. L’attività del
COBUS (che ha valenza provinciale) è proseguita nel corso del 2013 con il risultato di un migliore
utilizzo degli emocomponenti (diminuzione dell’utilizzo del plasma per uso clinico del 3.65 % rispetto al
2012 e delle unità rosse eliminate per scadenza = - 0.57 %) Nel corso dell’anno il SIMT di Parma ha
68
contribuito alla autosufficienza regionale e nazionale mettendo a disposizione: 2535 unità di emazie e
47 di altri emocomponenti. Ha sostenuto le necessità del territorio di competenza, fornendo 8347 unità
di emocomponenti all’AUSL di Parma ed alle Case di Cura convenzionate. Il Plasma conferito
all’Industria di lavorazione ha superato i 7900 kg (+ 4.12 % rispetto al 2012).
Nella tabella seguente si riportano i dati più significativi relativi al 2013 (vs 2012).
Tabella 41 Confronto attività di raccolta sangue, anni 2012-2013
Unità raccolte
Uso clinico
%
Unità
esportate
%
2012
29.761
25.186
84,63
2.787
9,36
2013
28213
24558
87.04
2535
8.97
Fonte:Centro Trasfusionale azienda Ospedaliero-Universitaria di Parma
Interventi in fase di sviluppo o in corso
Sono continuate le riunioni di Area Vasta Emilia Nord propedeutiche all’implementazione di una
concentrazione delle attività produttive. E’ proseguita la disincentivazione nei confronti delle richieste
di autodonazione mediante predeposito (-4 %), in coerenza con le indicazioni cliniche attuali.
Si rinvia alla sezione “Promozione dell'eccellenza tecnologica, clinica e organizzativa” del capitolo
3 e specificamente al Progetto Officina Trasfusionale di Area Vasta nel paragrafo “Strategie e percorsi di
integrazione interaziendali e di Area Vasta” per il percorso relativo alla riorganizzazione del sistema
trasfusionale regionale nelle Aree Vaste.
La rete per le donazioni e i trapianti di organi e tessuti del Servizio Sanitario Regionale è organizzata
secondo un modello che prevede il collegamento tra centri di alta specializzazione e ospedali del territorio
(hub and spoke). Secondo questo modello, i centri trapianto, le rianimazioni, le sedi delle banche di
tessuti e cellule sono collegati tra loro e con il Centro Riferimento Trapianti Emilia-Romagna (CRT-ER), il
quale coordina tutte le attività di donazione e trapianto, le attività di raccolta dati e il coordinamento delle
liste di attesa.
Nel corso dell’anno 2013 l’attività trapiantologica è aumentata di oltre il 20% rispetto all’anno precedente
sia per numero di trapianti da cadavere che di quelli da vivente. In particolare sono stati eseguiti 46
trapianti di rene da donatore cadavere (43 trapianti singoli, 1 doppio trapianto, 2 rene/pancreas), 7
trapianti da vivente (di cui 2 AB0 incompatibili), tutti con prelievo dell’organo portato a termine con
tecnica laparoscopica.
Anche nell’anno 2013 i risultati dell’attività di trapianto renale da cadavere sono stati sovrapponibili a
quelli dei migliori Centri nazionali ed internazionali, nonostante l’elevata complessità clinica della casistica
trattata. Tali dati sono riportati in dettaglio sul sito del Centro Nazionale Trapianti.
Per quanto riguarda i trapianti di rene da cadavere eseguiti dal 2008 al 2013, la sopravvivenza
dell’organo è risultata del 97,1% a 1 anno e del 97,1% a 5 anni, mentre la sopravvivenza del paziente è
stata rispettivamente del 98,5% a 1 anno e del 94,9% a 5 anni. Per i trapianti da donatore vivente, non
distinti per epoca storica a causa della numerosità limitata, la sopravvivenza dell’organo a 1 e 5 anni è
stata rispettivamente del 95,3% e 93,4%, mentre la sopravvivenza del paziente a 1 e 5 anni è stata del
100%.
Tutti e nove i trapianti AB0-incompatibili eseguiti sino a ora sono ad oggi ben funzionanti, con
sopravvivenza dei pazienti del 100%.
I risultati complessivi del trapianto di rene-pancreas simultaneo possono essere considerati anch’essi
soddisfacenti, essendo la sopravvivenza del paziente del 97,4% a 1 anno e del 84,9% a 5 anni. In otto
dei 39 trapianti di pancreas, è stato necessario riprendere il trattamento insulinico nel corso di un followup medio di circa 7 anni. La lista d’attesa per il trapianto di rene-pancreas consta attualmente di 4
pazienti (di cui due attualmente sospesi per motivi clinici).
Per quanto concerne la nostra strategia terapeutica per il trapianto renale da vivente AB0 incompatibile,
abbiamo proseguito nel 2013 con un protocollo “cost-effective” iniziato nel corso del 2012, che si fonda
sull’uso di immunoadsorbimento non-selettivo (Therasorb™ Ig-Flex) e che non fa ricorso all’uso di
immunoglobuline endovenose. Tale protocollo si è rivelato sicuro ed efficace, infatti, nessuno dei pazienti
ha sviluppato rigetto anticorpo-mediato o severe complicanze infettive.
Prosegue lo studio sull’inserimento rapido in lista dei pazienti dializzati e operati per carcinoma
differenziato della tiroide. In tale studio, pazienti in lista di attesa e affetti da carcinoma differenziato
69
2. Profilo aziendale
Attività trapiantologica
della tiroide, sono sottoposti a tiroidectomia totale, terapia radiometabolica, e poi reinseriti
immediatamente in lista se il successivo test al Thyrogen risulta negativo. Tale approccio modifica la
pratica seguita sino ad oggi che prevedeva di attendere 24 mesi dal termine del trattamento.
Nel corso del 2013 abbiamo ulteriormente progredito negli studi sul monitoraggio immunologico che
coinvolgono il Cylex Immuknow, l’IFNgamma, IL10- ELISPOT, il CXCL9 urinario, gli alloanticorpi HLA
fissanti il C1q, e il crossmatch in citofluorimetria.
Si è concluso lo studio sul monitoraggio tramite Cylex Immuknow nei riceventi di trapianto di rene o di
rene-pancreas durante i primi 36 mesi di follow-up e pubblicato i risultati (Am J Transplant 2013;
13:3215). Tale studio mostra che, nel ricevente di trapianto di rene o rene-pancreas, il monitoraggio
tramite Cylex Immunknow non si è rivelato utile nel predire futuri eventi clinici avversi quali rigetto acuto
e infezioni. Il Cylex Immuknow non dovrebbe pertanto essere impiegato per le modifiche della terapia
immunosoppressiva nel ricevente di trapianto clinicamente stabile. Piuttosto, il Cylex Immuknow rimane
un strumento potenzialmente utile per monitorare la funzione immunitaria in corso di infezione in atto.
Nel corso del 2013 abbiamo concluso lo studio IFNgamma, IL10- ELISPOT per il monitoraggio
immunologico del paziente trapiantato, i cui risultati saranno resi disponibili per la pubblicazione nel corso
del 2014. L’indagine ELISPOT potrebbe rivelarsi utile per identificare i pazienti a rischio di rigetto acuto e
cronico. Inoltre, i risultati di ELISPOT potrebbero essere integrati con quelli del Cylex Immuknow per
ottimizzare la gestione della terapia immunodepressiva.
Per quanto riguarda invece il monitoraggio degli anticorpi donatore-specifici nel post-trapianto, sarà a
breve possibile effettuare nel nostro Centro la ricerca degli anticorpi donatore-specifici fissanti il C1q. Tale
indagine consente, nell’ambito degli alloanticorpi HLA donatore-specifici, di distinguere gli anticorpi ad
elevato rischio da quelli a basso rischio di causare fallimento del graft.
Sono in corso di stesura i risultati dello studio sul protocollo per ottimizzare i criteri di allocazione dei
trapianti da donatore cadavere marginale sino ad ora basati su criteri esclusivamente bioptici. I risultati
dello studio di coorte, realizzato tra il 2001 e il 2010 in collaborazione con i Centri Trapianto di Bologna e
Modena, saranno resi disponibili nel 2014.
2. Profilo aziendale
Nel corso del 2013 il Centro Trapianti ha collaborato alla stesura delle linee guida Europee per il trapianto
renale (European Renal Best Practice, ERBP; ERA-EDTA) che sono state pubblicate nel settembre 2013
(Nephrol Dial Transplant 2013;28 Suppl 2:ii1-71). Il Centro Trapianti è attualmente coinvolto nel gruppo
di lavoro ERBP per la stesura di linee guida sul trapianto renale pre-emptive. Tali linee guida saranno
completate entro il 2014.
Il Centro Trapianti è anche parte attiva nel gruppo di lavoro Europeo sul Trapianto DESCARTES a cui
hanno aderito circa 350 professionisti di 55 Paesi diversi. Tale rete di collaborazione ha lo scopo di
favorire l’interazione tra i diversi Centri Trapianto per lo sviluppo di attività formative e programmi di
ricerca con particolare riguardo al trapianto pre-emptive, al trapianto nel donatore anziano,
all’identificazione e lo studio dei pazienti con tolleranza verso il trapianto. Nel corso del 2013 sono state
organizzate varie attività formative (tra cui seminari ECM Praga, Istanbul, Amsterdam).
È stato inoltre avviato uno studio sulla tolleranza immunitaria cui hanno aderito vari Centri Italiani.
È infine in corso di stesura un protocollo per un studio randomizzato Europeo sulla minimizzazione della
terapia immunosoppressiva nel ricevente anziano. Tale protocollo sarà completato entro il primo
semestre del 2014.
In ottemperanza a quanto stabilito a livello regionale si è provveduto anche nell’anno 2013 alla riduzione
dei pazienti in lista d’attesa raggiungendo l’obiettivo concordato. Infatti al 31/12/2013 il numero totale
dei pazienti in lista d’attesa presso il nostro Centro era di 349 rispetto ai 377 del 2012, la maggior parte
dei quali residenti in altre regioni italiane (61%). Il tempo d’attesa tra richiesta di visita pre-trapianto e
sua effettuazione è stato inferiore ai 30 giorni sia per i candidati della regione che per i pazienti
extraregionali. Nell’anno 2013 sono usciti dalla lista d’attesa 80 pazienti (8 deceduti, 27 esclusi, 45
trapiantati in altra sede), i nuovi ingressi sono stati 93 di cui 42 (45,1%) residenti in Emilia-Romagna.
Per quanto concerne l’attività di follow-up, oltre 700 pazienti trapiantati vengono seguiti direttamente dal
entro Trapianti secondo protocolli clinici definiti ed informatizzati.
70
Tabella 42 Attività di prelievo di organi Azienda Ospedaliero-Universitaria di Parma,
anni 2010-2013
Tipologie
2010
2011
2012
2013
Segnalati
37
31
19
25
7
9
4
6
Opposizioni procura
-
2
-
0
Non idoneo
8
2
-
2
Effettivi
21
14
14
17
Utilizzati
18
14
14
16
Opposizioni
Fonte: Banca Dati Centro Riferimento Trapianti RER
La tabella 43 riporta i dati inerenti gli organi procurati dalla Rianimazione dell’AOU di Parma dal 2011 al
2013 (organi trapiantati sia nell’AOU di Parma che in altri ospedali), da cui si evidenzia un incremento
nel 2013 degli organi prelevati e trapiantati rispetto all’anno precedente. L’AOU di Parma svolge
un’efficiente attività di procurement, è infatti uno dei centri che fornisce il maggiore contributo in EmiliaRomagna, nel 2013 gli organi procurati dalla nostra Rianimazione rappresentano il 18% del totale.
Tabella 43 Organi procurati nella Rianimazione dell’Azienda Ospedaliero-Universitaria di
Parma, anni 2011- 2013
Cuore
Anno
Prel.
Fegato
Rene
Pancreas
Polmone
Totale
Trap.
Prel.
Trap.
Prel.
Trap.
Prel.
Trap.
Prel.
Trap.
Prel.
Trap.
2011
4
4
13
13
16
15
-
-
2
2
35
34
2012
4
4
13
13
22
17
1
0
4
4
44
38
2013
2
2
16
15
31
22
2
2
5
5
56
46
17
17
100
98
165
142
2
2
20
18
304
277
Totale RER
Fonte: Banca Dati Centro Riferimento Trapianti RER
La tabella 44 riporta i dati inerenti le attività di prelievo di tessuti presso l’AOU Parma dal 2011 al 2013
con il dettaglio relativo a cornee, cute, osso e cartilagini, vasi e valvole prelevate, da cui si evidenzia un
incremento dell’attività nel 2013 relativamente al prelievo di vasi, valvole e cute.
Tabella 44 Azienda Ospedaliero-Universitaria di Parma - Attività di prelievo di tessuti da
donatori cadavere (a cuore fermo e a cuore battente)
Osseo +
Cornee
Cute
Vasi
Valvole
cartilagini
Anno
N.
N.
N.
Tessuti
N.
N.
N.
N.
N.
N.
donatori
tessuti
donatori
(cm2)
donatori
tessuti
donatori
tessuti
donatori
tessuti
2011
105
208
6
7.280
4
59
2
5
1
2
2012
94
187
4
7.760
14
66
2
5
2
4
2013
76
152
7
13.670
5
75
3
8
4
8
Fonte: Banca Dati Centro Riferimento Trapianti RER
Tabella 45 Attività trapiantologica Azienda Ospedaliero-Universitaria di Parma
Trapianto
2011
2012
2013
*Cornea
Midollo
*Rene
Rene-pancreas
59
26 autologhi
1 allogenici
39 di cui
5 da vivente
3
77
13 autologhi
10 allogenici
41 di cui
5 da vivente
-
Fonte: Banca Dato SDO – RER
*Fonte : Report 2013 Centro Riferimento Trapianti Regione Emilia-Romagna
71
61
18
18
53 di cui
7 da vivente
2
2. Profilo aziendale
Nella tabella 45 i dati più significativi sono da riferirsi all’incremento dei trapianti di rene e ai trapianti di
midollo sia autologhi che allogenici. Questi ultimi sono in relazione a specifici indirizzi terapeutici adottati
dalla Unità Operativa di Trapianti di Midollo Osseo, già nel corso del 2012 e consolidatisi nel 2103.
Qualità dell’assistenza
La qualità dell’assistenza viene valutata attraverso specifici indicatori che riguardano principalmente
l’accessibilità, l’appropriatezza, la sicurezza e l’efficacia.
Si tratta complessivamente di 14 indicatori, individuati dalla Regione Emilia-Romagna in collaborazione
con le Aziende sanitarie. Le principali fonti adottate nella selezione degli indicatori sono state l’Agency for
Healthcare Reserch and Quality (AHRQ) e il programma “Mattoni - Misura dell’Outcome”.
In questa sezione troveranno ospitalità solo 6 dei 14 indicatori individuati, tale scelta è finalizzata a dare
evidenza solo a quelli che misurano in modo più specifico la performance delle aziende ospedaliere nel
confronto con la regione o che misurano azioni congiunte e condivise con l’azienda USL di riferimento
all’interno di specifiche reti territoriali.
Le fratture del collo del femore sono eventi traumatici particolarmente frequenti nell’età anziana, che
prevedono un trattamento di tipo chirurgico la cui strategia dipende dal tipo di frattura e dall’età del
paziente. Diversi studi internazionali hanno dimostrato che attese brevi per l’intervento concorrono a una
diminuzione delle complicanze post-operatorie e a una maggiore efficacia della fase riabilitativa.
Per questo molte delle linee-guida più recenti raccomandano che il paziente con frattura del collo del
femore venga operato entro 48 ore dall’ingresso in ospedale. Il tempo d’attesa per l’intervento di frattura
del femore è un indicatore proxy della gestione clinica e della presa in carico del paziente. A livello
europeo vi sono paesi in cui il valore dell’indicatore è prossimo al 90%, e paesi come l’Italia e la Spagna
con valori inferiori al 40%. Nel corso del 2013 il dato relativo a questo indicatore mette in evidenza un
miglioramento della performance dell’area ortopedica, anche per effetto del processo di riorganizzazione,
tutt’ora in corso, che ha previsto la distinzione dei percorsi in urgenza e in elezione per le Unità Operative
di Ortopedia all’interno del progetto dell’ospedale per intensità di cure (cfr. capitolo 7). Il valore
dell’indicatore seppur migliorato rispetto allo scorso anno resta al disotto della media regionale (63,5%).
Tabella 46 Interventi per frattura del collo del femore entro 2 giorni dal ricovero > 18 anni,
per aziende ospedaliere di ricovero, anni 2009-2013
2009
Azienda di ricovero
AOU Parma
Totale Aziende Osp. RER
Totale RER
2010
2011
2013
2012
Casi
% sul
totale
Casi
% sul
totale
Casi
% sul
totale
Casi
% sul
totale
261
59,5
208
49,3
215
55,8
208
48,4
890
45,5
845
43,1
971
51,5
1.181
2.639
41,9
2.581
42,3
2.879
49,0
3.691
Casi
% sul
totale
226
49,3
56,3
1.405
65,4
55,5
4.187
63,5
Fonte: Area riservata Bilancio di missione
2. Profilo aziendale
Tra gli obiettivi del Piano Sanitario Nazionale 2002-2004 viene citata la diminuzione della frequenza dei
parti con taglio cesareo laddove non sussistano indicazioni cliniche alla sua realizzazione. Fra le
indicazioni mediche all’effettuazione del taglio cesareo viene annoverata anche la condizione di parto
cesareo in precedenti gravidanze che molti sistemi di indicatori internazionali escludono dal calcolo. La
tabella che segue mostra infatti l’indicatore relativo alla percentuale di parti cesarei presso al nostra
Azienda nel confronto con le altre realtà sanitarie della regione, considerando solo la casistica relativa ai
parti con taglio cesareo primario (partorienti che non hanno avuto un parto cesareo precedente). La
nostra Azienda registra dal 2009 un trend in diminuzione del valore, che si attesta nel 2013 al 22,6%
(pari a 6 punti percentuali in meno) al pari della media delle aziende ospedaliere della regione. La media
regionale si è mantenuta nel corso dei cinque anni intorno al 20%.
Tabella 47 Parti con taglio cesareo primario per aziende ospedaliere di ricovero, anni 20092013
2009
Azienda di ricovero
2010
% sul
totale
Casi
627
28,8
628
Totale Aziende Osp. RER
2.732
24,1
Totale RER
7.224
21,6
AOU Parma
Casi
2011
% sul
totale
2013
2012
Casi
% sul
totale
Casi
% sul
totale
27,3
574
27,3
526
23,2
2.624
23,4
2.595
23,8
2.653
6.918
20,9
6.652
20,0
6.835
Fonte: Area riservata Bilancio di missione
72
Casi
% sul
totale
490
22,6
22,7
2679
23,8
19,8
6.819
20,4
L’intervento di colecistectomia per via laparoscopica rappresenta il “gold standard” nel trattamento della
calcolosi della colecisti nei casi non complicati, in quanto è associata ad una degenza ospedaliera e ad
una convalescenza inferiori rispetto al classico intervento a cielo aperto. Per questo alte percentuali di
questa tipologia di approccio terapeutico rappresentano una migliore qualità delle cure.
L’Azienda Ospedaliero-Universitaria di Parma tratta, attraverso questa modalità, più del 96% della
casistica con un valore superiore sia alla media delle aziende ospedaliere della regione (93%) che alla
media regionale complessiva (92%), come risulta dalla tabella 48.
Tabella 48 Interventi di colecistectomia laparoscopica per aziende ospedaliere di ricovero,
anni 2009-2013
2009
Azienda di ricovero
2010
2011
2012
2013
Casi
% sul
totale
Casi
% sul
totale
Casi
% sul
totale
Casi
% sul
totale
423
95,1
435
93,5
365
92,9
335
94,6
359
96,5
Totale Aziende Osp. RER
1.201
91,1
1.283
91,3
1.132
91,6
1.091
93,5
1.152
93,1
Totale RER
4.841
88,9
5.013
89,2
4.710
90,8
4897
92,0
5.093
92,0
AOU Parma
Casi
% sul
totale
Fonte: Area riservata Bilancio di missione
L’ictus (“stroke”), insieme ad altre condizioni cerebrovascolari, è fra le prime cause di morte in molti
paesi. Il tasso di mortalità per stroke, rispecchia sia la gravità clinica dei pazienti sia la qualità e l’efficacia
del trattamento e dell’assistenza erogati. Quest’ultimo aspetto riguarda non solo la fase acuta della
malattia, ma anche quella riabilitativa considerato che una parte non trascurabile dei decessi per Ictus
avviene a distanza di tempo dal ricovero ospedaliero. Da qui la necessità di valutare la mortalità a 30
giorni dal ricovero in urgenza per Ictus. L’indicatore rappresentato nella tabella 49 mostra come il tasso
di mortalità calcolato su pazienti il cui ricovero è avvenuto presso l’Azienda Ospedaliero-Universitaria di
Parma, seppur incrementato rispetto al 2011, si pone decisamente al di sotto della media regionale, così
come si pone al di sotto della media regionale la mortalità a 30 giorni dei residenti della provincia di
Parma (grafico 14).
Tabella 49 Mortalità a 30 giorni dopo un ricovero in urgenza per stroke, per aziende
ospedaliere di ricovero, anni 2010-2012*
2010
Azienda di ricovero
Casi
137
17,3
524
1.832
AOU Parma
Totale Aziende Osp. RER
Totale RER
2011
% sul
totale
2012
Casi
% sul
totale
Casi
% sul
totale
90
12,1
137
16,4
18,5
485
17,6
488
18,2
18,7
1.644
17,5
1.710
18,4
*L'indicatore non è aggiornato al 2013 in quanto non sono completi i dati del flusso REM
Grafico 14 Mortalità a 30 giorni dopo un ricovero in urgenza per stroke, per residenza dei
pazienti, anno 2012
22
20
16
17
17
18
19
19
19
20
23
20
18
15
10
5
Modena
Parma
Piacenza
Cesena
Ferrara
Reggio
Emilia
Ravenna
Fonte: Elaborazione Banca dati SDO e REM, dall’area riservata del BdM
73
Bologna
Imola
Forlì
Rimini
RER
2. Profilo aziendale
25
L’angioplastica coronarica percutanea transluminale (PTCA) è ormai considerata il trattamento più
appropriato per l’infarto miocardico acuto e quanto più è rapido tanto più è efficace. Un indicatore
indiretto della qualità dell’assistenza erogata per questa tipologia di pazienti è rappresentato dalla
numerosità delle procedure effettuate, in quanto importanti volumi di attività garantiscono una migliore
qualità e tempestività di esecuzione grazie proprio all’esperienza acquisita dai singoli centri. Le linee
guida di importanti società di cardiologia a livello mondiale stabiliscono che una struttura sanitaria
dovrebbe eseguire almeno 36 procedure di PTCA in urgenza all’anno; l’AOU di Parma nel corso dei 4 anni
rappresentati nella tabella 50 si pone ben al di sopra di questo standard di riferimento con una casistica
media in urgenza superiore ai 250 casi. Il valore percentuale di tale casistica è superiore alla media di
riferimento regionale (nel 2013 la differenza è di 1,1 punti, con una percentuale aggiustata per genere,
età e comorbilità).
Tabella 50 PTCA eseguite entro 1 giorno dall’ammissione di pazienti con un episodio di STEMI
per aziende ospedaliere di ricovero, anni 2010-2013
2010
Azienda di ricovero
AOU Parma
Totale RER
% sul
totale
Casi
2011
Casi
2012
% sul
totale
Casi
% sul
totale
2013
Casi
% sul
totale
212
59,7
228
68,5
201
65,0
280
71,9
2.224
58,9
2.379
60,4
2.237
60,2
3.362
70,8
Fonte: Area riservata Bilancio di missione
La mortalità per Infarto Miocardico Acuto rappresenta un elemento importante di valutazione della
tempestività delle cure prestate e della loro appropriatezza. L’indicatore calcolato per azienda di ricovero
vede l’AOU di Parma ben posizionata all’interno della regione con un valore del 12,4% nel 2013 al di sotto
della media regionale e in decremento rispetto agli anni precedenti (tabella 51); tale flessione è
attribuibile alla diminuzione dei tempi di intervento intra ed extra-ospedaliero a seguito dell’attuazione
della rete cardiologica, messa in atto negli ultimi anni in collaborazione con la AUSL, per la risposta
all’infarto miocardico acuto e alla elaborazione e monitoraggio del PDT del dolore toracico. Decremento
anche rispetto alla casistica NSTEMI (quella senza sopralivellamento del tratto ST) che ha raggiunto nel
2013 il 5,3%, in linea con la media regionale.
Tabella 51 Mortalità a 30 giorni da un ricovero per un episodio di STEMI e NSTEMI (con o
senza sopralivellamento del tratto ST), per azienda di ricovero, anni 2010-2012*
Azienda di
ricovero
AOU Parma
Totale RER
STEMI
2011
14,1
2012**
13,1
15,0
14,0
NSTEMI
2013**
12,4
13,9
2011
5,5
6,7
2012** 2013**
6,1
5,3
5,0
5,0
Fonte: Area riservata Bilancio di missione.
*il calcolo dell’indicatore prevede l’estrazione del dato di mortalità dall’Anagrafe assistiti della regione
** Valore standardizzato per genere, età e comorbilità
2. Profilo aziendale
2.4 Ricerca e didattica
E’ ormai riconosciuto che ricerca e didattica costituiscono due attività inscindibili che, se gestite in
sinergia, possono alimentarsi e sostenersi reciprocamente. L’esecuzione di validi programmi formativi
permette infatti allo studente non solo di acquisire conoscenze e competenze professionali, ma anche di
appassionarsi alle materie scientifiche, sviluppare la capacità di analisi, comprendere i processi della
ricerca biomedica e imparare a pianificare e condurre ricerca di qualità [Anderson 2011, Science;
Ioannidis 2014, Lancet]. Ricerca e didattica sono, a loro volta, strettamente connesse all’assistenza, in
quanto professionisti adeguatamente formati e aggiornati saranno in grado di favorire il trasferimento
tempestivo alla pratica clinica di nuove conoscenze, competenze e innovazioni tecnologiche, a beneficio
dei pazienti. In questo senso, i docenti assumono un ruolo chiave per rafforzare il connubio tra l’area
accademica e quella assistenziale; in particolare, essi possono contribuire ad aumentare nei giovani la
consapevolezza del ruolo fondamentale della ricerca nel loro percorso professionale, a prescindere dalla
carriera che intendono perseguire. Anche i clinici, infatti, devono possedere competenze in materia di
ricerca e capacità critica sufficienti per poter distinguere studi di buona qualità (scientificamente validi) ai
74
quali fare riferimento nella pratica e saper interpretarne i risultati al fine di offrire un’assistenza ottimale
ai loro pazienti.
Nonostante queste premesse, si registrano ancora, un po’ in tutto il mondo, carenze nella formazione dei
giovani medici in materia di metodologia della ricerca. Generalmente i corsi di laurea in medicina
prevedono una breve introduzione iniziale alla statistica, non seguita da training formale sulla ricerca
clinica negli anni successivi. Inoltre, questi brevi corsi spesso si limitano a tecniche di analisi dei dati, e
raramente includono aspetti più cruciali della ricerca, come il disegno dello studio [Ioannidis 2014,
Lancet.]
Alla luce di queste problematiche, numerosi lavori in letteratura sottolineano la necessità di rafforzare la
formazione biostatistica e metodologica durante i corsi di laurea e di specialità; esistono in merito anche
raccomandazioni su contenuti, modalità e tempistiche [Dixon 1994, Medical Education; Cheatham 2000,
the American Surgeon; Dommisse 2009, South African Family Practice] ai quali fare riferimento. Esse
sottolineano, tra l’altro, la necessità di introdurre, fin dal primo anno di studi, nozioni di biostatistica e di
metodologia, e di rafforzarle in seguito con corsi più approfonditi. Inoltre, si raccomanda che il training
comprenda la realizzazione di un progetto di ricerca; in tal modo, lo studente dovrà cimentarsi in tutti gli
step richiesti da uno studio e potrà acquisire competenze fondamentali, tra cui il lavoro di squadra.
Come spesso accade, però, l’esistenza di raccomandazioni non basta a garantire il loro rispetto nella
realtà; sono quindi necessari impegni e iniziative concreti, volti a supportare e valorizzare la sinergia tra
ricerca e didattica.
A tale proposito, la Regione Emilia-Romagna riconosce il ruolo fondamentale del binomio ricerca e
didattica all’interno delle Aziende Ospedaliero-Universitarie e degli IRCCS (riportando nella D.G.R. n.
199/2013 che in questi enti “I progetti di ricerca e la didattica rappresentano una funzione istituzionale
fondamentale, al pari di quella assistenziale e di formazione continua”), e lo sostiene anche attraverso
finanziamenti dedicati al sistema integrato Servizio Sanitario Regionale-Università. In particolare, nel
2013 sono stati destinati alle 4 Aziende Ospedaliero-Universitarie oltre 44 milioni di euro a integrazione
delle tariffe per l’impatto di ricerca e didattica.
Inoltre, anche nel 2013 la Regione ha sostenuto proposte progettuali, orientate ad una formazione alla
ricerca su temi rilevanti per il Servizio Sanitario Regionale che coinvolgono giovani medici e studenti di
medicina, al fine di aumentare la consapevolezza dell’importanza del loro ruolo futuro, non solo in quanto
professionisti clinici, ma anche come ricercatori del Servizio Sanitario Regionale.
Attività di ricerca
L’attività di ricerca rappresenta una priorità per l’Azienda Ospedaliero-Universitaria di Parma, in quanto
gran parte dei progetti realizzati sono parte integrante del processo di cura e costituiscono anche
strumento di formazione continua.
I progetti
Come negli anni precedenti, anche nel 2013 è stata effettuata la rilevazione sistematica degli studi avviati
in Azienda nell’arco dell’anno, con il duplice scopo di mettere in evidenza il lavoro di ricerca svolto, ma
anche per rispondere al debito informativo per l’attuazione dell’Anagrafe Regionale della Ricerca (ARER).
Complessivamente nell’anno 2013 sono stati avviati 118 progetti di ricerca, nel 43% dei quali l’Azienda è
responsabile del coordinamento. Rispetto all’anno precedente, si registra una riduzione del numero totale
di progetti avviati (-13, pari a -10%), prevalentemente sperimentazioni finanziate con fondi privati, ma
un incremento dei progetti in cui l’AOU di Parma è centro coordinatore (+15, pari a +42%).
Numero totale progetti
di cui l'AOU di Parma è capofila/centro di coordinamento
di cui progetti privi di finanziamento
2013
118
2012
138
2011
132
51
41
56
57
56
60
Nei grafici seguenti sono illustrati i risultati riguardanti il disegno dello studio e l’area tematica dei
progetti di ricerca.
Una macro-classificazione del disegno dello studio è quella che vede contrapporsi studi sperimentali
(studi in cui il ricercatore attua una modificazione controllata e programmata di alcuni fattori, ad esempio
75
2. Profilo aziendale
Tabella 1 Numero progetti attivati
terapie, test, eccetera, raccogliendo informazioni in merito alle conseguenze di tali modificazioni) e
osservazionali (studi in cui il ricercatore non interviene modificando l’esposizione, il trattamento o altri
fattori, ma si limita a raccogliere dati e informazioni su fenomeni che esistono e si svolgono
indipendentemente dallo studio).
Analogamente alla situazione evidenziata negli anni passati gli studi sperimentali prevalgono sugli quelli
osservazionali, totalizzando complessivamente il 57% dei progetti avviati.
Grafico 1 Percentuale di progetti suddivisi per disegno dello studio
43%
57%
Sperimentale
Osservazionale
Un maggiore dettaglio del disegno degli studi censiti è fornito nel grafico 2: si evidenzia come il 22% dei
progetti avviati nel 2013 sia una sperimentazione clinica, randomizzata e controllata, cioè studi
metodologicamente molto rigorosi attuati per dimostrare con un elevato grado di certezza l’efficacia o
meno di un trattamento sui pazienti. Tra gli studi osservazionali, svolge un ruolo preponderante quello di
coorte (che costituisce il 22% degli studi attivati nell’anno).
Grafico 2 Percentuali dei progetti suddivisi per tipologia di disegno
Sperimentale - Studio clinico
randomizzato e controllato
Anno 2013
Sperimentale - Studio preclinico
1%
17%
Sperimentale – Studio clinico
non randomizzato o non
controllato
Sperimentale - Altro
22%
9%
Osservazionale - Di coorte
14%
30%
3%4%
Osservazionale - Trasversale
Osservazionale - Caso controllo
Osservazionale - Altro
2. Profilo aziendale
Un altro aspetto che descrive le caratteristiche più salienti dell’attività di ricerca svolta nell’AOU di Parma
è l’area tematica dello studio: ancora una volta, come evidente nel grafico sotto, l’area “Tumori, inclusa
Leucemia” è quella prevalente (44 studi), seguita dalla ricerca sulle Infezioni (16 progetti). Un altro
elemento di rilievo è la grande diversificazione e multidisciplinarietà della ricerca condotta presso l’AOU,
anche grazie alla stretta collaborazione tra setting ospedaliero e accademico.
76
Grafico 3 Numero progetti suddivisi per Area tematica
50
45
44
40
n°progettii
35
30
25
20
16
15
11
9
10
7
5
Gravidanza
2
Riproduzione/
Reni /
2
App.Urogenitale
2
Occhio
2
Att. Endocrina
2
App. Muscolo-
Neurologia
CavoOrale/
App. Digerente
Salute/
Benessere
Sist. Immunit.
Infiammazione/
App.
Respiratorio
Cardiovascolare
Infezioni
Tumori /
Leucemia
Ematologia
3
0
Metabolismo/
5
Scheletrico
5
5
Area Tematica
Nota: sono riportate le aree tematiche su cui sono stati avviati almeno due progetti di ricerca nell’anno 2013.
Il lavoro dei ricercatori, e il generoso contributo dei pazienti partecipanti a uno studio clinico, non
avrebbero senso se l’esperienza e i risultati acquisiti non venissero condivisi con la comunità scientifica, e
con il pubblico. Comunicare quanto svolto è importante per valorizzare l’impegno profuso e rendervi
merito, ma è anche necessario per produrre il progresso della scienza, e il miglioramento della qualità
dell’assistenza, che costituiscono lo scopo ultimo di qualsiasi attività di ricerca. Le riviste scientifiche,
ormai per lo più disponibili online, consentono di raggiungere colleghi in tutte le parti del mondo,
favorendo anche lo scambio e la nascita di collaborazioni. Tuttavia, nonostante la semplificazione del
trasferimento di informazioni degli ultimi anni, solo per circa la metà dei trial registrati vengono
disseminati i risultati, almeno parziali [Chalmers 2013, BMJ]. A ciò si aggiunge la tendenza, propria sia
degli autori, sia delle riviste, di pubblicare prevalentemente studi con esiti positivi (es. che dimostrano
l’efficacia di un farmaco o di una tecnologia). Questa pubblicazione sbilanciata (definita publication bias)
rappresenta un grave limite, in quanto, sebbene gli studi negativi possano certamente risultare di minor
impatto mediatico, la loro mancata diffusione può portare a possibili conseguenze negative, quali la
replica di ricerca non necessaria perché già effettuata, spreco di risorse, eccetera [Chalmers & Glasziou
2009. Lancet].
Consapevole dell’importanza della questione, la Regione Emilia-Romagna incoraggia da anni i ricercatori
a disseminare i risultati di progetti, in particolare su riviste gratuitamente accessibili (open-access). Nel
2013, questa opera di promozione ha assunto una forma particolarmente concreta: è stata infatti
prevista, nei bandi del Programma di Ricerca Regione-Università, una quota di finanziamento integrativa
che verrà stanziata solo a seguito della pubblicazione dello studio su rivista open-access. Inoltre, la
Regione ha attuato una indagine online, rivolta a tutti i responsabili scientifici di studi finanziati dal
suddetto programma di ricerca, volta a rilevare i prodotti derivanti da questi progetti, comprese le
pubblicazioni.
Con la stessa finalità, l’Azienda da anni è impegnata nella valorizzazione della produzione scientifica dei
suoi professionisti, tramite la diffusione sulla intranet e sul sito internet aziendale di report trimestrali e
annuali, e l’inclusione delle pubblicazioni tra gli obiettivi di budget.
Tali report contengono, per ogni Struttura Complessa, oltre il numero di pubblicazioni dell’ultimo triennio,
anche un set di indicatori basati sulla misurazione dell’impatto dei singoli articoli scientifici. Non esistendo
un’unica modalità standard, ma oltre 70 indicatori censiti in letteratura [Canadian Academy of Health
Sciences. 2009; Banzi 2011], la scelta del set minimo è stata fatta privilegiando la reperibilità delle
informazioni e la facilità di elaborazione e di interpretazione dei risultati. Le informazioni relative alle
pubblicazioni dell’Azienda sono desunte dalla banca dati Web of Science della Thomson Reuters ISI
(Institute for Scientific Information) di Philadelphia e confermate dai professionisti. Di seguito sono
riassunti alcuni dati salienti, rimandando al Capitolo 6 per un maggiore dettaglio.
La tabella 2 mostra il numero di pubblicazioni (Articoli, Review, Lettere, Editorial Material, eccetera)
effettuate nel periodo 2011-2013, mettendo in rilievo la quota di articoli scientifici, in quanto
maggiormente rilevanti dal punto di vista della comunicazione scientifica. Per ciascun anno, sono indicati
anche i valori totali di Impact Factor (IF) grezzo e di Impact Factor normalizzato. Il trend anche per il
2013 rimane positivo, in particolare si rileva un incremento notevole in termini di Impact Factor, risultato
77
2. Profilo aziendale
Le pubblicazioni
di particolare rilievo se rapportato ai circa 800 professionisti dell’Azienda (145 professori universitari
convenzionati, 496 dirigenti medici e sanitari, 90 tra contrattisti e borsisti)
Tabella 2 Numero pubblicazioni realizzate, anni 2011-2013
Anno
N° pubblicazioni
di cui Articoli
Impact Factor Totale
Impact Factor
normalizzato (IFn)
2013
468
339
2154
2328
2012
466
324
1818.81
1397.2
2011
431
304
1223.29
939.9
Nota: L’IF è un indicatore che valuta numericamente, in base alle citazioni che gli articoli di un giornale ricevono e al numero
di lavori pubblicati nello stesso periodo, la posizione di una rivista rispetto ad altre della stessa categoria o disciplina: si
stabilisce così una graduatoria delle riviste basata su tale punteggio. Tanto maggiore è l’IF assegnato alla rivista, e quindi agli
articoli in essa pubblicati, tanto maggiore è il peso della pubblicazione. Dal momento che esistono diversi ambiti disciplinari,
alcuni di più ampia portata, diventa problematica la valutazione di singoli lavori e la loro confrontabilità. Questo problema è
emerso in maniera netta quando si è trattato di valutare, da parte del Ministero della Salute, la produttività scientifica degli
IRCCS (a partire dal 1997), su cui basare la ripartizione del finanziamento della ricerca corrente. Per ridurre, almeno in parte,
la disparità di valutazione tra diversi settori di ricerca, si effettua una “normalizzazione” dell’Impact Factor (Impact Factor
normalizzato - IFn). Per ogni disciplina o categoria si identificano le riviste ad essa riferibili e si calcola l’intervallo dei valori che
l’IF assume, isolandovi dei centili, a cui sono stati fatti corrispondere altrettanti punteggi. Questo processo ha consentito di
superare l’ostacolo dell’eterogeneità disciplinare e rendere così più omogeneo il confronto della produzione scientifica
Le quattro rappresentazioni grafiche che seguono sono costruite dai dati direttamente estratti dalla Banca
dati ISI, una volta selezionati gli articoli pubblicati dai professionisti dell’AOUPR nel periodo 2011-2013
Nel grafico 4 sono rappresentati per anno il numero di pubblicazioni e il relativo numero di citazioni
ricevute per le pubblicazioni del medesimo periodo. Quest’ultimo dato è di notevole interesse e
significato, in quanto il presupposto è che il numero di volte in cui una pubblicazione è stata citata nella
bibliografia di altre pubblicazioni può costituire una misura della sua “Utilità” per il progredire della ricerca
scientifica. Il numero di citazioni è cumulativo e non immediato, cioè nel 2011 le citazioni sono quelle
relative alle pubblicazioni dello stesso anno, nel 2012 riguardano sia l’anno precedente sia l’anno
corrente, nel 2013 le citazioni dei tre anni considerati. Accanto ai grafici nella parte destra del grafico
vengono calcolati alcuni indicatori, di cui il principale è sicuramente l’h-index (pari a 29) che riassume con
un unico dato sia il numero di citazioni sia di pubblicazioni. Tra gli altri valori vengono presentati il
numero totale di pubblicazioni (1346 nei tre anni) e il totale delle citazioni (5990).
2. Profilo aziendale
Grafico 4 Pubblicazioni censite ISI e citazioni ricevute, anni 2011-2013
Nota: l’h-index, presentato nel 2005 da Jorge E. Hirsch della University of California di San Diego, è stato creato per
quantificare con un unico valore numerico la produzione scientifica di un ricercatore, basandosi sul numero delle pubblicazioni
e sul numero di citazioni ricevute. Lo scopo è rilevare la reale influenza di un ricercatore sulla comunità di riferimento,
prescindendo da singoli articoli di grande successo, o anche dai lavori di autori che, pur avendo pubblicato molto, hanno
prodotto solo articoli di scarso interesse, come invece avviene usando l'IF. In teoria più alto è l’h-Index più rilevante è
l’impatto dell’autore/della struttura in seno alla comunità scientifica di riferimento.
Nel grafico successivo sono elencate le collaborazioni internazionali (grafico 5), cioè la provenienza dei
co-autori: la Francia è la nazione con cui vi è stata la maggiore collaborazione (nel 16% delle
pubblicazioni dell’Azienda c’è almeno un autore che lavora in Francia) e a seguire con USA (nel 7% delle
pubblicazioni).
78
Grafico 5 Pubblicazioni con autori internazionali
Il grafico 6 descrive le Aree tematiche prevalenti, cioè quelle in cui l’AOU di Parma ha pubblicato con
maggiore frequenza: sono confermate anche per il 2013 la Cardiovascolare, l’Ematologia e la Tecnologia
e Medicina di laboratorio.
Per misurare l’impatto della ricerca vengono analizzati in tabella 3 un set di indicatori, denominati di
“Research Capacity”:
•
Grado di proprietà: numero di articoli in cui l’AOU ha dato il maggior contributo al lavoro, indicato
dalla presenza dell’autore in 1°, 2° o ultima posizione
•
Grado di eccellenza: numero di articoli pubblicati sulle migliori riviste (top journals)
convenzionalmente intese come con IF>10
•
Grado di qualità: numero di articoli pubblicati sulle migliori riviste del proprio settore
convenzionalmente intese come IFN>6
• Grado di partecipazione: quota di professionisti coinvolti in attività di ricerca, che quindi hanno
pubblicato almeno un lavoro nel periodo considerato
79
2. Profilo aziendale
Grafico 6 Aree tematiche prevalenti
Tabella 3 Indicatori “Research Capacity” (Proprietà, Eccellenza e Qualità)
Anno 2013 Anno 2012 Anno 2011
Indicatore
v.a.
Grado di proprietà: numero di articoli in cui l’AOU ha dato il maggior
contributo al lavoro, indicato dalla presenza dell’autore in 1°, 2° o
ultima posizione
Grado di eccellenza: numero di articoli pubblicati sulle migliori riviste
(top journals) convenzionalmente intese come con IF>10
Grado di qualità: numero di articoli pubblicati sulle migliori riviste del
proprio settore convenzionalmente intese come IFN>6
%
v.a.
%
v.a.
58% 189
%
143
43%
189
62%
15
4%
20
6%
13
4%
37
11%
71
22%
63
21%
Si evince che nei tre anni considerati i professionisti dell’AOU di Parma hanno esercitato un ruolo di
rilievo, come ideatori o principali realizzatori di studi o estensori di articoli.
2. Profilo aziendale
Il grafico 7 riporta il confronto tra la produzione scientifica dell’Azienda Ospedaliero-Universitaria e quella
di altre Istituzioni internazionali (università, ospedali, laboratori, ecc). Per ciascuna delle 10 Aree
tematiche prevalenti nell’AOUPR sono state individuate le prime quattro Istituzioni che nel periodo 20112013 hanno pubblicato maggiormente a livello internazionale, quindi centri di eccellenza in ambito
scientifico. Successivamente, per ogni Istituzione selezionata è stato calcolato il numero medio di
citazioni per pubblicazione e creato l’istogramma. Per confrontare il posizionamento dell’AOU di Parma
rispetto a questi centri di eccellenza, è stata utilizzata una barra rossa che indica il valore medio di
citazioni del nostro ospedale.
In breve, è possibile affermare che l’Azienda Ospedaliero-Universitaria di Parma presenta un numero
medio di citazioni per area molto simile alle top-four internazionali; in particolare, l’eccellenza è
rappresentata dall’area di Tecnologia e medicina di laboratorio, dove il numero medio di citazioni è
superiore a 6, e dalla Medicina Generale-Medicina Interna dove il valore, pari a 14,6, è al di sopra delle
top-four istituzioni.
80
Grafico 7 Numero medio di citazioni per area tematica prevalente: Confronto Azienda
Ospedaliero-Universitaria di Parma con altre Istituzioni Internazionali
EMATOLOGIA
(N=150 - 11%)
SISTEMA CARDIOVASCOLARE - CARDIOLOGIA
(N=212 - 16%)
7
6
5
4
3
2
1
0
10
8
6
4
2
0
Harvard
University
University of
C alifornia
System
Mayo C linic
University of
London
Harvard
University
INSERM
University of
C alifornia
System
NIH USA
CHIRURGIA
(N=124 - 9%)
TECNOLOGIA E MEDICINA DI LABORATORIO
(N=134 - 10%)
7
6
5
4
3
2
1
0
4
3
2
1
0
Harvard
University
University of
Toronto
Mayo C linic
University of
C alifornia
System
Harvard
University
University of
C alifornia
System
University of
London
PC SHE
ENDOCRINOLOGIA - METABILISMO
(N=64 - 5%)
MEDICINA GENERALE - MEDICINA INTERNA
(N=89 - 7%)
21
18
15
12
9
6
3
0
10
8
6
4
2
0
Harvard
University
University of
London
University of
C alifornia
System
University of
C alifornia
System
University of
Toronto
Harvard
University
INSERM
University of
London
RADIOLOGIA - MEDICINA NUCLEARE DIAGNOSTICA PER IMMAGINE (N=44 - 3%)
SISTEMA RESPIRATORIO
(N=57 - 4%)
6
5
4
3
2
1
0
Harvard
University
University of
C alifornia
System
University of
London
Harvard
University
Imperial
C ollege
London
81
University of
C alifornia
System
University of Johns Hopkins
London
University
2. Profilo aziendale
7
6
5
4
3
2
1
0
Un indicatore di notevole importanza (grafico 8) è il grado di coinvolgimento nelle attività di ricerca,
misurato dalla percentuale di professionisti con almeno un articolo scientifico pubblicato su riviste censite
ISI e dalla percentuale di professionisti che nel corso dell’anno non hanno pubblicato ma che sono stati
coinvolti in altre attività di ricerca. Dall’analisi dei dati nei tre anni, si rileva che circa un terzo dei
professionisti ha contribuito alla produzione scientifica dell’Azienda, e che un ulteriore 10% ha
attivamente partecipato ad altre attività di ricerca come redazione di linee guida, formazione in
metodologia della ricerca, eccetera.
Grafico 8 Indicatori “Research Capacity” (Partecipazione)
2. Profilo aziendale
Infine, per completare la descrizione delle attività, di seguito si riportano i primi 20 articoli scientifici
pubblicati sulle riviste più autorevoli nel 2013; la selezione è stata realizzata in base all’IF assegnato alla
rivista nella quale l’articolo è stato pubblicato, e nell’elenco sono stati evidenziati in grassetto gli autori
afferenti all’AOU di Parma.
1.
Sanna-Cherchi, S; Sampogna, RV; ... ; Allegri, L; ... ; Gharavi, AG (2013) Mutations in DSTYK and Dominant
Urinary Tract Malformations 369(7):621-629 IF2012=51.658 [Article]
2.
Wiviott, SD; White, HD; … ; Menozzi, A; … ; Bhatt, DL (2013) Prasugrel versus clopidogrel for patients with
unstable angina or non-ST-segment elevation myocardial infarction with or without angiography: a secondary,
prespecified analysis of the TRILOGY ACS trial LANCET 382(9892):605-613 IF2012=39,06 [Article]
3.
Lambert, JC; Ibrahim-Verbaas, CA; … Caffarra, P; Schellenberg, GD; Amouyel, P (2013) Meta-analysis of 74,046
individuals identifies 11 new susceptibility loci for Alzheimer's disease NATURE GENETICS 45(12):1452-U206
IF2012=35.209 [Article]
4.
Santoro, A; Rimassa, L; ... ; Salvagni, S; ... P; Porta, C (2013) Tivantinib for second-line treatment of advanced
hepatocellular carcinoma: a randomised, placebo-controlled phase 2 study LANCET ONCOLOGY 14(1):55-63
IF2012=25.117 [Article]
5.
Kohli, P; Wallentin, L; ... ; Ardissino, D; ... ; Cannon, CP (2013) Reduction in First and Recurrent Cardiovascular
Events With Ticagrelor Compared With Clopidogrel in the PLATO Study CIRCULATION 127(6):673-+
IF2012=15.202 [Article]
6.
Roe, MT; Goodman, SG; ... ; Ardissino, D; Fox, KAA; Armstrong, PW (2013) Elderly Patients With Acute
Coronary Syndromes Managed Without Revascularization: Insights Into the Safety of Long-Term Dual Antiplatelet
Therapy With Reduced-Dose Prasugrel Versus Standard-Dose Clopidogrel CIRCULATION 128(8):823-833
IF2012=15.202 [Article]
7.
Vergani, A; Tezza, S;... ; Corradi, D; ... ; Fiorina, P (2013) Long-Term Heart Transplant Survival by Targeting the
Ionotropic Purinergic Receptor P2X7 CIRCULATION 127(4):463-+ IF2012=15.202 [Article]
8.
Lambert, JC; Grenier-Boley, B; ... ; Concari, L; ... ; Caffarra, P;... ; Amouyel, P (2013) Genome-wide haplotype
association study identifies the FRMD4A gene as a risk locus for Alzheimer's disease MOLECULAR PSYCHIATRY
18(4):461-470 IF2012=14.897 [Article]
9.
Senior, R; Moreo, A; Gaibazzi, N; ... ; Kasprzak, JD (2013) Comparison of Sulfur Hexafluoride Microbubble
(SonoVue)-Enhanced Myocardial Contrast Echocardiography With Gated Single-Photon Emission Computed
Tomography for Detection of Significant Coronary Artery Disease JOURNAL OF THE AMERICAN COLLEGE OF
CARDIOLOGY 62(15):1353-1361 IF2012=14.086 [Article]
10. Gehring, AJ; Haniffa, M; ... ; Ferrari, C; Ginhoux, F; Bertoletti, A (2013) Mobilizing monocytes to cross-present
circulating viral antigen in chronic infection JOURNAL OF CLINICAL INVESTIGATION 123(9):3766-3776
IF2012=12.812 [Article]
82
11. Maggio, M; Corsonello, A; Ceda, GP; Cattabiani, C; Lauretani, F; Butto, V; Ferrucci, L; Bandinelli, S;
Abbatecola, AM; Spazzafumo, L; Lattanzio, F (2013) Proton Pump Inhibitors and Risk of 1-Year Mortality and
Rehospitalization in Older Patients Discharged From Acute Care Hospitals JAMA INTERNAL MEDICINE 173(7):518523 IF2012=10.58 [Article]
12. Bracarda, S; Porta, C; … ; Gasparro, D; ... ; De Angelis, V (2013) Could Interferon Still Play a Role in Metastatic
Renal Cell Carcinoma? A Randomized Study of Two Schedules of Sorafenib Plus Interferon-Alpha 2a (RAPSODY)
EUROPEAN UROLOGY 63(2):254-261 IF2012=10.476 [Article]
13. Bolzoni, M; Donofrio, G; Storti, P; Guasco, D; Toscani, D; Lazzaretti, M; Bonomini, S; Agnelli, L; Capocefalo,
A; Dalla Palma, B; Neri, A; Nicolini, F; Lisignoli, G; Russo, F; Colla, S; Aversa, F; Giuliani, N (2013) Myeloma
cells inhibit non-canonical wnt co-receptor ror2 expression in human bone marrow osteoprogenitor cells: effect of
wnt5a/ror2 pathway activation on the osteogenic differentiation impairment induced by myeloma cells LEUKEMIA
27(2):451-463 IF2012=10.164 [Article]
14. Storti, P; Bolzoni, M; Donofrio, G; ... ; Mancini, C; ... ; Aversa, F; Roodman, GD; Giuliani, N (2013) Hypoxiainducible factor (HIF)-1 alpha suppression in myeloma cells blocks tumoral growth in vivo inhibiting angiogenesis
and bone destruction LEUKEMIA 27(8):1697-1706 IF2012=10.164 [Article]
15. Mangia, A; Santoro, R; ... ; Missale, G; ... ; Folgori, A; Ferrari, C (2013) Treatment optimization and prediction
of HCV clearance in patients with acute HCV infection JOURNAL OF HEPATOLOGY 59(2):221-228 IF2012=9.858
[Article]
16. Eckhardt, CL; van Velzen, AS; ... ; Tagliaferri, A; ... ; Fijnvandraat, K (2013) Factor VIII gene (F8) mutation and
risk of inhibitor development in nonsevere hemophilia A BLOOD 122(11):1954-1962 IF2012=9.06 [Article]
17. Gay, F; Magarotto, V; ... ; Giuliani, N; Passera, R; Pietrantuono, G; Boccadoro, M; Corradini, P; Palumbo, A
(2013) Bortezomib induction, reduced-intensity transplantation, and lenalidomide consolidation-maintenance for
myeloma: updated results BLOOD 122(8):1376-1383 IF2012=9.06 [Article]
18. Gobbi, G; Mirandola, P; Carubbi, C; Masselli, E; Sykes, SM; Ferraro, F; Nouvenne, A; Thon, JN; Italiano, JE;
Vitale, M (2013) Proplatelet generation in the mouse requires PKC epsilon-dependent RhoA inhibition BLOOD
122(7):1305-1311 IF2012=9.06 [Article]
19. Larocca, A; Montefusco, V; … ; Giuliani, N; ... ; Palumbo, A (2013) Pomalidomide, cyclophosphamide,and
prednisone for relapsed/refractory multiple myeloma: a multicenter phase 1/2 open-label study BLOOD
122(16):2799-2806 IF2012=9.06 [Article]
20. Mazzera, L; Lombardi, G; Abeltino, M; Ricca, M; Donofrio, G; Giuliani, N; Cantoni, AM; Corradi, A; Bonati, A;
Lunghi, P (2013) Aurora and IKK kinases cooperatively interact to protect multiple myeloma cells from
Apo2L/TRAIL BLOOD 122(15):2641-2653 IF2012=9.06 [Article]
Attività didattica
Tabella 4 Iscrizioni a Medicina e Chirurgia (Corso di Laurea a Ciclo Unico-LM6), a. a. 20132014
Corso di laurea
Medicina e Chirurgia
Iscritti Iscritti Iscritti
1° anno 2° anno 3° anno
288
269
Iscritti
4° anno
257
173
83
Iscritti
5° anno
145
Iscritti
6° anno
Iscritti
FC
155
30
Totale
iscritti
1745
2. Profilo aziendale
In questa sezione viene delineata l’offerta formativa dei Dipartimenti Universitari di Area Medico
Chirurgica dell’Università di Parma nell’ambito del percorso di collaborazione con l’Azienda OspedalieroUniversitaria anche in termini di attività didattiche e formative che integrano la primaria funzione di
assistenza.
La funzione di didattica per quanto concerne le lauree magistrali a ciclo unico per le professioni Mediche è
articolata nei due corsi di Medicina e Chirurgia e di Odontoiatria e Protesi Dentaria.
Tabella 5 Iscrizioni a Odontoiatria e protesi dentaria (Corso di Laurea a Ciclo Unico–LM6),
a. a. 2013-2014
Corso di laurea
Iscritti
1° anno
Odontoiatria
e protesi dentaria
Iscritti
2° anno
29
Iscritti
3° anno
19
Iscritti
4° anno
19
Iscritti
5° anno
12
Iscritti
6° anno
18
Iscritti
FC
Totale
iscritti
12
109
0
Tabella 6 Provenienza iscritti a Medicina e Chirurgia (Corso di Laurea a Ciclo Unico–LM6) e
iscritti a Odontoiatria e protesi dentaria (Corso di laurea a ciclo unico), a. a. 2013-2014
Provenienze iscritti
Tipo corso di studi
Residenti in
Totale
Emilia
Residenti
Residenti
generale
Romagna
a Parma
extra regione
esclusa
Parma
Medicina e Chirurgia
Odontoiatria e protesi dentaria
Totale
521
342
882
1745
36
17
56
109
577
359
1038
1854
Tabella 7 Iscrizioni ai corsi di Laurea Triennale per le Professioni Sanitarie (L2), a. a. 20132014
Corso di laurea
Fisioterapia
Infermieristica
Logopedia
Ortottica e assistenza oftalmologica
Ostetricia
Tecniche di radiologia medica per
immagini e radioterapia
Tecniche della prevenzione
nell’ambiente e nei luoghi di lavoro
Tecniche di laboratorio biomedico
Tecniche Audioprotesiche
Totale
Iscritti
2° anno
Iscritti
3° anno
Iscritti
FC
Totale
iscritti
51
242
50
202
42
201
3
86
146
731
16
15
29
14
7
25
10
7
25
0
0
0
40
29
79
22
23
17
5
67
20
11
16
0
47
30
425
26
358
21
339
0
94
77
68
1284
Iscritti 1°
anno
Tabella 8 Iscrizioni ai corsi di Laurea Magistrale (LM), a. a. 2013-2014
2. Profilo aziendale
Corsi di studio
Totale iscritti
Scienze infermieristiche e ostetriche
53
Psicobiologia e Neuroscienze Cognitive
44
Nel contesto della collaborazione tra sistema sanitario e sistema universitario assume un ruolo rilevante il
concorso dei rispettivi sistemi allo sviluppo della formazione medico-specialistica post-laurea che si attua
prevalentemente nelle strutture di sede dell’Azienda Ospedaliero-Universitaria di riferimento per le
attività assistenziali essenziali allo svolgimento delle funzioni istituzionali di didattica e di ricerca
dell’Università.
Le modalità di svolgimento delle attività teoriche e pratiche del medico in formazione specialistica, la
rotazione tra le strutture inserite nella rete formativa, nonché il numero minimo e la tipologia di interventi
pratici da eseguire sono quelli determinati dai Consigli delle Scuole in conformità agli ordinamenti didattici
e agli accordi tra l’Università e l’Azienda Sanitaria di riferimento.
Di seguito si riportano le Scuole di Specializzazione di Area Sanitaria dell’Università di Parma e il numero
dei medici in formazione specialistica iscritti agli anni di corso di ciascuna Scuola nell’anno accademico
2012/2013.
84
I dati si riferiscono all’anno accademico 2012/2013, tenuto conto delle intervenute disposizioni
ministeriali che hanno comportato uno slittamento dell’avvio di ciascun anno di corso in luogo del
precedente inizio di tutti gli anni di corso nel mese di Novembre.
Tabella 9 Scuole di specializzazione e iscritti, a. a. 2013-2014
Residenti in
EmiliaRomagna
Residenti
Estero
extraregione
Totale iscritti
(Res Emilia
Romagna+
Res extra
regione)
Allergologia ed Immunologia Clinica
1
1
1
0
3
Anatomia Patologica
3
6
2
0
11
33
4
14
0
51
Anestesia Rianimazione e Terapia
Intensiva
Biochimica Clinica
1
0
0
0
1
20
4
9
1
34
Chirurgia Maxillo-Facciale
6
7
5
0
18
Chirurgia Plastica, Ricostruttiva ed
Estetica
0
2
3
0
5
Gastroenterologia
1
1
0
0
2
Geriatria
10
4
1
0
15
Ginecologia e Ostetricia
16
1
8
0
25
9
4
1
0
14
18
2
7
0
27
Chirurgia Generale
Igiene e Medicina Preventiva
Malattie Dell'apparato Cardiovascolare
Malattie Dell'apparato Respiratorio
8
9
8
0
25
Medicina Del Lavoro
14
4
4
0
22
Medicina D'emergenza-Urgenza
14
7
5
1
27
7
5
5
0
17
Medicina Fisica E Riabilitativa
Medicina Interna
13
5
8
0
26
Medicina Legale
1
0
0
0
1
Nefrologia
9
2
6
0
17
Neurologia
8
5
1
1
15
Neuropsichiatria Infantile
5
10
11
0
26
Oftalmologia
2
1
0
0
3
3
0
0
0
3
10
5
6
0
21
Oncologia Medica
Ortopedia e Traumatologia
Otorinolaringoiatria
1
0
1
0
2
Pediatria
34
7
8
1
50
Psichiatria
17
3
5
0
25
Radiodiagnostica
38
13
18
0
69
Radioterapia
Totale
6
5
6
2
19
308
117
143
6
574
Nota: I dati, in relazione al D.M. MIUR del 24 aprile 2013, si riferiscono al numero degli iscritti esclusivamente alla sede
Capofila di Parma e non comprendono gli specializzandi frequentanti le Scuole aggregate con l’Università di Parma ma iscritti
presso le sedi Capofila di altre Università (cfr. capitolo 3.6).
L’offerta formativa post-laurea della Facoltà si struttura anche in master universitari, di I e II livello, con
un numero complessivo di iscritti per l’a. a. 2013-2014 di 82.
85
2. Profilo aziendale
Scuole di specializzazione
Residenti a
Parma
Tabella 10 Master attivati di I e II livello, a. a. 2013-2014
Titolo Master
Livello
Laser in Odontostomatologia - Master Europeo
M2
Fisiopatologia e Trattamento del Paziente Critico
con Malattie dell'apparato Respiratorio
M1
Ortodonzia Intercettiva
Residenti in
EmiliaRomagna
Residenti in
Pr. di Parma
Residenti
Iscritti
extraregione
0
0
0
0
0
0
0
0
M2
1
0
1
2
Cure Palliative
M2
7
0
13
20
Dolore Orofacciale, Malattie Temporomandibolari,
Malattie del Sonno
M2
0
0
0
0
Medicina Estetica
M2
0
0
12
12
Implantologia
M2
0
0
3
3
0
0
0
0
0
0
0
0
0
0
0
0
8
4
5
13
7
5
9
Cure Palliative e Terapia del Dolore per Professioni
Sanitarie
Cellule Staminali Ematopoietiche e Medicina
Rigenerativa
Case/Care Management Infermieristico in Ospedale
e Sul Territorio
M1
M2
M1
Chirurgia e Patologia Orale
M2
Medicina e Biostatistica: Fondamenti di
Metodologia della Ricerca
M2
Estetica Orale e Periorale
M2
2
0
9
11
Tecniche Avanzate in Endoscopia Digestiva
M2
2
2
1
3
Parodontologia
M2
0
27
0
11
2
55
82
Totale
16
2
Il dottorato di ricerca rappresenta il più alto livello della formazione universitaria e il relativo titolo
accademico si consegue una volta acquisita la laurea specialistica. Di seguito si evidenziano i dottorati di
ricerca attivi in area clinica e il numero dei dottorandi frequentanti i corsi.
Tabella 11 Dottorati attivi area clinica, anno 2013
2. Profilo aziendale
Dottorati area medica attivi nell’anno
2013
Neuroscienze
Biologia e Patologia Molecolare
Diagnostica per Immagini Avanzata-Toracica
(Cardiopolmonare)
Fisiopatologia dell'insufficienza Renale
Scienze Ostetriche e Ginecologiche
Neuroscienze
Fisiopatologia Sistemica
Microbiologia e Virologia
Biologia e Patologia Molecolare
Fisiopatologia Renale e Malattie
Osteometaboliche
Fisiopatologia Sperimentale e Diagnostica
Funzionale e per Immagini del Sistema
Cardio-Polmonare
Neuroscienze
Fisiopatologia Sistemica
Biologia del Comportamento
Microbiologia e Virologia
Scienze della Prevenzione
Biologia e Patologia Molecolare
Fisiopatologia Renale e Malattie
Osteometaboliche
Fisiopatologia Sperimentale e Diagnostica
Funzionale e per Immagini del Sistema
Cardio-Polmonare
Residenti in
Anno di
Residenti in
provincia di
corso Emilia-Romagna
Parma
4
1
0
3
1
1
Residenti
extraregione
Iscritti
2
4
3
5
3
1
0
1
2
3
3
3
3
3
2
0
1
1
2
0
3
0
0
0
1
0
2
3
2
3
1
2
2
3
3
4
3
2
5
2
1
1
2
3
2
4
3
3
7
2
2
2
2
2
1
1
0
0
0
2
6
1
0
0
0
2
4
2
3
3
1
2
0
3
3
3
1
4
6
1
3
3
0
3
1
3
2
2
5
86
Dottorati area medica attivi nell’anno
2013
Neuroscienze
Scienze della Prevenzione
Fisiopatologia Sistemica
Microbiologia e Virologia
Biologia del Comportamento
Totale
Residenti in
Anno di
Residenti in
provincia di
corso Emilia-Romagna
Parma
1
2
1
1
1
1
1
1
1
1
3
2
1
0
0
37
25
Residenti
extraregione
Iscritti
1
5
4
0
3
51
3
6
5
3
3
88
2.5 Assetto organizzativo
L'assetto aziendale al 31 dicembre 2013 per i Dipartimenti ad Attività Integrata è definito sulla base
dell'Atto aziendale (delibere 221 del 22.11.2006 e 129 del 31.05.2010 con le quali è stato approvato e
successivamente modificato l’Atto Aziendale) ed è dettagliato come riportato nelle tabelle delle pagine
che seguono.
Razionalizzazione del Modello Organizzativo Dipartimentale - Redazione del Manuale
Organizzativo Dipartimenti Attività Integrata (DAI)
La necessità di standardizzare i contenuti organizzativi dei Dipartimenti attraverso un Manuale
Organizzativo Aziendale di Dipartimento (Manuale Qualità), nasce dalla necessità di aggiornare la
descrizione del modello organizzativo aziendale oltre che di semplificare il lavoro di redazione dei
Dipartimenti dei contenuti previsti dal Modello Regionale per l’Accreditamento. Il Manuale Organizzativo
dei Dipartimenti nel rappresentare l’immagine dell’organizzazione ed i livelli di responsabilità legati al
contesto aziendale, rende trasparenti i processi di realizzazione del servizio reso ai cittadini. In piena
coerenza con la Missione e la Visione aziendale espresse nell’Atto Aziendale, il Dipartimento ad Attività
Integrata intende soddisfare la richiesta di assistenza per le patologie di competenza nei setting
assistenziali appropriati, in modalità programmata e nelle situazioni di urgenza-emergenza (in accordo
con il modello organizzativo Hub and Spoke adottato dalla regione Emilia-Romagna e con la
programmazione del Piano Attuativo Locale Provinciale). Il Dipartimento ad Attività Integrata opera al
fine di favorire il trasferimento delle conoscenze scientifiche nelle attività clinico-assistenziali a vantaggio
della popolazione che afferisce all’Azienda Ospedaliero-Universitaria di Parma, nonché le attività di
formazione e didattica per studenti e specializzandi. Sul piano assistenziale il Dipartimento opera per
affrontare in modo coordinato ed integrato i percorsi di diagnosi e terapia nell’ottica dell’appropriatezza,
dell’efficienza e dell’equità di accesso. Il Dipartimento, nella propria azione di governo, ha come principi
ispiratori: la promozione della qualità, l’appropriatezza, l’efficienza, l’efficacia, la valorizzazione delle
risorse e la sicurezza.
Nel corso del 2013 è stato redatto e validato il nuovo Manuale Organizzativo o Manuale della Qualità del
Dipartimento, per descrivere il modello organizzativo del Dipartimento ad Attività Integrata dell’Azienda
Ospedaliero-Universitaria di Parma, secondo il Sistema di Gestione per la Qualità della Regione EmiliaRomagna. Il Manuale Organizzativo é articolato in 10 capitoli, che richiamano i capitoli del modello di
Accreditamento regionale (fonte Manuale Qualità, 2013).
Il Manuale è stato presentato e validato in Collegio di Direzione e successivamente è stato trasmesso a
tutte le articolazioni organizzative dell’Azienda.
I Direttori dei Dipartimenti, assieme ai Direttori delle Strutture Complesse e ai Responsabili delle
Strutture Semplici Dipartimentali e Strutture Semplici, sono responsabili dell’approvazione del Manuale: il
Direttore Sanitario è invece responsabile della sua autorizzazione.
87
2. Profilo aziendale
Si consideri che, ai fini della definizione dell'assetto, il personale a tempo determinato (dirigenza e
comparto) è "fotografato" al 31.12.2013, come unità in servizio a tale data.
Per l'indicazione della disciplina ministeriale si è optato per il codice di riferimento dell'attività di ricovero,
ove disponibile, o per quello che identifica l'attività prevalente.
Al computo complessivo dei posti letto vanno aggiunti 8 posti letto pensionanti in regime ordinario, che
sono assegnati a diverse unità operative.
2. Profilo aziendale
I Direttori, i Coordinatori, la Rete Qualità del Dipartimento, hanno contribuito alla stesura degli Allegati e
delle parti specifiche. La diffusione del Manuale e degli allegati è avvenuta attraverso la rete Intranet
Aziendale.
Il Manuale, che prevede revisioni periodiche, potrà essere aggiornato ogni qual volta si presentino
cambiamenti avvenuti nella struttura organizzativa dell’Azienda, del Dipartimento e/o delle Unità
Operative afferenti, oltre che per quanto concerne la documentazione aziendale di riferimento o nei
contenuti stessi del Manuale. Eventuali problematiche riscontrate
Per la visita esterna di Accreditamento del Dipartimento Patologia e Medicina di Laboratorio è stato
utilizzato il precedente Manuale, in quanto la redazione era stata appena completata.
L’obiettivo di definizione del Manuale Organizzativo dei Dipartimenti per l’Accreditamento, corredato dal
sistema documentale condiviso con il Collegio di Direzione, è stato pienamente raggiunto in quanto il
Manuale è stato redatto, condiviso e sperimentato con due domande di Accreditamento (Dipartimento
Testa Collo e Dipartimento Medico Polispecialistico) e una visita di verifica esterna (Dipartimento Cardio
Nefro Polmonare).
88
Ϯϭ
ϭϮ
ϴ
Ϯϭ
ϭϮ
Ϯϭ
hŶŝǀĞƌƐŝƚĂƌŝŽ
hŶŝǀĞƌƐŝƚĂƌŝŽ
ŝƌŝŐĞŶƚĞĚĞů^^Z
hŶŝǀĞƌƐŝƚĂƌŝŽ
ŝƌŝŐĞŶƚĞĚĞů^^Z
hŶŝǀĞƌƐŝƚĂƌŝŽ
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
^ƚƌƵƚƚƵƌĂƐĞŵƉůŝĐĞ
ĚŝƉĂƌƚŝŵĞŶƚĂůĞ
^ƚƌƵƚƚƵƌĂƐĞŵƉůŝĐĞ
ĚŝƉĂƌƚŝŵĞŶƚĂůĞ
^ƚƌƵƚƚƵƌĂƐĞŵƉůŝĐĞ
ĚŝƉĂƌƚŝŵĞŶƚĂůĞ
ϴ
ϯ
ϭ
ϭ
ϭ
3RVWL/HWWR/'
Ϯ
ϯ
ϯ
3RVWL/HWWR'+
ϱϱ
ŝƌŝŐĞŶƚĞĚĞů^^Z
3RVWL/HWWR2UGLQDUL
hŶŝƚăKƉĞƌĂƚŝǀĂ
Ϯϵ
Ϭ
ϰ
ϭ
ϱ
ϲ
ϲ
ϭ
ϭ
ϵ
ϮϮ
ϰ
ϭ
ϱ
ϲ
ϲ
ϭ
ϭ
ϵ
Ϯϯ
'LULJHQWLPHGLFL6657DEHOOD
FRQWRDQQXDOH
hŶŝǀĞƌƐŝƚĂƌŝŽ
'LULJHQWLPHGLFL665
UDSSRUWRHVFOXVLYR
'LULJHQWLPHGLFL665WHPSR
GHWHUPLQDWR
hŶŝƚăKƉĞƌĂƚŝǀĂ
ϭ
Ϯ
Ϯ
ϯ
ϭ
ϲ
Ϯ
'LULJHQWLPHGLFLXQLYHUVLWDUL
ϭ
Ϯ
Ϯ
Ϭ
ϯ
ϭ
ϲ
Ϭ
Ϯ
Ϭ
'LULJHQWLPHGLFLXQLYHUVLWDUL
UDSSRUWRHVFOXVLYR
&ƵŶnjŝŽŶĂůŝƚăWŽůŵŽŶĂƌĞ
ϭ
'LULJHQWLVDQLWDULQRQPHGLFL
XQLYHUVLWDUL
ϬϮϬϯ
ϱ
ϰϰ
ϭϬ
ϭϱ
ϯϴ
ϭϰ
ϭϭ
Ϯϯ
ϱϱ
ϲϰ
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
665WDEHOODFRQWRDQQXDOH
ĂLJ,ŽƐƉŝƚĂůWŶĞƵŵŽůŽŐŝĐŽ
Ϯ
ϭ
ϯ
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
XQLYHUVLWDULR
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
665WHPSRGHWHUPLQDWR
ϬϳϬϭͲϰϵϬϮ
ϬϴϬϭͲϬϴϬϯͲ
ĂƌĚŝŽůŽŐŝĂ
ϱϬϬϭ
ůŝŶŝĐĂĞ/ŵŵƵŶŽůŽŐŝĂDĞĚŝĐĂ
ϮϲϬϵͲϮϲϭϬ
ůŝŶŝĐĂWŶĞƵŵŽůŽŐŝĐĂ
ϲϴϬϭ
&ŝƐŝŽƉĂƚŽůŽŐŝĂZĞƐƉŝƌĂƚŽƌŝĂ
ϰϵϬϯ
EĞĨƌŽůŽŐŝĂ
ϮϵϬϭͲϰϴϬϭ
WŶĞƵŵŽůŽŐŝĂĞĚŶĚŽƐĐŽƉŝĂƚŽƌĂĐŝĐĂ ϲϴϬϮ
^ĞŵĞŝŽƚŝĐĂDĞĚŝĐĂ
ϮϲϬϴ
ŽŽƌĚŝŶĂŵĞŶƚŽƚƚŝǀŝƚă^ƉĞĐŝĂůŝƐƚŝĐŚĞ
ŵďƵůĂƚŽƌŝĂůŝĂƌĚŝŽůŽŐŝĐŚĞ
$WWULEX]LRQHGHOOD
'LUH]LRQHGHOOD
6WUXWWXUD
ϭ
ϭϳ
ϭ
ϱ
ϮϬ
ϴ
ϴ
ϳ
ϭϳ
Ϯϰ
ϭ
Ϯ
Ϯ
ϭ
ϴ
Ϯ
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFRXQLYHUVLWDULR
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFR665WHPSR
GHWHUPLQDWR
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFR6657DEHOODFRQWR
DQQXDOH
ĂƌĚŝŽĐŚŝƌƵƌŐŝĂ
'LVFLSOLQD
7LSRVWUXWWXUD
0LQLVWHULDOH
6WUXWWXUHDIIHUHQWLDO
'LSDUWLPHQWR
8QLYHUVLWDULR
&$5',21()5232/021$5(
'LUH]LRQH'LSDUWLPHQWR ',3$57,0(172
ϭ
Ϯ
Ϯ
ϯ
ϲ
%RUVLVWL
&RQWUDWWLVWL
'LULJHQWLVDQLWDULQRQPHGLFL
6657DEHOODFRQWRDQQXDOH
3RVWL/HWWR'6
ϭ
ŝƌŝŐĞŶƚĞĚĞů^^Z
ϰ
ϭϱ
ϴ
ϭϰ
Ϯϭ
ϭϵ
ϯϮ
ϯϮ
Ϯϲ
Ϯ
Ϯ
Ϯ
ϳ
3RVWL/HWWR'6
ϵϴϬϭ
ϴ
3RVWL/HWWR2UGLQDUL
hŶŝǀĞƌƐŝƚĂƌŝŽ
3RVWL/HWWR'+
^ƚƌƵƚƚƵƌĂƐĞŵƉůŝĐĞ
ĚŝƉĂƌƚŝŵĞŶƚĂůĞ
^ƚƌƵƚƚƵƌĂƐĞŵƉůŝĐĞ
ĚŝƉĂƌƚŝŵĞŶƚĂůĞ
ϭ
ϳ
ϭ
Ϯ
ϰ
ϳ
ϵ
ϭϮ
ϯϵ
'LULJHQWLPHGLFL6657DEHOOD
FRQWRDQQXDOH
ϭ
Ϭ
ϰ
ϭ
Ϭ
Ϯ
ϰ
ϰ
ϭ
ϴ
ϭ ϭϯ
ϯϵ
'LULJHQWLPHGLFL665
UDSSRUWRHVFOXVLYR
'LULJHQWLPHGLFL665WHPSR
GHWHUPLQDWR
hŶŝƚăKƉĞƌĂƚŝǀĂ
Ϯ
ϯ
ϰ
ϳ
ϳ
ϰ
ϭ
Ϯ
'LULJHQWLPHGLFLXQLYHUVLWDUL
ŝƌŝŐĞŶƚĞĚĞů^^Z
hŶŝǀĞƌƐŝƚĂƌŝŽ
hŶŝǀĞƌƐŝƚĂƌŝŽ
hŶŝǀĞƌƐŝƚĂƌŝŽ
hŶŝǀĞƌƐŝƚĂƌŝŽ
hŶŝǀĞƌƐŝƚĂƌŝŽ
hŶŝǀĞƌƐŝƚĂƌŝŽ
ŝƌŝŐĞŶƚĞĚĞů^^Z
Ϭ
Ϯ
Ϭ
ϯ
ϰ
ϳ
ϲ
ϯ
ϭ
Ϭ
Ϯ
'LULJHQWLPHGLFLXQLYHUVLWDUL
UDSSRUWRHVFOXVLYR
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
'LULJHQWLVDQLWDULQRQPHGLFL
XQLYHUVLWDUL
hŶŝǀĞƌƐŝƚĂƌŝŽ
ϯϮ
ϱϴ
ϯϮ
ϭϬ
ϳ
ϭϬ
ϱ
ϭϵ
ϭϳ
ϰϬ
ϯϵ
Ϯϳ
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
665WDEHOODFRQWRDQQXDOH
hŶŝƚăKƉĞƌĂƚŝǀĂ
Ϯ
Ϯ
ϭ
ϯ
ϭ
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
XQLYHUVLWDULR
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
665WHPSRGHWHUPLQDWR
ĂLJ^ƵƌŐĞƌLJ
$WWULEX]LRQHGHOOD
'LUH]LRQHGHOOD
6WUXWWXUD
ϭϲ
ϭϵ
ϵ
ϭ
ϭ
Ϯ
ϴ
ϳ
ϭϬ
ϭϱ
ϭϬ
ϭ
ϭ
ϭ
ϭ
ϭ
ϭ
Ϯ
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFRXQLYHUVLWDULR
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFR665WHPSR
GHWHUPLQDWR
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFR6657DEHOODFRQWR
DQQXDOH
ϮΣŶĞƐƚĞƐŝĂ͕ZŝĂŶŝŵĂnjŝŽŶĞĞdĞƌĂƉŝĂ
ϰϵϬϰ
ŶƚĂůŐŝĐĂ
ŚŝƌƵƌŐŝĂWůĂƐƚŝĐĂĞĞŶƚƌŽhƐƚŝŽŶŝ
ϭϮϬϭ
ŚŝƌƵƌŐŝĂdŽƌĂĐŝĐĂ
ϭϯϬϭ
ŚŝƌƵƌŐŝĂsĂƐĐŽůĂƌĞ
ϭϰϬϭ
ůŝŶŝĐĂŚŝƌƵƌŐŝĐĂĞdĞƌĂƉŝĂŚŝƌƵƌŐŝĐĂ ϬϵϬϯ
ůŝŶŝĐĂŚŝƌƵƌŐŝĐĂĞdƌĂƉŝĂŶƚŝĚΖKƌŐĂŶŽϬϵϬϰ
ůŝŶŝĐĂKƌƚŽƉĞĚŝĐĂ
ϯϲϬϭ
KƌƚŽƉĞĚŝĂ
ϯϲϬϮ
hƌŽůŽŐŝĂ
ϰϯϬϭ
ƚƚŝǀŝƚăŽŵƵŶŝKƌƚŽƉĞĚŝĞ
ƚƚŝǀŝƚăŽŵƵŶŝŝƉĂƌƚŝŵĞŶƚŽ
ŚŝƌƵƌŐŝĐŽ
ŚŝƌƵƌŐŝĂĚĞůůĂƵƚĞĞĚĞŐůŝŶŶĞƐƐŝ͕
ϭϮϬϮ
DŝŶŝŶǀĂƐŝǀĂ͕ZŝŐĞŶĞƌĂƚŝǀĂĞWůĂƐƚŝĐĂ
'LVFLSOLQD
7LSRVWUXWWXUD
0LQLVWHULDOH
6WUXWWXUHDIIHUHQWLDO
'LSDUWLPHQWR
8QLYHUVLWDULR
&+,585*,&2
'LUH]LRQH'LSDUWLPHQWR ',3$57,0(172
ϯ
ϭ
ϭ
ϭ
%RUVLVWL
&RQWUDWWLVWL
'LULJHQWLVDQLWDULQRQPHGLFL
6657DEHOODFRQWRDQQXDOH
3RVWL/HWWR/'
ŝƌŝŐĞŶƚĞĚĞů^^Z
3RVWL/HWWR/'
3RVWL/HWWR2UGLQDUL
ϵ
ϲ
ϲϮ
ϭϮ
ϯ
ϵ
ϳ
ϭϬ
'LULJHQWLPHGLFL6657DEHOOD
FRQWRDQQXDOH
ϯ
ϴ
ϭ
ϯ
ϭϬ
ϳ
ϭϬ
'LULJHQWLPHGLFL665
UDSSRUWRHVFOXVLYR
'LULJHQWLPHGLFL665WHPSR
GHWHUPLQDWR
ϮϮ
Ϯϲ
ϯϮ
ϭϮ
ϱ
ϱ
ϯϲ
ϰ ϯϮ
Ϯϴ
ϯ
ϰ
ϭ
ϯ
Ϭ
ϰ
ϭ
ϭϲ
Ϯ
ϯ
ϭϴ
ϭϳ
ϯϱ
ϲϭ
ϴϵ
ϰϱ
ϯϮ
ϮϬ
ϭϵ
'LULJHQWLPHGLFLXQLYHUVLWDUL
hŶŝǀĞƌƐŝƚĂƌŝŽ
ŝƌŝŐĞŶƚĞĚĞů^^Z
hŶŝǀĞƌƐŝƚĂƌŝŽ
ŝƌŝŐĞŶƚĞĚĞů^^Z
'LULJHQWLPHGLFLXQLYHUVLWDUL
UDSSRUWRHVFOXVLYR
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
ϯϲ
ϯϯ
ϭ
ϴ
ϴ
'LULJHQWLVDQLWDULQRQPHGLFL
XQLYHUVLWDUL
ϮϭϬϭ
ϮϭϬϭ
ϲϬϬϮͲϲϬϬϰ
ϱϲϬϭͲϲϬϬϭ
ϯϯ
ϭ
ϴ
ϴ
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
665WDEHOODFRQWRDQQXDOH
ϭ
ϴ
ϯ
ϭ
ϴ
ϰ
ϭ
ϭ
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
XQLYHUVLWDULR
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
665WHPSRGHWHUPLQDWR
hŶŝƚăKƉĞƌĂƚŝǀĂ
$WWULEX]LRQHGHOOD
'LUH]LRQHGHOOD
6WUXWWXUD
ϭ
ϱ
ϭ
ϭϳ
ϴ
ϴ
ϱ
ϰϯ
ϴ
ϭϬ
ϭϬ
Ϯϴ
ϭϰ
ϭ
Ϯ
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFRXQLYHUVLWDULR
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFR665WHPSR
GHWHUPLQDWR
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFR6657DEHOODFRQWR
DQQXDOH
ϬϮϬϭ
'LVFLSOLQD
7LSRVWUXWWXUD
0LQLVWHULDOH
Ϯ
Ϯ
Ϯ
Ϯ
ϭ
Ϯ
ϯ
ϱ
&RQWUDWWLVWL
ƚƚŝǀŝƚăŽŵƵŶŝŝƉĂƌƚŝŵĞŶƚŽ
'ĞƌŝĂƚƌŝĐŽͲZŝĂďŝůŝƚĂƚŝǀŽ
ůŝŶŝĐĂ'ĞƌŝĂƚƌŝĐĂ
'ĞƌŝĂƚƌŝĂ
>ƵŶŐŽĚĞŐĞŶnjĂƌŝƚŝĐĂ
DĞĚŝĐŝŶĂZŝĂďŝůŝƚĂƚŝǀĂ
6WUXWWXUHDIIHUHQWLDO
'LSDUWLPHQWR
'LULJHQWHGHO665
3RVWL/HWWR'+
3RVWL/HWWR'6
3RVWL/HWWR2UGLQDUL
ϭϰ
Ϯϭ
ϭϰ
3RVWL/HWWR/'
'LUH]LRQH'LSDUWLPHQWR 'LULJHQWLPHGLFL6657DEHOOD
FRQWRDQQXDOH
'LULJHQWLPHGLFL665
UDSSRUWRHVFOXVLYR
'LULJHQWLPHGLFL665WHPSR
GHWHUPLQDWR
'LULJHQWLVDQLWDULQRQPHGLFL
6657DEHOODFRQWRDQQXDOH
*(5,$75,&25,$%,/,7$7,92
'LULJHQWLPHGLFLXQLYHUVLWDUL
'LULJHQWLPHGLFLXQLYHUVLWDUL
UDSSRUWRHVFOXVLYR
&RQWUDWWLVWL
',3$57,0(172
'LULJHQWLVDQLWDULQRQPHGLFL
XQLYHUVLWDUL
ϮϲϭϰͲϵϳϬϭ
^ƚƌƵƚƚƵƌĂƐĞŵƉůŝĐĞ
ĚŝƉĂƌƚŝŵĞŶƚĂůĞ
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
665WDEHOODFRQWRDQQXDOH
DĞĚŝĐŝŶĂ/ŶƚĞƌŶĂ
ŝƌŝŐĞŶƚĞĚĞů^^Z
hŶŝƚăKƉĞƌĂƚŝǀĂ
ϱϭϬϭ
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFRXQLYHUVLWDULR
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFR665WHPSR
GHWHUPLQDWR
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFR6657DEHOODFRQWR
DQQXDOH
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
XQLYHUVLWDULR
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
665WHPSRGHWHUPLQDWR
ŝƌŝŐĞŶƚĞĚĞů^^Z
ŝƌŝŐĞŶƚĞĚĞů^^Z
ŝƌŝŐĞŶƚĞĚĞů^^Z
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
ϰϵϬϭ
ϬϵϬϲ
ϯϬϬϮ
ϭΣŶĞƐƚĞƐŝĂĞZŝĂŶŝŵĂnjŝŽŶĞ
ĞŶƚƌĂůĞKƉĞƌĂƚŝǀĂϭϭϴ
ŚŝƌƵƌŐŝĂĚΖhƌŐĞŶnjĂ
EĞƵƌŽĐŚŝƌƵƌŐŝĂͲEĞƵƌŽƚƌĂƵŵĂƚŽůŽŐŝĂ
WƌŽŶƚŽ^ŽĐĐŽƌƐŽĞDĞĚŝĐŝŶĂ
ĚΖhƌŐĞŶnjĂ
$WWULEX]LRQHGHOOD
'LUH]LRQHGHOOD
6WUXWWXUD
'LVFLSOLQD
7LSRVWUXWWXUD
0LQLVWHULDOH
6WUXWWXUHDIIHUHQWLDO
'LSDUWLPHQWR
'LULJHQWHGHO665
(0(5*(1=$85*(1=$
'LUH]LRQH'LSDUWLPHQWR ',3$57,0(172
%RUVLVWL
%RUVLVWL
'LULJHQWLVDQLWDULQRQPHGLFL
6657DEHOODFRQWRDQQXDOH
3RVWL/HWWR'6
3RVWL/HWWR'+
ϭ
ϭ
ϯϵϬϯ
ĂƌĚŝŽůŽŐŝĂWĞĚŝĂƚƌŝĐĂ
ŽŽƌĚŝŶĂŵĞŶƚŽƚƚŝǀŝƚăĚŝĂLJ
,ŽƐƉŝƚĂů
ŝƌŝŐĞŶƚĞĚĞů^^Z
hŶŝǀĞƌƐŝƚĂƌŝŽ
hŶŝǀĞƌƐŝƚĂƌŝŽ
ŝƌŝŐĞŶƚĞĚĞů^^Z
Ϯϭ
ϰϯ
ϭϱ
ϮϬ
ϴ
ϱ
ϴ
3RVWL/HWWR/'
3RVWL/HWWR'6
ϭ
ϱ
ϲ
ϲ
ϳ
ϭϬ
ϳ
ϰ
ϳ
ϱ
ϭ
Ϭ
ϭ
ϲ
ϱ ϭϬ
ϲ
ϳ
ϭϬ
ϭ
ϭ
ϭ
ϭ
ϰ
Ϯ
ϲ
Ϭ
ϭ
ϭ
ϰ
Ϭ
Ϭ
ϭ
Ϭ
ϱ
Ϯ
ϴ
ϱϳ
ϵϮ
Ϯϯ
ϱϴ
ϭϴ
ϵ
Ϯϰ
1RWDO¶DWWLYD]LRQHHIIHWWLYDGHOODVWUXWWXUD3HGLDWULD*HQHUDOHHG¶8UJHQ]DqDYYHQXWDDSDUWLUHGDIHEEUDLRFRQLOWUDVIHULPHQWRSUHVVRO¶2VSHGDOHGHL%DPELQL³3LHWUR%DULOOD´HFRQO¶DVVHJQD]LRQHGLSRVWLOHWWRHSHUVRQDOHGHGLFDWR
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
^ƚƌƵƚƚƵƌĂƐĞŵƉůŝĐĞ
ĚŝƉĂƌƚŝŵĞŶƚĂůĞ
^ƚƌƵƚƚƵƌĂƐĞŵƉůŝĐĞ
ĚŝƉĂƌƚŝŵĞŶƚĂůĞ
3RVWL/HWWR2UGLQDUL
ϴ
ϭϬ
3RVWL/HWWR'+
ϲϮϬϭ
ϯϳϬϭ
ϯϵϬϭͲϲϱϬϭ
'LULJHQWLVDQLWDULQRQPHGLFL
6657DEHOODFRQWRDQQXDOH
hŶŝǀĞƌƐŝƚĂƌŝŽ
hŶŝƚăKƉĞƌĂƚŝǀĂ
'LULJHQWLPHGLFL6657DEHOOD
FRQWRDQQXDOH
'LULJHQWLPHGLFLXQLYHUVLWDUL
ŝƌŝŐĞŶƚĞĚĞů^^Z
hŶŝǀĞƌƐŝƚĂƌŝŽ
'LULJHQWLPHGLFL665
UDSSRUWRHVFOXVLYR
'LULJHQWLPHGLFL665WHPSR
GHWHUPLQDWR
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
'LULJHQWLPHGLFLXQLYHUVLWDUL
UDSSRUWRHVFOXVLYR
ϭϭϬϭ
ϯϵϬϮ
'LULJHQWLVDQLWDULQRQPHGLFL
XQLYHUVLWDUL
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
665WDEHOODFRQWRDQQXDOH
hŶŝƚăKƉĞƌĂƚŝǀĂ
ϭϬ
ϯ
ϵ
ϯ
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
XQLYHUVLWDULR
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
665WHPSRGHWHUPLQDWR
ϬϮϬϰ
$WWULEX]LRQHGHOOD
'LUH]LRQHGHOOD
6WUXWWXUD
ϭ
ϱ
Ϯϳ
ϱ
ϭϵ
ϭϬ
ϰ
ϭ
ϯ
Ϯ
ϭ
ϭ
ϭ
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFRXQLYHUVLWDULR
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFR665WHPSR
GHWHUPLQDWR
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFR6657DEHOODFRQWR
DQQXDOH
ƚƚŝǀŝƚăŽŵƵŶŝŝƉĂƌƚŝŵĞŶƚŽ
DĂƚĞƌŶŽͲ/ŶĨĂŶƚŝůĞ
ŚŝƌƵƌŐŝĂWĞĚŝĂƚƌŝĐĂ
ůŝŶŝĐĂWĞĚŝĂƚƌŝĐĂ
'ĂƐƚƌŽĞŶƚĞƌŽůŽŐŝĂĞĚŶĚŽƐĐŽƉŝĂ
ŝŐĞƐƚŝǀĂ
EĞŽŶĂƚŽůŽŐŝĂ
KƐƚĞƚƌŝĐŝĂĞ'ŝŶĞĐŽůŽŐŝĂ
WĞĚŝĂƚƌŝĂĞKŶĐŽĞŵĂƚŽůŽŐŝĂ
WĞĚŝĂƚƌŝĂ'ĞŶĞƌĂůĞĞĚΖhƌŐĞŶnjĂ
'LVFLSOLQD
7LSRVWUXWWXUD
0LQLVWHULDOH
6WUXWWXUHDIIHUHQWLDO
'LSDUWLPHQWR
8QLYHUVLWDULR
0$7(512,1)$17,/(
'LUH]LRQH'LSDUWLPHQWR ',3$57,0(172
ϭ
ϭ
ϭ
ϯ
ϭ
Ϯ
Ϯ
Ϯ
%RUVLVWL
&RQWUDWWLVWL
ϯϬϬϭ
ϯϮϬϭ
EĞƵƌŽĐŚŝƌƵƌŐŝĂ
EĞƵƌŽůŽŐŝĂ
EĞƵƌŽƌĂĚŝŽůŽŐŝĂ
ĞŶƚƌŽĞĨĂůĞĞ
ϯ
ϰ
ϰ
ϯ
ϰ
3RVWL/HWWR'+
3RVWL/HWWR2UGLQDUL
ϲ
ϱ
ϭϬ
'LULJHQWLPHGLFL6657DEHOOD
FRQWRDQQXDOH
ϲ
ϱ
ϭ ϭϭ
'LULJHQWLPHGLFL665
UDSSRUWRHVFOXVLYR
'LULJHQWLPHGLFL665WHPSR
GHWHUPLQDWR
ϮϬ
ϴ
ϵ
ϭϭ
ϵ
Ϭ
Ϭ
ϭ
Ϭ
Ϭ
ϭ
ϭ
ϭ
ϭϬ
'LULJHQWLPHGLFLXQLYHUVLWDUL
ϭ
Ϯ
ϭ
Ϭ
ϭϬ
Ϭ
'LULJHQWLPHGLFLXQLYHUVLWDUL
UDSSRUWRHVFOXVLYR
'LULJHQWLVDQLWDULQRQPHGLFL
XQLYHUVLWDUL
Ϯϲ
ϭϰ
ϭ
ϭ
ϭϯ
ϭ
ϭϯ
ϯ ϭϮ
Ϯϵ
Ϯϯ
Ϯϲ
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
665WDEHOODFRQWRDQQXDOH
hŶŝǀĞƌƐŝƚĂƌŝŽ
ϵ
ϭϭ
ϭ
ϵ
ϭ
ϱ
ϱ
ϯ
ϭϭ
ϯ
ϵ
ϭ
ϭ
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFRXQLYHUVLWDULR
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFR665WHPSR
GHWHUPLQDWR
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFR6657DEHOODFRQWR
DQQXDOH
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
XQLYHUVLWDULR
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
665WHPSRGHWHUPLQDWR
ŝƌŝŐĞŶƚĞĚĞů^^Z
hŶŝǀĞƌƐŝƚĂƌŝŽ
ŝƌŝŐĞŶƚĞĚĞů^^Z
$WWULEX]LRQHGHOOD
'LUH]LRQHGHOOD
6WUXWWXUD
ϭ
ϯ
ϯ
ϯ
ϯ
Ϯ
ϭ
%RUVLVWL
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
^ƚƌƵƚƚƵƌĂƐĞŵƉůŝĐĞ
ĚŝƉĂƌƚŝŵĞŶƚĂůĞ
'LVFLSOLQD
7LSRVWUXWWXUD
0LQLVWHULDOH
6WUXWWXUHDIIHUHQWLDO
'LSDUWLPHQWR
'LULJHQWHGHO665
&RQWUDWWLVWL
'LUH]LRQH'LSDUWLPHQWR Ϯ
ϭϵ
Ϯ
Ϯϭ
3RVWL/HWWR'6
'LULJHQWLPHGLFLXQLYHUVLWDUL
UDSSRUWRHVFOXVLYR
'LULJHQWLVDQLWDULQRQPHGLFL
XQLYHUVLWDUL
',3$57,0(1721(8526&,(1=(
ŝƌŝŐĞŶƚĞĚĞů^^Z
ŝƌŝŐĞŶƚĞĚĞů^^Z
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
665WDEHOODFRQWRDQQXDOH
dƌĂƚƚĂŵĞŶƚŽ/ŶƚĞŶƐŝǀŽĚĞůŝĂďĞƚĞĞ
Ϯϲϭϯ
ĚĞůůĞƐƵĞŽŵƉůŝĐĂŶnjĞ
ϮϲϬϮ
3RVWL/HWWR2UGLQDUL
ϴ
3RVWL/HWWR'+
DĞĚŝĐŝŶĂ/ŶƚĞƌŶĂ͕ZĞƵŵĂƚŽůŽŐŝĂ
3RVWL/HWWR/'
'LULJHQWLPHGLFLXQLYHUVLWDUL
DĂůĂƚƚŝĞĚĞůƌŝĐĂŵďŝŽĞĚŝĂďĞƚŽůŽŐŝĂ ŝƌŝŐĞŶƚĞĚĞů^^Z
'LULJHQWLPHGLFL6657DEHOOD
FRQWRDQQXDOH
ŝƌŝŐĞŶƚĞĚĞů^^Z
'LULJHQWLVDQLWDULQRQPHGLFL
6657DEHOODFRQWRDQQXDOH
^ƚƌƵƚƚƵƌĂƐĞŵƉůŝĐĞ
ĚŝƉĂƌƚŝŵĞŶƚĂůĞ
^ƚƌƵƚƚƵƌĂƐĞŵƉůŝĐĞ
ĚŝƉĂƌƚŝŵĞŶƚĂůĞ
^ƚƌƵƚƚƵƌĂƐĞŵƉůŝĐĞ
ĚŝƉĂƌƚŝŵĞŶƚĂůĞ
^ƚƌƵƚƚƵƌĂƐĞŵƉůŝĐĞ
ĚŝƉĂƌƚŝŵĞŶƚĂůĞ
hŶŝƚăKƉĞƌĂƚŝǀĂ
Ϯϲϭϭ
'LULJHQWLPHGLFL665
UDSSRUWRHVFOXVLYR
'LULJHQWLPHGLFL665WHPSR
GHWHUPLQDWR
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
XQLYHUVLWDULR
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
665WHPSRGHWHUPLQDWR
ϬϮϬϱ
hŶŝƚăKƉĞƌĂƚŝǀĂ
ϱϴϬϭ
'ĂƐƚƌŽĞŶƚĞƌŽůŽŐŝĂ
DĞĚŝĐŝŶĂ/ŶƚĞƌŶĂĂĚ/ŶĚŝƌŝnjnjŽ
ŶŐŝŽůŽŐŝĐŽĞŽĂŐƵůĂƚŝǀŽ
$WWULEX]LRQHGHOOD
'LUH]LRQHGHOOD
6WUXWWXUD
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFRXQLYHUVLWDULR
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFR665WHPSR
GHWHUPLQDWR
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFR6657DEHOODFRQWR
DQQXDOH
ĂLJ,ŽƐƉŝƚĂůŝƉĂƌƚŝŵĞŶƚĂůĞ
'LVFLSOLQD
7LSRVWUXWWXUD
0LQLVWHULDOH
6WUXWWXUHDIIHUHQWLDO
'LSDUWLPHQWR
0(',&232/,63(&,$/,67,&2
'LUH]LRQH'LSDUWLPHQWR ',3$57,0(172
%RUVLVWL
&RQWUDWWLVWL
'LULJHQWLVDQLWDULQRQPHGLFL
6657DEHOODFRQWRDQQXDOH
3RVWL/HWWR/'
3RVWL/HWWR'6
3RVWL/HWWR2UGLQDUL
'LVFLSOLQD
7LSRVWUXWWXUD
0LQLVWHULDOH
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
^ƚƌƵƚƚƵƌĂƐĞŵƉůŝĐĞ
ĚŝƉĂƌƚŝŵĞŶƚĂůĞ
ŝĂŐŶŽƐƚŝĐĂŵĂƚŽĐŚŝŵŝĐĂ
/ŵŵƵŶŽĞŵĂƚŽůŽŐŝĂĞDĞĚŝĐŝŶĂ
dƌĂƐĨƵƐŝŽŶĂůĞ
DŝĐƌŽďŝŽůŽŐŝĂ
sŝƌŽůŽŐŝĂ
ŝŽĐŚŝŵŝĐĂĂĚůĞǀĂƚĂƵƚŽŵĂnjŝŽŶĞ
ϯ
ϯ
Ϯ
ϴ
ϱ
'LULJHQWLPHGLFL6657DEHOOD
FRQWRDQQXDOH
ϭ
ϯ
Ϯ
ϴ
ϲ
'LULJHQWLPHGLFL665
UDSSRUWRHVFOXVLYR
'LULJHQWLPHGLFL665WHPSR
GHWHUPLQDWR
ϰ
ϭϬ
Ϯ
ϰ
ϱ
ϭ
'LULJHQWLPHGLFLXQLYHUVLWDUL
'LULJHQWLVDQLWDULQRQPHGLFL
6657DEHOODFRQWRDQQXDOH
ϭ
Ϭ
Ϭ
Ϭ
ϯ
ϭϳ
ϭϭ
ϯϯ
ϲϱ
ϯ
ϭ
ϭ
ϭ
ϯ
Ϯ
ϰ
ϭϳ
Ϯϭ
ϳ
ϭϵ
ϲ
ϯϯ
ϯϲ
ϭϴ
ϱ
ϱ
ϳ
ϰ
ϰ
ϰ
ϭ
Ϭ
Ϭ
Ϭ
ϱ
ϳ
ϱ
ϰ
ϰ
ϭ
ϭ
ϭ
ϰ
Ϯ
ϰ
ϳ
ϭ
ϭ
ϭ
Ϯ
ϭ
Ϯ
ϭϲ
ϭϰ
ϰ
'LULJHQWLPHGLFL6657DEHOOD
FRQWRDQQXDOH
ϳ
ϭ
Ϯ
Ϯ
ϭ
Ϯ
ϭϲ
ϭϰ
ϰ
'LULJHQWLPHGLFL665
UDSSRUWRHVFOXVLYR
'LULJHQWLPHGLFL665WHPSR
GHWHUPLQDWR
'LULJHQWLPHGLFLXQLYHUVLWDUL
UDSSRUWRHVFOXVLYR
ŝƌŝŐĞŶƚĞĚĞů^^Z
'LULJHQWLVDQLWDULQRQPHGLFL
XQLYHUVLWDUL
ϱ
ϯ
Ϯ
ϭ
ϭ
ϰ
ϭ
ϭ
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
XQLYHUVLWDULR
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
665WHPSRGHWHUPLQDWR
hŶŝǀĞƌƐŝƚĂƌŝŽ
ϰ
ϭ
ϭϰ
ϳ
Ϯ
ϱ
ϭ
Ϯϰ
ϭϳ
ϯ
Ϯ
ϯ
ϭ
ϭ
ϲ
ϳ
ϵ
ϯϳ
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFRXQLYHUVLWDULR
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFR665WHPSR
GHWHUPLQDWR
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFR6657DEHOODFRQWR
DQQXDOH
ŝƌŝŐĞŶƚĞĚĞů^^Z
ϭ
Ϯ
ϭ
ϭ
ϭ
Ϯ
ϯ
ϰ
ϯ
ϰ
ϭ
ϱ
ϱ
ϱ
ϭ
Ϯ
%RUVLVWL
ŝƌŝŐĞŶƚĞĚĞů^^Z
$WWULEX]LRQHGHOOD
'LUH]LRQHGHOOD
6WUXWWXUD
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
665WDEHOODFRQWRDQQXDOH
6WUXWWXUHDIIHUHQWLDO
'LSDUWLPHQWR
'LUH]LRQH'LSDUWLPHQWR 3RVWL/HWWR'+
ϯϴ Ϯ
ϰ Ϯ
ϭϮ Ϯ
ϯϭ ϵ
ϭϰ ϮϬ
3RVWL/HWWR'6
3$72/2*,$(0(',&,1$',/$%25$725,2
3RVWL/HWWR/'
'LULJHQWLVDQLWDULQRQPHGLFL
6657DEHOODFRQWRDQQXDOH
'LULJHQWLPHGLFLXQLYHUVLWDUL
&RQWUDWWLVWL
',3$57,0(172
'LULJHQWLPHGLFLXQLYHUVLWDUL
UDSSRUWRHVFOXVLYR
'LULJHQWLVDQLWDULQRQPHGLFL
XQLYHUVLWDUL
hŶŝǀĞƌƐŝƚĂƌŝŽ
hŶŝǀĞƌƐŝƚĂƌŝŽ
hŶŝǀĞƌƐŝƚĂƌŝŽ
hŶŝǀĞƌƐŝƚĂƌŝŽ
hŶŝǀĞƌƐŝƚĂƌŝŽ
hŶŝǀĞƌƐŝƚĂƌŝŽ
ŝƌŝŐĞŶƚĞĚĞů^^Z
ŝƌŝŐĞŶƚĞĚĞů^^Z
ŝƌŝŐĞŶƚĞĚĞů^^Z
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
665WDEHOODFRQWRDQQXDOH
ϭϴϬϭ
$WWULEX]LRQHGHOOD
'LUH]LRQHGHOOD
6WUXWWXUD
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFRXQLYHUVLWDULR
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFR665WHPSR
GHWHUPLQDWR
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFR6657DEHOODFRQWR
DQQXDOH
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
XQLYHUVLWDULR
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
665WHPSRGHWHUPLQDWR
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
^ƚƌƵƚƚƵƌĂƐĞŵƉůŝĐĞ
ĚŝƉĂƌƚŝŵĞŶƚĂůĞ
ϮϲϬϲ
ϱϮϬϭ
ϭϴϬϭ
ϮϰϬϭ
ϲϰϬϭ
ŶĂƚŽŵŝĂĞ/ƐƚŽůŽŐŝĂWĂƚŽůŽŐŝĐĂ
ůŝŶŝĐĂĞdĞƌĂƉŝĂDĞĚŝĐĂ
ĞƌŵĂƚŽůŽŐŝĂ
ŵĂƚŽůŽŐŝĂĞ͘d͘D͘K͘
ŶĚŽĐƌŝŶŽůŽŐŝĂ
'ĞŶĞƚŝĐĂDĞĚŝĐĂ
DĂůĂƚƚŝĞ/ŶĨĞƚƚŝǀĞĞĚƉĂƚŽůŽŐŝĂ
KŶĐŽůŽŐŝĂDĞĚŝĐĂ
ZĂĚŝŽƚĞƌĂƉŝĂ
dƌĂƉŝĂŶƚŝDŝĚŽůůŽKƐƐĞŽĞĞůůƵůĞ
^ƚĂŵŝŶĂůŝŵŽƉŽŝĞƚŝĐŚĞ
'LVFLSOLQD
0LQLVWHULDOH 7LSRVWUXWWXUD
6WUXWWXUHDIIHUHQWLDO
'LSDUWLPHQWR
'LUH]LRQH'LSDUWLPHQWR 21&2(0$72/2*,&2,17(51,67,&2 ',3$57,0(172
%RUVLVWL
&RQWUDWWLVWL
3RVWL/HWWR/'
3RVWL/HWWR'6
3RVWL/HWWR'+
3RVWL/HWWR2UGLQDUL
ϭ
ϯ
ϭ
Ϯ
ϲ
Ϭ
Ϯϳ
ϭϵ
ϯ
ϯ
ϰϳ
Ϭ
Ϭ
ϭϮ
ϭ
ϲ
ϭϮ
Ϯ
Ϯϰ
ϯ
ϯ
ϰ
ϰ
3RVWL/HWWR'+
3RVWL/HWWR'6
3RVWL/HWWR/'
Ϯϱ
ϯ
ϯ
Ϯϱ
ŝƌŝŐĞŶƚĞĚĞů^^Z
WŽůŽŵĞƌŐĞŶnjĂhƌŐĞŶnjĂ
ZĂĚŝŽůŽŐŝĂWĞĚŝĂƚƌŝĐĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
^ƚƌƵƚƚƵƌĂƐĞŵƉůŝĐĞ
ĚŝƉĂƌƚŝŵĞŶƚĂůĞ
^ƚƌƵƚƚƵƌĂƐĞŵƉůŝĐĞ
ĚŝƉĂƌƚŝŵĞŶƚĂůĞ
^ĐŝĞŶnjĞZĂĚŝŽůŽŐŝĐŚĞ
hŶŝƚăKƉĞƌĂƚŝǀĂ
ZĂĚŝŽůŽŐŝĂ
ŝƌŝŐĞŶƚĞĚĞů^^Z
hŶŝƚăKƉĞƌĂƚŝǀĂ
DĞĚŝĐŝŶĂEƵĐůĞĂƌĞ
$WWULEX]LRQHGHOOD
'LUH]LRQHGHOOD
6WUXWWXUD
'LVFLSOLQD
0LQLVWHULDOH 7LSRVWUXWWXUD
6WUXWWXUHDIIHUHQWLDO
'LSDUWLPHQWR
'LULJHQWHGHO665
hŶŝǀĞƌƐŝƚĂƌŝŽ
3RVWL/HWWR2UGLQDUL
'LULJHQWLPHGLFL6657DEHOOD
FRQWRDQQXDOH
'LULJHQWLPHGLFL665
UDSSRUWRHVFOXVLYR
'LULJHQWLPHGLFL665WHPSR
GHWHUPLQDWR
'LULJHQWLVDQLWDULQRQPHGLFL
6657DEHOODFRQWRDQQXDOH
'LULJHQWLPHGLFLXQLYHUVLWDUL
'LUH]LRQH'LSDUWLPHQWR ŝƌŝŐĞŶƚĞĚĞů^^Z
hŶŝƚăKƉĞƌĂƚŝǀĂ
5$',2/2*,$',$*1267,&$3(5,00$*,1(
',3$57,0(172
hŶŝǀĞƌƐŝƚĂƌŝŽ
hŶŝƚăKƉĞƌĂƚŝǀĂ
DĞĚŝĐŝŶĂĚĞů>ĂǀŽƌŽĞdŽƐƐŝĐŽůŽŐŝĂ
/ŶĚƵƐƚƌŝĂůĞ
^ĞƌǀŝnjŝŽĚŝWƌĞǀĞŶnjŝŽŶĞĞWƌŽƚĞnjŝŽŶĞ
njŝĞŶĚĂůĞ
$WWULEX]LRQHGHOOD
'LUH]LRQHGHOOD
6WUXWWXUD
'LVFLSOLQD
7LSRVWUXWWXUD
0LQLVWHULDOH
6WUXWWXUHDIIHUHQWLDO
'LSDUWLPHQWR
3RVWL/HWWR2UGLQDUL
3RVWL/HWWR'6
3RVWL/HWWR'+
Ϭ
3RVWL/HWWR/'
Ϯϯ
ϭ
ϭ
ϯ
ϯ
'LULJHQWLPHGLFL6657DEHOOD
FRQWRDQQXDOH
'LULJHQWLPHGLFL665
UDSSRUWRHVFOXVLYR
'LULJHQWLPHGLFL665WHPSR
GHWHUPLQDWR
'LULJHQWLPHGLFLXQLYHUVLWDUL
UDSSRUWRHVFOXVLYR
'LULJHQWLVDQLWDULQRQPHGLFL
6657DEHOODFRQWRDQQXDOH
'LUH]LRQH'LSDUWLPHQWR 'LULJHQWLVDQLWDULQRQPHGLFL
XQLYHUVLWDUL
'LULJHQWLPHGLFLXQLYHUVLWDUL
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
XQLYHUVLWDULR
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
665WHPSRGHWHUPLQDWR
'LULJHQWLPHGLFLXQLYHUVLWDUL
UDSSRUWRHVFOXVLYR
35(9(1=,21((6,&85(==$
'LULJHQWLVDQLWDULQRQPHGLFL
XQLYHUVLWDUL
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFRXQLYHUVLWDULR
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFR665WHPSR
GHWHUPLQDWR
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFR6657DEHOODFRQWR
DQQXDOH
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
665WDEHOODFRQWRDQQXDOH
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
665WDEHOODFRQWRDQQXDOH
Ϯ
&RQWUDWWLVWL
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
XQLYHUVLWDULR
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
665WHPSRGHWHUPLQDWR
',3$57,0(172
%RUVLVWL
&RQWUDWWLVWL
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFRXQLYHUVLWDULR
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFR665WHPSR
GHWHUPLQDWR
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFR6657DEHOODFRQWR
DQQXDOH
%RUVLVWL
hŶŝǀĞƌƐŝƚĂƌŝŽ
3RVWL/HWWR2UGLQDUL
ϭ
ϭ
ϯ
3RVWL/HWWR'+
ϮϮ
ϭ
ϯ
ϲ
ϭ
ϭ
Ϯ
ϯ
Ϭ
ϱ
ϯ
ϳ
ϳ
'LULJHQWLPHGLFLXQLYHUVLWDUL
ϭϰ
ϰ
hŶŝƚăKƉĞƌĂƚŝǀĂ
'LULJHQWLPHGLFL6657DEHOOD
FRQWRDQQXDOH
hŶŝǀĞƌƐŝƚĂƌŝŽ
hŶŝǀĞƌƐŝƚĂƌŝŽ
hŶŝǀĞƌƐŝƚĂƌŝŽ
'LULJHQWLPHGLFL665
UDSSRUWRHVFOXVLYR
'LULJHQWLPHGLFL665WHPSR
GHWHUPLQDWR
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
hŶŝƚăKƉĞƌĂƚŝǀĂ
ϱ
ϯ
ϰ
ϯ
'LULJHQWLPHGLFLXQLYHUVLWDUL
UDSSRUWRHVFOXVLYR
'LULJHQWLVDQLWDULQRQPHGLFL
XQLYHUVLWDUL
hŶŝƚăKƉĞƌĂƚŝǀĂ
Ϯϱ
ϭϰ
Ϯϴ
ϭϯ
ϭϵ
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
665WDEHOODFRQWRDQQXDOH
ϭ
ϱ
ϯ
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
XQLYHUVLWDULR
3HUVRQDOHLQIHUPLHULVWLFR
WHFQLFRGHOODULDELOLWD]LRQH
665WHPSRGHWHUPLQDWR
hŶŝƚăKƉĞƌĂƚŝǀĂ
$WWULEX]LRQHGHOOD
'LUH]LRQHGHOOD
6WUXWWXUD
ϲ
ϰ
ϴ
ϱ
ϲ
ϭ
Ϯ
ϭ
ϭ
ϭ
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFRXQLYHUVLWDULR
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFR665WHPSR
GHWHUPLQDWR
3HUVRQDOHDPPLQLVWUDWLYRH
WHFQLFR6657DEHOODFRQWR
DQQXDOH
ƚƚŝǀŝƚăŽŵƵŶŝŝƉĂƌƚŝŵĞŶƚŽdĞƐƚĂͲ ŽůůŽ
ƚƚŝǀŝƚăŽŵƵŶŝKƚŽƌŝŶŽůĂƌŝŶŐŽŝĂƚƌŝĂĞ
KƚŽƌŝŶŽůĂƌŝŶŐŽŝĂƚƌŝĂĞ
KƚŽŶĞƵƌŽĐŚŝƌƵƌŐŝĂ
DĂdžŝůůŽͲ&ĂĐĐŝĂůĞ
ϭϬϬϭ
KĐƵůŝƐƚŝĐĂ
ϯϰϬϭ
KĚŽŶƚŽƐƚŽŵĂƚŽůŽŐŝĂ
KƚŽƌŝŶŽůĂƌŝŶŐŽŝĂƚƌŝĂĞ
ϯϴϬϮ
KƚŽŶĞƵƌŽĐŚŝƌƵƌŐŝĂ
'LVFLSOLQD
7LSRVWUXWWXUD
0LQLVWHULDOH
6WUXWWXUHDIIHUHQWLDO
'LSDUWLPHQWR
8QLYHUVLWDULR
7(67$&2//2
'LUH]LRQH'LSDUWLPHQWR ',3$57,0(172
ϰ
Ϯ
Ϯ
Ϯ
ϭ
ϭ
%RUVLVWL
&RQWUDWWLVWL
'LULJHQWLVDQLWDULQRQPHGLFL
6657DEHOODFRQWRDQQXDOH
3RVWL/HWWR/'
3RVWL/HWWR'6
2ELHWWLYLLVWLWX]LRQDOL
HVWUDWHJLHD]LHQGDOL
,O SUHVHQWH FDSLWROR FRVWLWXLVFH LO FXRUH GHO GRFXPHQWR
LQ HVVR YHQJRQR HVSOLFLWDWL L SULQFLSDOL RELHWWLYL
DWWUDYHUVR L TXDOL O¶$]LHQGD LQWHUSUHWD L VXRL GRYHUL
LVWLWX]LRQDOL H FRQFRUUH DO SHUVHJXLPHQWR GHOOH ILQDOLWj
GHO6HUYL]LR6DQLWDULR5HJLRQDOH
,Q TXHVWD VHGH OH LQIRUPD]LRQL VRQR RUJDQL]]DWH LQ VHL
DPELWL FKH FRQILJXUDQR LO PRGR GL HVVHUH H GL RSHUDUH
GL WXWWH OH D]LHQGH VDQLWDULH GHOOD UHJLRQH WXWWDYLD OD
VHVWD DUHD qWHVD D FRJOLHUH DOFXQL DVSHWWLGHOSURFHVVR
GL LQWHJUD]LRQH WUD DWWLYLWj DVVLVWHQ]LDOL H DWWLYLWj
LVWLWX]LRQDOLSURSULHGHOVLVWHPDXQLYHUVLWDULR
•
3DUWHFLSD]LRQHGHJOL(QWLORFDOLDOOD
SURJUDPPD]LRQHVDQLWDULD
•
8QLYHUVDOLWjHGHTXLWjGLDFFHVVR
•
&HQWUDOLWjGHOFLWWDGLQR
•
4XDOLWjGHOO¶DVVLVWHQ]DHGHIILFLHQ]D
JHVWLRQDOH
•
3URPR]LRQHGHOO¶HFFHOOHQ]DWHFQRORJLFD
FOLQLFDHRUJDQL]]DWLYD
•
,QWHJUD]LRQHWUDOHDWWLYLWjDVVLVWHQ]LDOLGL
GLGDWWLFDHGLULFHUFD
Obiettivi istituzionali e strategie aziendali
I principi che ispirano l'organizzazione di questo capitolo del volume, ovvero la partecipazione dei
cittadini, l'universalità e l'equità di accesso alle cure, la centralità della persona, così come aspetti
importanti legati alla qualità dei servizi o alle aree di eccellenza e innovazione, intendono restituire una
visione sistematica, sebbene complessa, del mondo della sanità.
Nell’organizzazione del capitolo si è cercato di preservare l’impostazione proposta dalle linee guida
regionali per i bilanci di missione delle aziende ospedaliere (D.G.R. 606/2008), operando per individuare i
punti di integrazione con le linee di programmazione regionali per le aziende del servizio sanitario relative
all’anno 2013 (D.G.R. 199/2013).
Infine, a partire dal 2008, sono state introdotte alcune sezioni che riportano in modo condiviso l'attività
svolta dalle due Aziende della provincia di Parma. Si tratta di percorsi/progetti che rispondono alla logica
di integrazione dei percorsi assistenziali e che, proprio per questo motivo, sono stati organizzati in modo
concertato. Sono riprodotti nelle pagine seguenti, così come accade nel Bilancio di Missione dell'Azienda
USL di Parma, sotto l'indicazione “Percorso elaborato in modo comune dalle due Aziende
sanitarie”, come ad esplicitare che, anche nella fase di stesura di questo documento, i professionisti che
hanno offerto il proprio contributo lo hanno fatto cercando di fornire una visione quanto più possibile
integrata.
La Conferenza Territoriale Sociale e Sanitaria - CTSS è la sede istituzionale di rappresentanza degli enti
territoriali in cui si definiscono, si verificano e si valutano le scelte di governo a livello locale del sistema
sanitario e socio-sanitario. Nella CTSS, la cui assemblea è composta da tutti i sindaci dei Comuni della
provincia di Parma e dal Presidente dell’Amministrazione Provinciale di Parma, trova piena realizzazione il
coinvolgimento degli Enti Locali nei processi decisionali per definire scelte politiche aderenti ai bisogni
effettivi della comunità.
La competenza della Conferenza non è limitata all’area sanitaria ma anche a quella sociale, ponendo
come chiara scelta strategica l’integrazione tra l’area sociale e quella sanitaria, puntando al
coinvolgimento e all’integrazione di ambiti e competenze molto diversificati tra loro.
La partecipazione dell’Azienda alla programmazione provinciale trova riconoscimento formale nell’invito a
prendere parte ai lavori dell’Ufficio di Presidenza della CTSS (composto dai quattro Presidenti dei Comitati
di Distretto e dal Presidente della Provincia). Infatti, all’Ufficio di Presidenza sono invitati permanenti,
senza diritto di voto, insieme al Direttore Generale dell’AOU, il Direttore Generale dell’Azienda USL, il
Rettore dell’Università degli Studi di Parma, il Presidente della Facoltà di Medicina e Chirurgia, il
Presidente dell’Ordine dei Medici Chirurghi e Odontoiatri della provincia, l’Assessore alle Politiche Sociali
della Provincia di Parma.
Il ruolo della Conferenza si sostanzia anche nell’espressione di indirizzi e nella valutazione dell’attività
delle Aziende sanitarie e rappresenta il luogo per la condivisione partecipata in merito alla
programmazione e organizzazione sanitaria, nonché della programmazione degli investimenti e degli
interventi strutturali da realizzare nell’ambito dell’Accordo di Programma ex art. 20 L. 67/88. Il lavoro
svolto in forma integrata permette di garantire il mantenimento degli attuali standard di qualità delle
prestazioni sanitarie fornite, nonostante la criticità dei finanziamenti.
Nello specifico per quanto attiene il 2013 la CTSS ha presento la bozza del nuovo Atto di Indirizzo e
Coordinamento (comprensivo del profilo di Comunità). Il documento, predisposto grazie al notevole
contributo delle Aziende Sanitarie, descrive una visione complessiva della realtà socio sanitaria nella
provincia locale e indica uno scenario di priorità per la stesura del Piano Attuativo locale e per i Piani di
Zona 2012/2014.
99
3. Obiettivi istituzionali e strategie aziendali
3.1 Partecipazione degli enti locali alla programmazione
sanitaria
In un clima di grande incertezza, a livello nazionale, sul futuro del nostro sistema Sanitario e di Welfare,
sulle risorse disponibili, sui cambiamenti da porre in atto per assicurarne la continuità e l’efficacia, la
nostra Regione ha scelto in modo pragmatico di non assumere, per il momento, un orizzonte
programmatorio triennale, come è avvenuto per il passato con il Piano regionale Sociale e Sanitario, ma
di sviluppare un quadro di indicazioni e priorità in un arco temporale annuale.
La CTSS, di concerto alle Aziende Sanitarie, ha condiviso questo orientamento nella consapevolezza di
come il livello di incertezza di chi è chiamato a compiti di programmazione sia direttamente proporzionale
alla complessità e alla rapidissima modificazione dei bisogni innescati dalla crisi economica che attraversa
il Paese.
3.2 Universalità ed equità di accesso
Assistenza Specialistica Ambulatoriale
Erogazione prestazioni specialistiche ambulatoriali appropriate, in tempi
adeguati e con percorsi chiari e definiti
3. Obiettivi istituzionali e strategie aziendali
Sono state confermate, anche per l’anno 2013, le indicazioni contenute nella D.G.R. 1035/2009
“Strategia regionale per il miglioramento dell’accesso ai servizi di specialistica ambulatoriale in
applicazione della D.G.R. 1532/2006 e della D.G.R. 73/2007” e alla D.G.R. 1803/2009 relativa ai
percorsi di Day Service Ambulatoriale. L’Azienda Ospedaliero-Universitaria di Parma, in collaborazione
con l’Azienda USL, al fine di garantire una adeguata offerta di prestazioni specialistiche ambulatoriali a
livello provinciale, nel rispetto dei tempi di attesa entro gli standard regionali, ha proseguito e
sviluppato le azioni già intraprese negli ultimi anni con particolare riferimento al miglioramento
dell’appropriatezza e al completamento dei piani di comunicazione, temi approfonditi anche in sede di
stesura dei Programmi attuativi aziendali e del Piano di Produzione provinciale di attività ambulatoriale.
Risultati raggiunti
L’Azienda Ospedaliero-Universitaria di Parma ha collaborato con l’Azienda USL nella valutazione del
fabbisogno e, in un quadro di stabilità dell’offerta provinciale, si è impegnata nel monitoraggio costante
dei tempi di attesa con relativa rimodulazione dell’offerta di prestazioni programmate, urgenze
differibili e urgenze h. 24, sulla scorta dello scostamento del tempo di attesa dallo standard regionale,
garantendo complessivamente i volumi concordati nel Piano di produzione provinciale al fine di
soddisfare il fabbisogno territoriale. Il piano di produzione provinciale è stato articolato secondo le varie
modalità di accesso che sono gestite sul sistema CUP provinciale (primi accessi, controlli, urgenze
differibili, urgenze H24, Accesso diretto, Day Service, 2° livello, percorsi semplici, completamento
diagnostico, Libera professione).
L’Azienda si è impegnata per garantire una programmazione e gestione complessiva dell’offerta
nell’ambito del sistema CUP grazie anche alla predisposizione di agende di prenotazione separate per
primi accessi, urgenze differite e controlli. L’articolazione dell’offerta per le varie classi di priorità con
un modello organizzativo che è stato ripreso nella formulazione del Piano di produzione provinciale,
risponde anche all’obiettivo dell’accessibilità esterna (che si esplica soprattutto attraverso la
qualificazione dei servizi di prenotazione in rete su tutta la provincia). In questa direzione, l’Azienda
territoriale ha dato forte sviluppo alla rete degli sportelli di prenotazione delle prestazioni di assistenza
specialistica ambulatoriale. Il sistema di prenotazione CUP nel corso degli ultimi anni è stato adeguato
alle normative regionali e alla domanda che è variata, non solo in termini quantitativi, ma anche in
termini di complessità clinica. Tutte le prestazioni dell’Azienda Usl, dell’Azienda OspedalieroUniversitaria e del Privato accreditato sono presenti nel sistema CUP provinciale.
Per le aree di criticità, individuate di concerto con l’Azienda territoriale, è stato strutturato un sistema
di produzione integrativo che ha previsto una rimodulazione dei livelli di offerta in relazione
all’andamento della domanda nonché l’attivazione dei percorsi di garanzia.
L’Azienda ha proseguito nella pianificazione dell’offerta di prestazioni nei diversi regimi di erogazione
nelle diverse modalità di accesso (prestazioni urgenti, programmabili, accesso diretto, prestazioni di
completamento diagnostico, agende dedicate per i follow-up per le patologie croniche, percorsi semplici
di presa in carico) e attraverso il consolidamento dei percorsi di Day Service Ambulatoriale:
DSA 1 rivolto a pazienti acuti o che presentano forme di riacutizzazione/scompenso della patologia, si
svolge in un arco temporale massimo di 30 giorni (percorsi diagnostici) o di 90 giorni (percorsi
terapeutici); coinvolge almeno 3 discipline (compresa quella erogante) e non può essere ripetuto
nell’anno per la stessa patologia. Numero totale dei percorsi attivi n. 39;
100
DSA 2 rivolto a pazienti che richiedono valutazioni periodiche programmate sulla base di un protocollo
predefinito in situazioni di elevata complessità clinica; il numero di accessi è coerente con quelli stabiliti
nel protocollo, e può essere ripetuto più volte nell’anno. In questo caso, il numero totale dei percorsi
attivi è pari a n. 35.
Anche nel corso dell’anno 2013, l’Azienda ha provveduto all’attivazione di nuovi percorsi di Day Service
Ambulatoriale, al monitoraggio dei DSA avviati e formalizzati in questi ultimi anni e, attraverso l’analisi
del flusso della specialistica ambulatoriale, alla rilevazione dell’attività erogata. Sono stati inoltre
introdotti strumenti e procedure concordati, tesi a rendere operativo un modello organizzativo della
specialistica ambulatoriale che faciliti le prenotazioni e i percorsi dei cittadini superando la
frammentazione degli accessi.
Azioni di miglioramento dell’appropriatezza delle prestazioni specialistiche
ambulatoriali
L’Azienda Ospedaliero-Universitaria, in collaborazione con l’Azienda USL e con il coinvolgimento degli
Specialisti Ambulatoriali, dei Medici di Medicina Generale e Pediatri di Libera Scelta, ha messo in campo
azioni mirate negli ambiti dell’appropriatezza prescrittiva, dell’appropriatezza organizzativa e
dell’appropriatezza erogativa. In particolare, per quanto riguarda l’appropriatezza prescrittiva, le
attività hanno avuto ad oggetto:
gli esami di laboratorio, ad esempio PSA Reflex e TSH Reflex, come da indicazioni contenute nella
D.G.R. 1779/2010
i percorsi senologici, come da D.G.R. 1035/2009, D.G.R. 220/2011 e D.G.R. 1414/2012
prestazioni trasferite dal regime di ricovero al regime ambulatoriale (D.G.R. 1108/2011) al fine di
disincentivare i ricoveri di Day Surgery ad alto rischio di inappropriatezza
la diagnostica per immagini, con particolare riferimento a RM e TAC osteo-articolari (D.G.R.
740/2013)
Risultati raggiunti
Le azioni di controllo messe in atto dall’Azienda sono sintetizzate nella scheda seguente:
Verifiche sulle prescrizioni:
(presenza QD, classe di
priorità di accesso coerente
con protocollo, corretto invio
a
prime
visite
/controlli/Follow Up)
Appropriatezza
prescrittiva
Identificazione dei
comportamenti di
prescrizione inappropriata
Adozione o revisione Linee
Guida
Pianificazione offerta SSN e
LP
Appropriatezza
organizzativa
Articolazione
offerta
modalità di accesso
per
Modalità di gestione delle
prestazioni a completamento
diagnostico
Azioni svolte nel 2013
E’ stata verificata, su base campionaria, la corretta
compilazione. La valutazione ha portato a un esito
di conformità rispetto alla normativa regionale per i
parametri “classe di priorità di accesso e corretto
invio a prime visite/controlli/ follow up”. La
presenza del QD non sempre è risultata indicata o
chiaramente interpretabile.
Si sono tenute riunioni di gruppi di lavoro
interaziendali oltre che del gruppo interaziendale
per la deburocratizzazione per affinare e diffondere
le buone pratiche relative all’identificazione dei
comportamenti
di
prescrizione
inappropriate.
Completamento
dell’informatizzazione
degli
ambulatori per la prescrizione e refertazione.
Sono state implementate le linee guida inerenti alla
gestione del paziente affetto da SLA, dello
scompenso
cardiaco,
dello
stroke
care
e
dell’odontoiatria. Sono state sviluppate le linee
guida inerenti il governo clinico e l’appropriatezza
delle prestazioni di laboratorio e di radiologia.
Modulazione delle agende di prenotazione ai sensi
dell’Accordo di Fornitura con l’Azienda USL nel
rispetto dei percorsi previsti per le differenti
modalità di accesso.
Differenziazione di agende di prenotazione CUP tra
primi accessi, controlli e DSA. Predisposizione di
agende di garanzia da attivarsi in caso di
superamento dei tempi di attesa.
Erogazione delle prestazioni a completamento
diagnostico contestualmente all’erogazione della
visita o mediante prescrizione da parte dello
specialista in caso di percorso semplice. Attivazione
DSA .
101
3. Obiettivi istituzionali e strategie aziendali
Scheda azioni appropriatezza
Modalità di
follow-up
3. Obiettivi istituzionali e strategie aziendali
Appropriatezza
erogativa
gestione
dei
Consolidamento e sviluppo
dei percorsi ambulatoriali
semplici e DSA
Trasferimento
in
regime
ambulatoriale di prestazioni
ad
alto
rischio
di
inappropriatezza in regime di
day surgery/day hospital
Mantenimento dell’ultima fase del programma di
gestione diagnostico/terapeutico individuato per le
patologie che necessitano di una periodica
valutazione
(endocrinologia,
senologia,
infettivologia, diabetologia, cardiologia ecc.).
Attivazione dei DSA 1 e 2.
Erogazione in regime ambulatoriale delle prestazioni
individuate dall’aggiornamento del nomenclatore
tariffario delle prestazioni erogabili nell’assistenza
specialistica dalla normativa regionale.
Attuazione dei Programmi attuativi aziendali
Monitoraggio e rendicontazione degli interventi, coerente con le indicazioni regionali, in merito ai tempi
di attesa; messa a punto di strumenti di valutazione dell’attività; sviluppo ulteriore della comunicazione
ai cittadini e alle parti sociali; governo dell’offerta di prestazioni programmate, urgenti, urgenti
differibili e di follow-up.
Risultati raggiunti
L’Azienda Ospedaliero-Universitaria di Parma ha collaborato con l’Azienda territoriale per garantire
l’adozione di strumenti funzionali al contenimento dei tempi di attesa in caso di criticità indicati a livello
regionale.
In particolare, l’Azienda si è impegnata all’aggiornamento degli ambiti di garanzia entro i quali, a
seconda delle tipologie di prestazioni (individuate come di base oppure no), è tenuta a garantire i
tempi massimi stabiliti e alla revisione continua delle agende di prenotazione (separazione delle prime
visite, dei controlli, dei follow-up, tipologie e volumi di prestazioni presenti a CUP, apertura continua
delle agende, overbooking). È stato inoltre monitorato l’andamento dei tempi di attesa confrontati con i
volumi pianificati.
L’Azienda ha garantito la qualità e la completezza dei dati da trasmettere nei flussi informativi
regionali, per il monitoraggio e la valutazione dei tempi di attesa inerenti l’attività specialistica
ambulatoriale, utilizzando le elaborazioni trimestrali di controllo dei dati messe a disposizione dalla
Regione. Si specifica che i flussi informativi regionali funzionali ad assolvere il debito informativo sono:
flusso informativo dell’assistenza specialistica ambulatoriale (ASA) per i tempi effettivi,
applicativo MAPS per i tempi di attesa prospettici.
Una migliore informazione delle scelte adottate, in un rapporto stabile e trasparente con i cittadini, è
un primo e fondamentale strumento di miglioramento della performance dei tempi di attesa regionali.
A completamento della campagna di comunicazione già avviata, articolata a livello regionale e locale e
rivolta a cittadini e professionisti, nel corso del 2013 si è proseguito su altri filoni di sviluppo:
sviluppo dei piani di comunicazione con particolare riferimento all’accessibilità dell’offerta, alle
eventuali innovazioni normative e organizzative, alle caratteristiche dei diversi regimi di erogazione
e alle regole a tutela dell’equità e della trasparenza,
sviluppo delle azioni di comunicazione nei confronti dei rappresentanti dei cittadini sull’utilizzo dei
servizi,
sviluppo, in collaborazione con l’Azienda USL, delle analisi degli strumenti di diffusione delle
informazioni e aumento della coerenza e qualità della comunicazione utilizzando il portale regionale
sui tempi di attesa www. TDAER.it, CUPWEB e SALUTER.
In particolare, l’implementazione del programma CUP/WEB e l’informatizzazione degli ambulatori
hanno consentito la completa attuazione operativa delle azioni correlate alla deburocratizzazione delle
procedure di prescrizione delle prestazioni specialistiche ambulatoriali successive a prima visita. Il
sistema di prenotazione On Line delle prestazioni specialistiche (visite e esami) della Regione EmiliaRomagna CUP/WEB consente infatti ai cittadini, attraverso la registrazione al portale regionale, di
prenotare le prestazioni sanitarie definite da ciascuna azienda, annullare o cambiare appuntamenti
prenotati, pagare una prenotazione con pagamento On Line, visualizzare e stampare gli appuntamenti
e il costo della prestazione prenotata.
L’attivazione del CUP/WEB riguarda una serie di prestazioni che presentano un diverso dettaglio di
visibilità all’interno del portale (territoriale e/o di Area Vasta) e che non richiedono una valutazione
specifica da parte del personale addetto alla prenotazione (sono esclusi: i controlli, le RMN, le TAC e
parte delle prestazioni pediatriche).
102
Progetti ICT di Sanità On Line
Percorso elaborato in modo comune dalle due Aziende sanitarie
Interventi di potenziamento e costituzione del sistema informatico a supporto del sistema informativo
aziendale, provinciale e del patrimonio del sistema informativo della sanità e politiche sociali.
Promozione Fascicolo Sanitario Elettronico (FSE) e Progetto SOLE
L’Azienda Sanitaria territoriale ha realizzato una campagna per la promozione del Fascicolo Sanitario
Elettronico, alla quale ha partecipato anche l’Azienda Ospedaliero-Universitaria tramite il proprio
portale online e organizzando eventi informativi per operatori interni ed esterni e giornate di
attivazione dedicate agli operatori interni.
In ottemperanza alla Circolare 5 della Regione Emilia–Romagna è stato definito congiuntamente tra le
due Aziende un piano di adeguamento delle integrazioni dei sistemi informatici aziendali con
l’architettura SOLE per la consegna al FSE dei referti. Il piano è stato presentato all’interno del
workshop che la Regione ha organizzato per la pianificazione della diffusione del FSE.
Anche allo scopo di favorire la diffusione del FSE si è proseguito nell’innalzamento dei volumi di invio
dei documenti sanitari. In particolare sono stati attivati presso l’AUSL i moduli di refertazione
endoscopica ed ecografica e in AOU è stata attivata la refertazione per le UUOO di Day Hospital
Dipartimentale e di Reumatologia.
I volumi possono essere di seguito riassunti:
Pronto Soccorso
Laboratorio
Radiologia
Specialistica
Lettera di Dimissione
AUSL di Parma
Documento
Pronto Soccorso
Laboratorio
Radiologia
Specialistica
Lettera di Dimissione
Volumi 2012
24.648
72.571
7.034
0
233
62.597
81.060
65.497
55
1.584
Volumi 2011
Volumi 2012
3.168
46.772
23.231
12.945
245
24.124
53.122
87.598
64.263
1.644
Volumi 2013
81.177
87.966
66.592
3.636
4.792
Volumi 2013
28.017
56.129
90.700
130.498
5.393
Nel contesto del sistema informativo di Anatomia Patologica si è proseguito, coerentemente con i lavori
del gruppo regionale, nella revisione delle funzionalità tecnologiche dello stesso per permettere il
successivo l’invio alla piattaforma SOLE del referto.
Anagrafica unica provinciale dei pazienti
Il progetto è fra quelli di integrazione/collaborazione interaziendale condivisi dalle direzioni aziendali e
formalizzati in un documento trasmesso alla Regione (cfr. il paragrafo “Strategie di integrazione a
livello provinciale” nel presente capitolo).
Il progetto è stato sospeso alla luce del nuovo applicativo regionale (in corso di acquisizione da parte
della Regione) per la gestione della medicina di base, che è il fulcro dell’anagrafe territoriale dei
pazienti. Il sistema di anagrafe unico provinciale verrà analizzato sulla base di tale nuovo sistema
regionale.
Osservatorio epidemiologico provinciale
Anche il progetto dell’Osservatorio è fra quelli di integrazione/collaborazione interaziendale citati nel
capoverso precedente. Sono stati definiti e formalizzati gli aspetti tecnici e le modalità organizzative di
finanziamento del progetto. E' stato acquisito il software in collaborazione tra le due Aziende ed è stata
effettuata una installazione unica provinciale. Sono attualmente in corso le attività di integrazione con i
rispettivi sistemi informatici di laboratorio.
Revisione delle funzionalità del Pronto Soccorso e del Dipartimento di Emergenza-Urgenza
Sono in corso le valutazioni degli applicativi di pronto soccorso attualmente in uso in modo da definire
103
3. Obiettivi istituzionali e strategie aziendali
Azienda Ospedaliero-Universitaria di Parma
Documento
Volumi 2011
le opportune strategie di integrazione tra i sistemi utilizzati presso il Pronto Soccorso dell’AOU e quelli
dei PS di Fidenza e Borgotaro e del Punto Bianco. E’ stata elaborata una prima analisi di fattibilità del
progetto, con relativi tempi di realizzazione e costi.
Assistenza odontoiatrica
3. Obiettivi istituzionali e strategie aziendali
Percorso elaborato in modo comune dalle due Aziende sanitarie
Nell’anno 2013 le attività realizzate nell’ambito del Programma Regionale di Assistenza Odontoiatrica,
in coerenza con l’obiettivo dell’anno precedente, sono proseguite in un ottica di standardizzazione
dell’offerta, di promozione della responsabilizzazione delle strutture distrettuali alla piena gestione
dell’erogato favorendo, l’uniformità dei comportamenti nei vari aspetti che attengono al Programma
Odontoiatrico.
Risultati raggiunti
• Nel 2013, sono state adottate le “Linee guida per l’attività odontoiatrica-anno 2013-documento
integrativo” (determinazione n. 56 del 19 Agosto 2013 della Direzione Sanitaria AUSL, per
l’Azienda Ospedaliera deliberazione del Direttore Generale n. 251 del 28 Ottobre 2013) a
recepimento delle linee guida AVEN, predisposte da un gruppo di lavoro interaziendale. Con tale
documento si è cercato di uniformare i comportamenti delle Aziende di Area Vasta, in particolare
facendo riferimento ai criteri di accesso al programma, con puntualizzazione in merito all’accesso
per i cittadini non residenti, alle modalità di erogazione delle prestazioni di conservativa, protesica
ed ortodonzia ed alla registrazione dell’attività, consolidando ulteriormente le innovazioni introdotte
con la D.G.R. 374/2008 e della Circolare 2/2008 dando piena attuazione ai contenuti delle stesse.
• Nel corso del 2013 sempre con l’obiettivo di standardizzare e uniformare i comportamenti nei vari
aspetti che attengono al Programma Odontoiatrico, in Area Vasta Emilia Nord, sono proseguiti gli
incontri tra i referenti aziendali, per condividere aspetti che verranno successivamente formalizzati
ad uso delle Aziende AVEN.
• È proseguito il processo di responsabilizzazione delle strutture distrettuali alla piena gestione
dell’erogato rispetto alle specifiche del flusso, soprattutto attraverso la verifica periodica
dell’attività svolta mediante la valutazione dei dati inseriti nel flusso ASA e l’evidenziazione di
eventuali anomalie attraverso il confronto con i semestri precedenti.
• Sempre nella direzione di uniformare i comportamenti, anche per quanto attiene gli aspetti
economici, sono stati consolidati in particolare quelli già definiti, concernenti i costi dei manufatti
ortodontici, ora comuni alle due Aziende Sanitarie e ai gestori privati accreditati. Sono infatti stati
definiti importi forfetari onnicomprensivi annuali per quanto riguarda gli apparecchi ortodontici fissi
e mobili, per essere in linea con i prezzi applicati in Area Vasta e per semplificare le procedure di
fornitura nell’interesse degli utenti. Il tutto formalizzato in un regolamento per il recupero del
pagamento dei manufatti ortodontici.
• Nell’anno 2013 sono stati mantenuti i contratti in essere con i tre gestori privati accreditati già
convenzionati con Azienda USL.
Nell’anno 2013 le due Aziende hanno mantenuto e promosso congiuntamente i programmi di
Prevenzione Primaria previsti dal Programma di Assistenza Odontoiatrica della Regione EmiliaRomagna. Le patologie del cavo orale, come riportato anche nel Piano Nazionale della Prevenzione
2010-2012, associate in molti casi a scarsa igiene, ad una alimentazione non corretta, a stili di vita non
salutari ed eventualmente in associazione con malattie cronico degenerative, immunitarie e infettive,
influiscono negativamente sulla qualità di vita degli individui, specie in età evolutiva. Appare pertanto
chiaro il ruolo fondamentale della prevenzione odontostomatologica. Per essere efficace, la prevenzione
primaria richiede interventi individuali fin dai primi periodi di vita del bambino, mirati ad un maggiore
controllo sui fattori di rischio come scarsa accuratezza dell’igiene orale, persistenza di abitudini errate,
l’uso del fluoro e il monitoraggio periodico dello stato di dentizione, promuovendo inoltre
comportamenti più salutari nella famiglia.
Con questi obiettivi pertanto vengono proposte tali tematiche nelle scuole primarie, in continuità con
quanto svolto negli anni precedenti aderendo, nei contenuti e nella forma, all’iniziativa ministeriale
“Guadagnare Salute IdentiKit”.
Interventi in fase di sviluppo o in corso
Eventuali problematiche riscontrate
Verranno monitorati tutti gli aspetti in relazione a refertazione e
ricettazione informatizzata, secondo quanto previsto dal
protocollo integrativo dell'accordo locale per la medicina
specialistica.
104
Gestione reti cliniche: percorsi integrati Ospedale – Distretto
Percorso nascita
Obiettivi:
ƒ Rinnovo del protocollo d'intesa inter-istituzionale sul Percorso Nascita con la partecipazione
delle Associazioni di Volontariato
ƒ Nell’ambito degli interventi di miglioramento del percorso nascita, promossi dalla Commissione
Nascita regionale, le Aziende sanitarie hanno condiviso un progetto di gestione dell'Assistenza
alla Gravidanza secondo il concetto dell'intensità di cure.
ƒ Sempre nell'ottica del miglioramento del Percorso integrato Ospedale-territorio, si è perseguito
l'obiettivo di creare un Ambulatorio di presa in carico della Gravidanza a termine differenziata
per livelli di Rischio e con una interfaccia di invio condivisa tra le due Aziende e a livello di area
Vasta Emilia Nord
ƒ Le Aziende sono, inoltre, chiamate a continuare nel programma di miglioramento
dell’appropriatezza del ricorso all’intervento di Taglio Cesareo partendo dalla Linea Guida
"Taglio cesareo: una scelta appropriata e consapevole" elaborata dal Sistema nazionale per le
linee guida dell’Istituto Superiore di Sanità e dall’elaborazione dei dati CeDAP secondo la
classificazione di Robson.
ƒ Trattamento del dolore da parto con lo sviluppo dell’offerta nei punti nascita di metodiche
farmacologiche e non farmacologiche di provata efficacia per il controllo del dolore nel travaglio
di parto.
ƒ Sviluppo delle abilità di comunicazione e di counselling dei professionisti nell’ambito del
percorso nascita.
ƒ Consolidamento degli interventi a sostegno dell'allattamento al seno in collaborazione con
l'Associazionismo e del Disagio emozionale.
Risultati raggiunti
• Rivisitazione, attraverso Gruppi di lavoro multidisciplinari, del Protocollo del 2004 e predisposizione
del nuovo Protocollo interistituzionale d'Intesa sul Percorso Nascita, sottoscritto tra il Distretto di
Parma (che comprende il Comune di Parma, quello di Colorno, Mezzani, Parma, Sorbolo e Torrile),
l’Azienda Usl di Parma e l’Azienda Ospedaliero-Universitaria. Alla stesura del Protocollo hanno preso
parte le associazioni che, a vario titolo, indirizzano il loro impegno verso i temi della maternità,
della nascita, per sostenerne i percorsi in un’ottica di benessere.
• Realizzazione day service ambulatoriale - DSA 2 Gravidanza fisiologica e DSA 2 Gravidanza a
rischio. Tale progetto, condiviso dalle due Aziende ed ormai consolidato, prevede che la presa in
carico delle gravide della provincia sia effettuata secondo il criterio dell’intensità di assistenza/cure.
In tale prospettiva si garantisce il trattamento delle condizioni associate a esito avverso della
gravidanza, nonché la migliore assistenza ad una condizione patologica o l'eventuale ri-definizione
del rischio.
• Realizzazione di un DSA della Gravidanza a termine, secondo quanto indicato nelle LG della
Gravidanza a termine ed a relativa Delibera regionale 1097/2011, seguita ad un ampio lavoro di
condivisione in AVEN della Check-list di valutazione del Livello di Rischio e dell'interfaccia nel
percorso ospedale-territorio della donna a termine di gravidanza
• L’Azienda Ospedaliera ha dato avvio nel 2013 all'implementazione del Progetto “Una strategia
basata sull’evidenza per ridurre il tasso dei parti cesarei: studio di implementazione”, avendo
ottenuto nel 2012 il finanziamento regionale per un progetto interaziendale, nell’ambito del
Programma di ricerca Regione-Università, dal titolo
• Consolidamento dell'offerta della Partoanalgesia farmacologica e condivisione interaziendale del
percorso informativo sul sostegno farmacologico e non farmacologico del dolore in travaglio di
parto. Adesione al progetto regionale
MNC (Medicina non convenzionale) con l'avvio
dell'implementazione del sostegno non farmacologico con la tecnica di Digitopressione. Particolare
attenzione nei Corsi di preparazione alla nascita viene data all'informazione sulle tecniche di
sostegno del dolore in travaglio di parto
• Completato il Percorso formativo in AVEN del personale medico e ostetrico volto a sviluppare le
abilità comunicative e di counselling nel percorso nascita, con particolare riferimento al counselling
per la diagnosi prenatale e per il sostegno all'allattamento al seno
• Implementazione fattiva del Network di sostegno interaziendale multidisciplinare per il Disagio
emozionale in gravidanza e nel primo anno di vita del bambino
• Adesione alle iniziative regionali della SAM (settimana mondiale dell'allattamento) con il Flash mob
dell'allattamento organizzato in Piazza Garibaldi a Parma.
105
3. Obiettivi istituzionali e strategie aziendali
Percorso elaborato in modo comune dalle due Aziende sanitarie
Interventi in fase di sviluppo o in corso
In corso la realizzazione del citato Progetto finanziato dalla Regione sull'Implementazione delle LG
sul Taglio cesareo,
Omogeneizzazione delle modalità di Assistenza dell'ambulatorio della Gravidanza a termine in AVEN.
Rete e percorsi cardiologici
3. Obiettivi istituzionali e strategie aziendali
Percorso elaborato in modo comune dalle due Aziende sanitarie
Le Aziende devono impegnarsi a favorire l’integrazione tra i professionisti dell’ Ospedale e del
Territorio, provinciale e di Area Vasta, e tra le diverse competenze specialistiche, per rafforzare e
rivitalizzare la rete cardiologica e cardiochirurgica dell’emergenza (infarto miocardico acuto STEMI),
estendendola ad altre condizioni a forte rischio di sopravvivenza (infarto miocardico acuto N-STEMI,
arresto cardiaco, sindrome aortica acuta).
Oltre all’accesso al trattamento, le aziende dovranno promuovere la definizione e valutazione di
percorsi assistenziali nel post-acuto, compresa la fase riabilitativa, sostenendo la concentrazione delle
competenze e dei servizi e il rispetto dei tempi di attesa.
Con il supporto della Commissione cardiologica e cardiochirurgica regionale, le aziende devono operare
per la definizione, laddove assente, e l’omogeneizzazione dei protocolli operativi, per la definizione dei
criteri professionali (clinical competence, volume minimo dei casi per le strutture, eccetera) e dei
setting di erogazione delle prestazioni e la realizzazione di attività di governo clinico come formazione,
introduzione delle innovazioni (impianto percutaneo di protesi valvolare aortica, sistemi meccanici di
assistenza cardiocircolatoria, eccetera) e gestione del rischio.
Risultati raggiunti
La rete cardiologica della Provincia di Parma ha proseguito l’attività di teletrasmissione dell’ECG da tutti
i mezzi 118, con invio diretto in sala di Emodinamica per gli infarti miocardici acuti STEMI. Nel 2013
sono state trasmesse dalle postazioni mobili territoriali del 118 all’Unità Coronarica dell’AOU di Parma
1879 teletrasmissioni, di cui 98 sono esitate in un’angioplastica primaria in emergenza, dal territorio
direttamente alla sala di emodinamica. In totale nel 2013 dall’AOU di Parma sono state eseguite 214
angioplastiche primarie in emergenza. Il Door to Balloon, ovvero il tempo che intercorre tra la diagnosi
e l’esecuzione dell’angioplastica, è stato per il 45% inferiore ai 90 minuti, come raccomandato dalla
letteratura, il 68% inferiore o uguale ai 120 minuti.
Nell’anno 2013 si è provveduto a sostituire il servizio di teletrasmissione basato sulla rete cellulare con
un nuovo sistema che consente la trasmissione dati totalmente per via telematica utilizzando un
service presente nella rete internet. Interventi in fase di sviluppo o in corso
Eventuali problematiche riscontrate
L’aggiornamento del percorso “Il dolore toracico di sospetta La realtà di Parma pur presentando
origine coronarica” è stato predisposto da un gruppo di valori di accesso con mezzi propri al P.S.
lavoro multidisciplinare e multiprofessionale interaziendale. (30.6%) migliori della media regionale,
Il PDTA sarà presto messo a disposizione dei professionisti, si pone come obiettivo un ulteriore
per evidenziare le possibilità di miglioramento e di riduzione di questi valori e un aumento
ottimizzazione dell’uso delle risorse nell’approccio al dell’ utilizzo del trasporto 118.
paziente con sospetta cardiopatia ischemica.
La diffusione del percorso avverrà attraverso un Convegno
per illustrare i punti più salienti e attraverso l’intranet delle
Aziende Sanitarie.
Per poter sviluppare un processo di miglioramento continuo
della qualità, il gruppo di lavoro effettuerà, dopo un anno
dall’avvio del percorso, il monitoraggio degli indicatori (v.
tabella), e la programmazione di AUDIT periodici.
OBIETTIVO INDICATORE TIPOLOGIA INDICATORE Modalità di accesso con 118 dei pazienti STEMI Performance Requisito RER Aumentare il n°. pazienti che utilizzano il 118 MODALITÀ DI CALCOLO NUMERATORE N. pazienti con diagnosi di STEMI effettuata con teletrasmissione di ECG che accedono direttamente in emodinamica DENOMINATORE N. pazienti con diagnosi di STEMI trattati in emodinamica 106
VALORE ATTESO STANDARD PERIODICITÀ RILEVAZIONE RESPONSABILE RILEVAZIONE FONTE DATI ≥55% 45% Annuale Responsabile inserimento dati nel registro RER Registri e banca dati dell’Agenzi
a Sanitaria Regionale e PNE Valutazione Ridurre il del Door in tempo di e Door out permanenza Time di di pazienti pazienti STEMI nelle STEMI nelle strutture strutture ospedaliere ospedaliere Spoke Spoke Tempo di esecuzione del primo ECG Ridurre il dall’arrivo in tempo di PS del permanenza paziente con dei pazienti dolore al PS toracico di sospetta origine coronarica Performance Requisito RER N. pazienti con stemi trasportati al centro Hub con tempo di permanenza nel centro Spoke non superiore a 30’ N. totale di pazienti con Stemi che vengono inviati al centro Hub attraverso l’ospedale Spoke ≥70% 30% Annuale Responsabile inserimento dati nel registro RER Registri e banca dati dell’Agenzi
a Sanitaria Regionale e PNE Percorso Requisito RER N. ECG eseguiti e valutati in PS entro 10’ dall’arrivo del paziente con dolore toracico in atto N. ECG eseguiti e valutati in PS in pazienti con dolore toracico in atto ≥80% 80% Annuale Responsabile inserimento dati nel registro RER Registri e banca dati dell’Agenzi
a Sanitaria Regionale e PNE I percorsi per la presa in carico: diffusione dei modelli organizzativi per la
gestione integrata delle patologie croniche e implementazione del Progetto
“La prevenzione delle malattie cardiovascolari” nei pazienti post-IMA/SCA
Percorso elaborato in modo comune dalle due Aziende sanitarie
Risultati raggiunti
Nel 2013 nell’ambito di un apposito progetto di ricerca finanziato dalla Regione Emilia-Romagna, che
fornisce al personale infermieristico delle Cardiologie ospedaliere e territoriali tutti i contenuti didattici,
scientifici e assistenziali necessari alla presa in carico del paziente nel post-IMA, per garantire l’inizio
immediato del trattamento riabilitativo e un monitoraggio adeguato dopo le dimissioni, è iniziato il
reclutamento dei casi clinici nelle cardiologie ospedaliere di Parma e di Fidenza.
Nell’ambito del progetto regionale “Lettura integrata carta rischio cardiovascolare” sono stati raggiunti
gli obiettivi della ricerca chiamando attivamente il cento per cento degli assistiti eleggibili e
somministrando la carta al 75% che ha accettato di partecipare al progetto.
Tale attività è stata svolta in collaborazione tra i medici del NCP Molinetto ed il personale infermieristico
del poliambulatorio Pintor del Distretto di Parma.
Nel corso dello scorso anno si sono svolti una serie di incontri tra specialisti cardiologi, ospedalieri e del
territorio, e MMG dei Nuclei di cure primarie, per presentare il documento regionale sulla “Gestione
integrata del paziente con scompenso cardiaco” e predisporre i relativi percorsi.
Nel 2013 è proseguita l’attività dell’ambulatorio dello scompenso cardiaco territoriale con la
sperimentazione della presa in carico domiciliare dei pazienti critici.
Interventi in fase di sviluppo o in corso
Eventuali problematiche riscontrate
Un centro dedicato alla prevenzione cardiovascolare è Le attività di prevenzione primaria e secondaria
stato progettato presso una nuova Casa della salute nelle realtà dove sono strutturati i progetti di
che sarà aperta a Parma Centro. Tale iniziativa nasce ricerca vengono svolte in modo
organico,
da una collaborazione tra Aziende Sanitarie, mentre nell’insieme della realtà assistenziale
Università degli Studi di Parma e Fondazione Don sono
svolte
in
modo
non
sempre
Gnocchi. standardizzato.
Gestione Integrata Diabete
Nel 2013 presso l’AOU di Parma è stato attivato il nuovo Centro di Cura per il Diabete, in cui sono
confluite le tre aree ambulatoriali aziendali dedicate al trattamento del diabete e dell’obesità. Il Centro
vede la collaborazione di un gruppo multidisciplinare di professionisti, in grado di gestire sia gli aspetti
clinici che psicologici della patologia diabetica e dell’obesità. E’ composto da sei ambulatori diabetologici,
un ambulatorio dedicato ai controlli per il piede diabetico, uno riservato al trattamento dei pazienti obesi,
un ambulatorio dietiste, un ambulatorio per i colloqui con lo psicologo e due ambulatori infermieristici.
L’attivazione del nuovo Centro di Cura per il Diabete ha inoltre portato all’utilizzo di una cartella clinica
unificata, a cui i diversi professionisti possano accedere per integrare le informazioni sul singolo caso e
107
3. Obiettivi istituzionali e strategie aziendali
Dare impulso al percorso di implementazione alla prevenzione delle malattie cardiovascolari nei
pazienti post-IMA/SCA, creando uno stretto collegamento con il Progetto sul Profilo dei Nuclei di cure
primarie, promuovendo incontri di audit tra MMG e Specialisti cardiologi, sul sistema di indicatori di
qualità (Profili di NCP) relativi al monitoraggio dei pazienti dimessi da un ricovero post-IMA:
trattamento farmacologico e controlli periodici, al fine di migliorare ulteriormente la qualità delle
prestazioni erogate ai cittadini.
prendere gli spunti documentali necessari all’impostazione dei percorsi di cura. All’interno del Centro un
ruolo fondamentale svolge il personale infermieristico, che rappresenta per il paziente un punto di
riferimento sia per la gestione pratica delle terapie prescritte, che per facilitare l’approccio a una gestione
globale della malattia da parte del paziente stesso, essenziale per il buon esito del percorso diabetologico
(si veda a riguardo un approfondimento presentato nel capitolo 4 al paragrafo “La Consulenza
Infermieristica” della sezione 4.4 Ridefinizione dei ruoli professionali in relazione allo sviluppo delle
strategie aziendali). Dal settembre 2013 è, inoltre, attiva la consulenza infermieristica pre-dimissione per
i pazienti ricoverati nelle Unità Operative dell'Azienda.
Il percorso prevede l'educazione all'automonitoraggio glicemico domiciliare e alla somministrazione di
insulina nei pazienti diabetici di nuova diagnosi o nei diabetici noti, che iniziano la terapia infusionale, al
fine di renderli preparati e autonomi rispetto alla gestione quotidiana della patologia diabetica.
Il nuovo Centro ha, tra gli altri, l’obiettivo di agevolare l’integrazione con le strutture del territorio gestite
dall’Azienda USL e con i Medici di Medicina Generale, al fine di rafforzare quella “gestione integrata del
diabete”, a cui le Aziende sanitarie della provincia di Parma hanno aderito fin dal 2005.
3. Obiettivi istituzionali e strategie aziendali
Percorso elaborato in modo comune dalle due Aziende sanitarie
Gestione Integrata Diabete
Le Aziende sanitarie della provincia di Parma hanno aderito al progetto “Gestione integrata del diabete
per la prevenzione delle complicanze" a partire dal 2005, in applicazione della Circolare Regionale n.
14/2003 e delle “Linee guida clinico-organizzative per il management del diabete mellito".
Tale progetto ha l’intento di migliorare la qualità dell’assistenza del paziente diabetico di tipo 2,
mediante la gestione diretta da parte dei Medici di Medicina Generale di quella quota di pazienti
diabetici che, per grado di compenso, età, adesione alla terapia, assenza di gravi complicanze non
richiedano un ricorso sistematico allo specialista e possano essere gestiti secondo modalità condivise
tra specialista diabetologo e MMG.
Risultati raggiunti
Nel 2013 nella provincia di Parma, fonte il Registro Provinciale di Patologia, risultano presenti 29.003
pazienti diabetici, su una popolazione residente di 447.251, ovvero il 6,48 % della popolazione; la
percentuale di diabetici sale al 21,97 % se si considera la fascia di popolazione residente con età > a
75 anni.
I nuovi entrati nel registro di patologia nel 2013 rispetto al 2012 sono 2028, con un’incidenza pari allo
0,45 % rispetto alla popolazione residente.
Sono 12.379 i pazienti diabetici ufficialmente in carico agli Ambulatori diabetologici dell'AUSL e
dell'AOU, di questi 4.716 sono seguiti con il percorso della gestione integrata.
Questo percorso condiviso fra MMG e Specialisti diabetologi continua a prevedere, oltre alla presa in
carico congiunta del paziente con diabete tipo 2 differenti progetti, fra i quali l’attivazione di un sistema
informatico di comunicazione tra MMG e Struttura Diabetologica attraverso la rete SoLe, la definizione
dei criteri per la concessione dei presidi per il monitoraggio domiciliare della glicemia e le modalità
distributive degli stessi.
Prosegue il percorso condiviso fra le due Aziende sanitarie della provincia per la presa in carico delle
gravidanze complicate da diabete gestazionale, oltre che il percorso provinciale integrato per la
diabetologia pediatrica. Il percorso per le Dimissioni Difficili/Protette
Da diversi anni, a livello gestionale trasversale, si colloca il progetto “Dimissioni Difficili/Protette” con
l’obiettivo di garantire la continuità assistenziale nelle situazioni in cui, pur essendo raggiunta la
stabilizzazione clinica, persistono bisogni socio-assistenziali e sanitari che rendono necessaria l’attivazione
della rete territoriale.
L’attivazione delle Dimissioni Protette implica l’integrazione di competenze sociali e sanitarie per la
valutazione multidimensionale dei bisogni delle persone ricoverate. In tale contesto, il Servizio Sociale
Ospedaliero (S.S.O.) riveste un ruolo fondamentale: l’attività degli Assistenti Sociali è innanzitutto
orientata ad affrontare le problematiche psicosociali connesse alla malattia e al ricovero ospedaliero, con
attenzione alla persona e al suo contesto di vita. Il lavoro integrato con i professionisti dell’ospedale e del
territorio consente di definire progetti di intervento a favore delle persone ricoverate, supportandone le
risorse personali, familiari e di comunità e attraverso la messa in rete di risorse pubbliche (servizi
domiciliari, case protette, RSA, eccetera) e del privato-sociale.
108
La dimissione del paziente fragile
Tra le varie strategie attivate in Azienda per gestire il tema della dimissione del paziente fragile vi è
anche la sperimentazione di uno strumento per garantire la continuità assistenziale attraverso l’uso della
Check - List (CL) “Dimissione del paziente”.
Lo strumento è frutto del lavoro multi-professionale condiviso ed è stato sperimentato per un anno e
validato dai Professionisti della Lungodegenza Critica e Lungodegenza Post - acuzie.
La CL è articolata su contenuti professionali (es. informazione MMG, valutazione clinica, lettera
dimissione, gestione presidi, igiene) e di relazione (es. informazioni mediche e assistenziali, recapiti,
saluti) che sono agiti dai diversi professionisti (Medico, Infermiere e OSS) in fase di dimissione del
paziente.
Il Dipartimento Geriatrico–Riabilitativo ha giudicato la sperimentazione protettiva per ridurre i rischi e gli
errori nel processo di dimissione, estendendola nel 2013 a tutte le Strutture del Dipartimento.
Nel 2013 è proseguito il progetto di continuità assistenziale del paziente oncologico, attivato alla fine del
2011 e condiviso tra i professionisti della U.O. Oncologia Medica dell’Azienda Ospedaliero-Universitaria di
Parma e il Dipartimento Cure Primarie dell’Azienda USL, con il coinvolgimento dei Medici di Medicina
Generale. Il progetto è indirizzato a quei pazienti oncologici residenti a Parma, in carico all’U.O. Oncologia
Medica, che abbiano difficoltà di accesso alla struttura ospedaliera, ma con necessità di terapie di
supporto o palliative e/o di controlli emato-chimici, eseguibili anche a domicilio. Sono state introdotte due
nuove figure nell’ambito del percorso: il medico oncologo responsabile della continuità assistenziale
(SOCA) e un infermiere professionale dedicato. In due anni di attività, sono stati presi in carico 54
pazienti, di cui la maggior parte off-therapy, candidati a sole cure palliative, e una piccola parte in
trattamento per tossicità da farmaci. Mediamente gli accessi del medico al domicilio sono stati 1-2 per
paziente, mentre quelli infermieristici 3-4 per paziente. Le prestazioni erogate a domicilio sono state:
visite specialistiche, somministrazione di idratazione e terapie ev, prelievi, medicazioni, paracentesi.
Questa assistenza domiciliare ha portato ad una migliore gestione e controllo dei sintomi di fine vita,
evitando accessi impropri sia presso il DH oncologico che al PS, con conseguente riduzione di ricoveri e
disagio per paziente e familiari. Si è potuto così garantire un ottimale percorso di fine vita, sia a domicilio,
che tramite ricovero presso hospice, a seconda delle volontà del paziente e della famiglia. Gli accessi in
PS, con conseguente ricovero, si sono verificati in seguito ad acuzie cliniche che, alla luce delle
esperienze acquisite, possono essere ulteriormente ridotti.
Infine, si è ridotta, da parte del paziente e familiari, la riferita percezione di “abbandono terapeutico”, che
si verifica al momento dell’interruzione dei trattamenti chemioterapici.
Si garantisce in questo modo una continuità assistenziale che migliora la qualità di vita e riduce la
resistenza da parte del paziente ad accettare il termine dei trattamenti oncologici attivi.
Inoltre, nel 2013 ci sono stati tre incontri del GOT, Gruppo Oncologico Provinciale, costituito da oncologi e
farmacisti dell’AOU e dell’AUSL, con la partecipazione estemporanea di altre figure professionali (MMG,
Referenti di Hospices e dei NCP), con l’obiettivo di condividere percorsi di continuità assistenziale
ospedale-territorio e protocolli diagnostico-terapeutici per i pazienti con carcinoma della mammella, del
polmone e del colon retto. Lo stesso gruppo di lavoro ha affrontato il tema dell’appropriatezza prescrittiva
dei farmaci oncologici ad alto costo.
Contrastare le iniquità
Rimozione delle condizioni di svantaggio e discriminazione
L’Azienda Ospedaliera ha promosso, attraverso il Piano dell’equità, un modello di governance definendo le
modalità organizzative per il coordinamento delle iniziative e delle azioni per l’equità e individuando un
Gruppo di coordinamento. Ciò ha permesso di garantire la partecipazione di propri referenti al percorso
formativo regionale “Le nuove dimensioni della relazione di cura in un contesto pluriculturale” nel 2012 e
la piena partecipazione alle attività promosse dall’Agenzia Sanitaria e Sociale Regionale e ai progetti di
modernizzazione finanziati dalla Regione.
Anche in seguito al percorso formativo regionale e per promuovere il perseguimento di strategie
innovative a favore delle persone immigrate e non solo, al fine di sviluppare e sostenere il cambiamento
culturale e di conseguenza innescare cambiamenti organizzativi condivisi e centrati rispetto agli obiettivi
strategici, l’Azienda ha sviluppato il progetto formativo “Mediazione di sistema e profili di responsabilità
medico-legale: laboratorio di apprendimento riflessivo” inserito nel sottoprogetto n. 4 “Mediazione di
109
3. Obiettivi istituzionali e strategie aziendali
Rete e percorsi oncologici
sistema” del Progetto di modernizzazione “TRASFERIMENTO DI BUONE PRATICHE DI CONTRASTO ALLE
INIQUITÀ IN RIFERIMENTO AGLI UTENTI NEI SERVIZI SANITARI, SOCIO-SANITARI E DI COMUNITÀ”.
La proposta formativa è volta a mettere i medici e il personale sanitario in condizione di favorire la
partecipazione dei pazienti nella produzione dei significati culturali dell’esperienza di malattia (con
particolare, ma non esclusivo, riferimento all’utenza straniera) e nella loro valorizzazione clinica tanto nel
processo diagnostico quanto in quello terapeutico assistenziale. Si tratta di assumere una prospettiva
polifonica, che tenga conto: sia della diversità culturale tra medico - e in linea generale tra professionista
sanitario - e paziente (anche attraverso la diffusione e progressiva acquisizione di una consapevolezza di
fondo da parte dei professionisti sanitari); sia della necessità di modalità di traduzione in chiave giuridicoprofessionale in grado di tener conto di possibili implicazioni medico-legali connesse con la mancata
instaurazione dell’alleanza medico-paziente per incomprensione sui termini e sull’approccio da tenere.
Il progetto è in corso ed è stato strutturato partendo dal presupposto che l'apprendimento e il
cambiamento organizzativo debbano avviarsi nei contesti stessi in cui avvengono le pratiche e attraverso
processi di analisi riflessiva sulle stesse, che coinvolgano gli attori organizzativi che vi prendono parte.
Le attività in essere o in definizione a livello aziendale su questa tematica sono diverse, alcune sono
presentate nel volume. Fra le altre progettualità possiamo citare: la mediazione telefonica, il progetto di
servizio civile “Curare la relazione per prendersi cura della persona”; il progetto promosso insieme al
Comitato Unico di Garanzia “L’accoglienza ospedaliera alle donne vittime di violenza e di stalking” (ripresi
anche nel capitolo 4 e nel capitolo 5); la partecipazione all’iniziativa bollini rosa (cfr. anche il capitolo 5),
l’health literacy e il citato progetto di modernizzazione “Mediazione di sistema”.
Assistenza e accoglienza ai cittadini migranti
3. Obiettivi istituzionali e strategie aziendali
La popolazione della provincia di Parma al 1° gennaio 2013 è di 447.251 abitanti; nello stesso periodo, la
popolazione migrante residente è di 60.550, equivalente all’13,5% del totale dei residenti.
La popolazione residente della provincia di Parma è cresciuta ininterrottamente, dal 1° gennaio 2003 al
1° gennaio 2013 la popolazione è passata da 404.722 a 447.251, nello specifico la popolazione migrante
è passata da 19.358 a 60.550 ovvero dal 4,3 % del 1° gennaio 2003 al 13,5% del 1° gennaio 2013, una
crescita maggiore di 2317 stranieri rispetto a quella dell’anno precedente.
I cittadini dell’ Est Europa si confermano il gruppo più numeroso. Ormai da alcuni anni, nella graduatoria
delle nazionalità, le prime tre posizioni sono occupate da Moldavi, Rumeni e Albanesi che rappresentano il
35,7% dell’intera popolazione straniera residente nella provincia di Parma.
Grafico1 Composizione della popolazione migrante residente al 1° gennaio 2013 nella
Provincia di Parma. Suddivisione per area di provenienza
Moldavia (Rep. Moldava)
7740
Romania
6855
Albania
6786
Marocco
5156
Tunisia
4207
3534
India
2636
Filippine
2112
Ucraina
1854
Senegal
Ghana
1634
Nigeria
1569
Costa d'Avorio
1523
Cina
1248
Ecuador
764
Camerun
712
Fonte: www.statistica.parma.it
110
Ricoveri ospedalieri
Nel 2013 nell’Azienda Ospedaliero-Universitaria di Parma, attraverso il flusso regionale SDO, sono stati
registrati 5568 ricoveri di pazienti stranieri, corrispondenti al 10,98% di tutti i ricoveri. L’ 81,20% di tutti i
ricoveri è stato effettuato in regime di ricovero ordinario, mentre il 18,78% in regime diurno. Tra i
pazienti dimessi di nazionalità non italiana, c’è una predominanza di africani, seguiti da pazienti
provenienti dall’Est europeo, da asiatici e da europei comunitari. Le nazionalità più rappresentate sono:
albanese, moldava, romena, marocchina, nigeriana e tunisina, che da sole costituiscono il 58,27% dei
ricoveri di pazienti di origine straniera. La composizione della popolazione migrante residente nel
territorio corrisponde sostanzialmente agli accessi registrati presso l’ospedale, ad eccezione della
nazionalità nigeriana che seppure nel territorio rappresenta il 2,59% della popolazione straniera ha
registrato nel 2013 il 6,07% dei ricoveri.
Grafico2 Ricoveri ospedalieri
provenienza, anno 2013
nella
popolazione
migrante
suddivisi
per
macroaree
di
UE28
14%
AFR ICA
38%
PAESI EU ROPEI
N ON UE
29%
AL TRO
0%
ASIA
14%
AM ERIC A
5%
Tabella 1 Ricoveri ospedalieri nella popolazione migrante suddivisi per paese di origine
(nazionalità più rappresentate), anno 2013
Paese di provenienza N. casi % Paese di provenienza N. casi % ALBANIA 655 11,76%
FILIPPINE
204
3,66% MOLDOVA 605 10,87%
GHANA
202
3,63% ROMANIA 581 10.,43%
SENEGAL
200
3,59% MAROCCO 519 9,32%
COSTA D'AVORIO
179
3,21% NIGERIA 338 6,07%
UCRAINA
158
2,84% TUNISIA 307 5,51%
CINA
112
2,01% INDIA 240 4,31%
PAKISTAN
94
1,69% Fonte:Banca dati SDO RER
Nella maggior parte dei casi si tratta di giovani adulti di età compresa tra i 26 e i 45 anni (36,36%) e di
bambini sotto i 15 anni, che costituiscono il 33,46% dei ricoveri totali di pazienti non Italiani.
Gli africani, così come negli anni precedenti, sono presenti prevalentemente nelle fasce di età adultogiovanili (87,63% <46 anni), anche se negli ultimi anni si sono registrati ricoveri anche a carico delle
fasce di età più avanzate.
Per quanto riguarda le fasce sopra i 55 anni, sono costituite nella maggior parte dei casi (64,38%) da
popolazioni provenienti dai paesi europei, sia appartenenti all’Unione Europea che non. Da notare
comunque che solo il 9,43 % dei pazienti ricoverati stranieri ha un’età superiore a 55 anni.
111
3. Obiettivi istituzionali e strategie aziendali
Fonte:Banca dati SDO RER
Grafico 3 Ricoveri ospedalieri nella popolazione migrante: suddivisione per macroaree di
provenienza e classe di età, anno 2013
1400
1200
1000
UE28
PAESI EUROPEI
NON UE
800
ASIA
600
AMERICA
400
ALTRO
AFRICA
200
0
<1
1 - 15
16 - 25
26 - 35
36 - 45
46 - 55
56 - 65
>66
Fonte:Banca dati SDO RER
3. Obiettivi istituzionali e strategie aziendali
La distribuzione per sesso vede il 60,65% dei dimessi di sesso femminile e il 39,35% di sesso maschile.
Analizzando la distribuzione per sesso ed età, si evidenzia come nella fascia adulto-giovanile (16-45), i
ricoveri sono per la maggior parte a carico delle donne (età fertile), pari al 35,22% di tutti i ricoveri
mentre la maggior parte dei ricoveri che riguardano il genere maschile rientra nella fascia di età infantile
(0-15).
Come per gli anni precedenti, anche nel 2013 il reparto che ha registrato il maggior numero di ricoveri è
stata l’Ostetricia e Ginecologia (26,38%), seguita dai reparti pediatrici (Neonatologia-Nursery, Clinica
Pediatrica, Pediatria e Oncoematologia, Astanteria Pediatrica, Chirurgia Pediatrica, T.I. Neonatale), con il
31,45% di tutti i ricoveri. Nell’insieme, i reparti del Dipartimento Materno-Infantile hanno accolto il
57,83% di tutti i ricoverati stranieri nell’AOU di Parma.
Tabella 2 Ricoveri ospedalieri nella popolazione migrante: suddivisione per reparti di
dimissione, anno 2013
Reparti di dimissione N. casi % Ostetricia e Ginecologia Neonatologia‐ Reparti pediatrici Reparti Internistici Reparti Chirurgici Ortopedie Terapie intensive Totale 1.469
1.751
1.104
968
250
26
5.568
26,38%
31,45%
57,83% 19,83%
17,39%
4,49%
0,47%
100,00%
Per gli accessi al Pronto Soccorso da parte della popolazione straniera, si rimanda alla parte specifica del
capitolo 2.3 del presente volume.
L’offerta di mediazione linguistica e culturale
L’impiego della mediazione culturale all’interno di una struttura ospedaliera porta ad agevolare la pratica
clinica e, di conseguenza, il lavoro e la sua organizzazione; essa permette di aiutare ammalati e familiari,
da una parte, e operatori sanitari dall’altra, riguardo la necessità di comunicare reciprocamente, e
contribuisce all’avvicinamento e alla comprensione reciproca di culture diverse.
A supporto dei processi di prevenzione e cura rivolti a persone con matrici culturali e linguistiche diverse
da quelle del nostro paese, nell'ambito delle iniziative in tema di equità, l’Azienda ha attivato a fine 2011
un servizio di Mediazione Linguistico-Culturale telefonica, avente la finalità di facilitare l’accesso e la
112
L’intervento di mediazione culturale anche in presenza all’interno della nostra Azienda ha raggiunto negli
ultimi anni una certa stabilità, il cui utilizzo da parte degli operatori sanitari dimostra come sia radicata
l’esigenza di comunicare con il malato, non solo per motivi medici legali, ma anche per una adeguata
accoglienza e comunicazione, in grado di ottenere un appropriato counselling, sia nel percorso di degenza
che nel processo della dimissione.
Nel corso del 2013 le ore di utilizzo del servizio di mediazione culturale in presenza sono state 359. La
maggior parte degli interventi hanno interessato le lingue indiana, punjabi e hindi (152 ore, 42%) e la
lingua cinese (95 ore, pari al 39%). Meno rilevante il ricorso alla lingua araba (59 ore, 11%) ed altre
lingue: sri lanka (19 ore), slava (12 ore), curdo (6 ore), mali-guinea (3 ore).
La presenza del mediatore in reparto nell’anno 2013 è stata richiesta dagli operatori sanitari (medico,
infermieri, operatori della riabilitazione, ostetrica) nelle situazioni in cui era necessario favorire il processo
di cura (diagnosi, terapia, prosecuzione terapeutica) attraverso la comunicazione diretta sia con il malato
che con la famiglia.
La stabilità residenziale di nucleo familiari indiani/pakistani costituiti da genitori giovani con bambini ha
richiesto più volte l’intervento del mediatore sia nelle fasi diagnosi che nelle fasi terapeutiche e post
ricovero con accompagnamento nell’educazione terapeutica ed alimentare, in quanto trattasi di bambini
affetti da patologie croniche.
La popolazione cinese regolare ha maggiore conoscenza dei servizi territoriali che ospedalieri. La richiesta
maggiore del mediatore in presenza, avviene dal personale Maternità e da reparti con particolare
intensità terapeutica.
Sono diminuite le richieste di mediatori per i pazienti provenienti dal Centro Africa (Mali, Guinea, Nigeria)
e delle donne sole gravide nonché donne con ricongiungimento in quanto tali persone sono intercettate
prima del ricovero (salvo le urgenze) dal Servizio Immigrazione del Comune (progetto richiesta asilo,
progetti del ministero) che mette a loro disposizione i mediatori.
Si è assistito all’accesso di giovani donne del Sri Lanka in stato di gravidanza e ricoveri di bambini con
patologie genetiche (matrimoni tra consanguinei). Sul nostro territorio si è insidiata una numerosa
comunità dello Sri Lanka.
Cittadini stranieri e qualità percepita nelle degenze dell’Azienda Ospedaliero
- Universitaria di Parma
La qualità di un Servizio Sanitario non può essere valutata solo considerando l’adeguatezza tecnica
delle prestazioni sanitarie erogate, ma anche attraverso la soddisfazione degli utenti in rapporto alle
loro aspettative.
Analizzare i giudizi forniti dai pazienti per le prestazioni ricevute nelle degenze e nello specifico
ricercare differenze confrontando:
a) pazienti italiani e stranieri rispetto a tutti gli aspetti dell’assistenza ricevuta nel ricovero;
113
3. Obiettivi istituzionali e strategie aziendali
fruibilità ai servizi aziendali da parte dei cittadini stranieri. La mediazione linguistico-culturale telefonica
costituisce un servizio strutturato, funzionante 24 ore su 24, 365 giorni l’anno, attivabile da tutti i telefoni
aziendali mediante un numero telefonico verde. La disponibilità del nuovo servizio è stata condivisa con i
professionisti dell’Azienda attraverso incontri dedicati e utilizzando tutti gli strumenti di comunicazione
interna disponibili (newsletter, sito intranet, circolari informative).
Il progetto è nato per favorire l’accesso ai servizi, facilitare la rimozione delle barriere linguistico-culturali
e la realizzazione delle pari opportunità da parte della popolazione straniera. Il progetto risponde in modo
concreto all’aumento dei ricoveri e degli accessi da parte della popolazione straniera e mira a sostenere i
professionisti nella necessità di comunicare in modo corretto e comprensibile e capire adeguatamente le
problematiche presentate dai pazienti. Tra gli obiettivi specifici del servizio, favorire l’acquisizione di
capacità di controllo e miglioramento della propria salute da parte delle persone immigrate o appartenenti
Non ci sono limiti di durata per la telefonata, che può proseguire anche per parecchi minuti, in quanto la
spiegazione di una diagnosi o la descrizione di una terapia può richiedere l’impiego di un tempo
maggiore. Il mediatore si mette a completa disposizione dell’azienda, e la chiamata termina solo quando
si è risolto il problema.
Dalla data di attivazione le chiamate al servizio sono state 378 per un totale di 36 lingue.
I principali interventi di Mediazione Linguistico- Culturale Telefonica sono stati per la lingua Cinese (74),
Inglese (26), Indiana (20), Albanese e Araba (17), Polacca (15), Francese (13).
Il Servizio di Mediazione Linguistico- Culturale Telefonica ha suscitato l’attenzione di numerosi
professionisti nei vari reparti soprattutto nell’area di emergenza.
3. Obiettivi istituzionali e strategie aziendali
b) pazienti maschi e femmine stranieri rispetto a tutti gli aspetti dell’assistenza ricevuta nel ricovero.
Rilevazione quantitativa basata sulla somministrazione di un questionario, validato dalla Agenzia
Sanitaria e Sociale Regionale della Regione Emilia–Romagna, per l’indagine della qualità percepita sulle
degenze e comprensivo di 7 versioni tradotte in inglese, francese, spagnolo, rumeno, arabo, cinese e
albanese. L’indagine ha avuto la durata di tre mesi sia nel 2011 che nel 2012 ed ha coinvolto complessivamente 34 Strutture di degenza ordinaria dell’Azienda Ospedaliero – Universitaria di Parma.
Una recente rassegna (Mastaki, 2010), svolta sulla letteratura internazionale (USA, Regno Unito,
Europa, Australia, eccetera), ha messo in luce che gran parte degli studi che hanno analizzato la
soddisfazione dell’utenza straniera rispetto ai servizi sanitari usufruiti, mostra generalmente livelli più
bassi di soddisfazione rispetto alla cittadinanza locale (19 dei 28 studi considerati, 68%), mentre solo il
21% mostra livelli di soddisfazione superiori; solo tre studi (10%) hanno descritto livelli simili di
soddisfazione fra il campione di stranieri e il campione di cittadini locali.
L’Azienda Ospedaliero-Universitaria di Parma ha aderito al progetto triennale (2010 – 2012)
“Osservatorio/laboratorio per l’ascolto/coinvolgimento dei cittadini, della comunità e dei professionisti e
azioni di miglioramento” e nello specifico alla “Rete Metodologica delle Indagini di Qualità Percepita”
promosso dalla ASSR dell’Emilia-Romagna.
Risultati raggiunti
Su 2823 questionari raccolti, il 5,1% (n=145) di rispondenti è di nazionalità straniera e proveniente da
37 Paesi: le nazionalità più rappre-sentate sono quelle moldava (18%), albanese (15%), rumena
(15%), marocchina (7%) e ucraina (4%). Il 66% del campione contattato è di genere femminile. In
accordo con i flussi di accesso, rispetto alla totalità del campione il 58% afferisce dal Dipartimento
Materno-Infantile.
I risultati indicano che i cittadini di nazionalità non italiana siano complessivamente più soddisfatti dei
servizi ricevuti, rispetto a tutti gli aspetti del ricovero: le modalità di accesso, l’assistenza fornita dal
personale medico e infermieristico, l’aiuto ricevuto per l’igiene personale, la privacy, la gestione del
dolore, gli aspetti organizzativi, gli ambienti e servizi alberghieri oltre che le informazioni ricevute in
fase di dimissioni. Non emergono invece differenze statisticamente significative fra i maschi e le
femmine rispetto a nessun aspetto dell’assistenza.
Interventi in fase di sviluppo o in corso
Il protocollo di rilevazione della Qualità Percepita
nelle degenze, rispetto al 2014 sarà aggiornato ed
ampliato
per
comprendere
ulteriori
aree
(responsiveness).
Eventuali problematiche riscontrate
Rispetto agli intervistati di nazionalità italiana,
gli intervistati stranieri hanno dichiarato di
ricevere
meno
aiuto
da
persone
non
appartenenti al nucleo familiare.
Note o approfondimenti
L'Azienda ha presentato l’iniziativa in occasione della I° Conferenza Società Italiana per la Promozione
della Salute (PI) tenutasi il 19 aprile 2013.
Garantire l’ascolto, l’accoglienza, il supporto diagnostico e la presa in carico
delle persone vittime di maltrattamento e abuso
Con Delibera di Giunta Regionale n. 1677 del 2013 sono state adottate le linee di indirizzo regionali per
l’accoglienza di donne vittime di violenza di genere e linee di indirizzo regionali per l’accoglienza e la cura
di bambini e adolescenti vittime di maltrattamento/abuso.
Tali linee di indirizzo sono state recepite dal Comitato Unico di Garanzia dell’Azienda Ospedaliero
Universitaria di Parma e presentate a tutti i suoi componenti in data 21 gennaio 2014.
Le linee guida regionali rappresentano una cornice di riferimento per gli operatori sanitari che
intervengono in aiuto delle donne vittime di violenza. La procedura ospedaliera già in essere, di
accoglienza delle donne vittime di violenza, redatta dal gruppo di operatori sanitari coinvolti
nell’accoglienza delle vittime e coordinato dal CUG, risponde a pieno alle raccomandazioni suggerite dalle
linee guida regionali.
La seconda parte delle linee guida affronta il problema della violenza sui minori e offre importanti
suggerimenti per i comportamenti che il personale sanitario deve adottare. Le linee guida sono state
diffuse a tutti gli operatori coinvolti nella cura delle vittime.
Progetto “L’accoglienza Ospedaliera alle donne vittime di violenza di genere e di stalking”
L’Azienda Ospedaliero-Universitaria ha promosso un progetto formativo “L’accoglienza Ospedaliera alle
donne vittime di violenza di genere e di stalking” ideato e realizzato nell’ambito dell’avviso della
114
Prevenzione degli atti di violenza contro gli operatori sanitari
L’Azienda Ospedaliero-Universitaria di Parma (AOUPR) che ha promosso la programmazione e
implementazione di misure (strutturali e organizzative) che consentano la rilevazione e gestione di
situazioni a rischio di atti di atti di violenza contro gli operatori sanitari, promuovendo iniziative di
empowerment dei professionisti (infermieri,
medici, operatori socio-sanitari, assistenti sociali,
psicologi, personale del servizio 118, servizi di vigilanza, tecnici sanitari, personale di front-office,
eccetera).
Risultati raggiunti
E’ stato attivato dal mese di settembre 2013 un Gruppo di Lavoro multiprofessionale per la gestione del
tema “prevenzione della violenza a danno degli operatori sanitari”.
Il fenomeno è tenuto a
monitoraggio grazie agli Incident Reporting, redatti dai Professionisti, ai report giornalieri dell’Istituto
di Vigilanza Aziendale (IVRI) e alle statistiche di infortunio (SPPA). Il Gruppo di Lavoro ha definito in
chiave multidisciplinare e multiprofessionale uno strumento informativo, successivamente diffuso ai
professionisti di tutte le Strutture dell’Azienda, che riprende i principali aspetti della Raccomandazione
e fornisce utili indicazioni, denominato COMEFAREPER… n. 7 PREVENZIONE DEGLI ATTI DI VIOLENZA
CONTRO GLI OPERATORI SANITARI [allegato n. 3]. Lo strumento contiene infatti informazioni e
modalità di segnalazione «pronte all’uso» per tutti i professionisti coinvolti in situazioni di rischio; come
tutti gli strumenti per la gestione del rischio, è stato diffuso al Comitato Consultivo Misto Aziendale,
espressione del Volontariato.
115
3. Obiettivi istituzionali e strategie aziendali
Presidenza del Consiglio dei Ministri per il finanziamento di progetti pilota di formazione degli operatori
sanitari sulla prima assistenza alle vittime di violenza di genere e stalking.
Il percorso formativo (iniziato nel 2012 con sviluppo nel 2013) per un totale di 50 ore era rivolto
principalmente al personale sanitario del Pronto soccorso e dell’Ostetricia e Ginecologia per l’elaborazione
e la messa in opera di una procedura aziendale condivisa per l’accoglienza alle donne vittime di violenza e
stalking e per un’assistenza qualificata e integrata nella rete di tutela territoriale.
Al corso ha partecipato anche personale esterno all’Azienda (un medico di medicina generale) e non
sanitario (due rappresentanti delle forze dell’ordine, un volontario di centro antiviolenza).
Obiettivi del progetto sono:
 aumentare le conoscenze del fenomeno della violenza sulle donne in termini culturali,
antropologici e sociologici con particolare riferimento al tema dello stalking, dei maltrattamenti,
della violenza domestica e della violenza sessuale;
 contribuire a realizzare un contesto di accoglienza capace di creare un sistema di protezione e di
tutela della vittima che l’aiuti a superare un momento e una condizione di estrema difficoltà e
complessità tenendo conto anche della diversità culturale;
 sviluppo e potenziamento delle competenze relazionali e comunicative di tutti gli attori coinvolti
(professionisti, volontari o forze dell’ordine) che si prendono cura della persona garantendone
l’accoglienza e la presa in carico.
Nell’ambito del percorso sono stati trattati anche i temi della negazione violenta della sessualità
femminile nei contesti immigratori e delle mutilazioni genitali e le modalità di utilizzo degli strumenti di
mediazione in tali frangenti.
In esito al percorso formativo è stata definita una procedura operativa per la realizzazione di un iter
definito e condiviso dall’accesso in pronto soccorso sino alla dimissione e attivazione delle risorse
territoriali finalizzate ad una presa in carico tempestiva e alla pianificazione di un progetto individuale di
intervento.
A chiusura del progetto è stato realizzato anche un workshop di socializzazione che è stato molto
partecipato e ha avuto un alto gradimento.
Nell’ambito della progettazione è stata strutturata una fase valutativa e di monitoraggio al fine di valutare
le conoscenze acquisite e le competenze conseguite dai partecipanti, nonché la capacità di sensibilizzare il
contesto organizzativo di appartenenza e la collaborazione tra specialisti con competenze diverse per
creare una rete di sostegno.
Monitoraggio e valutazione delle competenze sono effettuati sia in itinere che al termine del percorso
formativo utilizzando diversi strumenti (test di ingresso e di uscita, focus group, eccetera).
Sono stati rilevati i cambiamenti dei partecipanti in termini di: maggiore attenzione ai segni premonitori
della violenza, consapevolezza che il loro intervento non è esaustivo, ma è il punto di partenza per
l’accesso della vittima in una rete integrata di sostegno, aumento della self efficacy nella conduzione del
colloquio e presa in carico. Si è rilevato inoltre il passaggio dalla rabbia per l’incapacità relazionale della
vittima alla consapevolezza della complessità della relazione affettiva.
Interventi in fase di sviluppo o in corso
Il tema specifico degli atti di violenza contro gli operatori è stato e verrà ulteriormente analizzato nei
corsi di formazione interattivi rivolti ai professionisti all’interno di 8 corsi aziendali programmati nel
2014.
Note o approfondimenti
L'esperienza dell'Azienda è stata presentata in occasione del Convegno "Segni parlanti, occhi che
ascoltano - Semeiotica della violenza per un protagonismo della cura" tenutosi a Reggio Emilia l’11
Aprile 2014.
La medicina delle differenze
Sono diversi i progetti realizzati in ambito aziendale che esplicitano l’attenzione al tema delle differenze di
genere nell’ambito delle cure mediche. Si tratta sia di iniziative di sensibilizzazione e formazione che di
veri e propri progetti di ricerca. Diamo brevemente conto di due specifiche iniziative qui di seguito.
3. Obiettivi istituzionali e strategie aziendali
In collaborazione con i comitati unici di garanzia (CUG) delle due Aziende sanitarie della provincia è stato
organizzato, in occasione dell'8 marzo, il convegno,“La medicina delle differenze: un percorso fra i generi
e le culture”, momento di riflessione, aperto agli operatori sanitari e alla cittadinanza, per sensibilizzare e
promuovere un cambiamento culturale nei percorsi di cura alle persone. Di questo evento si parla anche
nel capitolo 5.
Un approccio di “genere” nella tutela della salute degli individui considera non solo le caratteristiche e le
diversità anatomiche e fisiologiche tra uomo e donna ma anche la personalità, le attitudini, i sentimenti, i
valori, i comportamenti e le attività che la società attribuisce ai due sessi.
La medicina di genere, attenta a tutte le differenze biologiche, psicologiche e culturali, permette quindi
l’avvio di percorsi di cura fortemente personalizzati e innovativi, nel rispetto delle diversità culturali,
etniche, di età, di disabilità, di religione e orientamento sessuale e di contrasto a tutti i pregiudizi e alle
disuguaglianze socio-economiche. I vari interventi hanno toccato tematiche più generali, ad esempio il
focus su generi e differenze o sul tema del lavoro, del cibo, dell’appartenenza etnica, o specifiche
patologie (come il diabete, le malattie cardio-vascolari).
L’AOU di Parma ha partecipato al progetto: “Clinical impact of coronary revascularization in myocardial
infarction: a gender project” nell’ambito del progetto strategico di medicina di genere “L'infarto miocardio
nella donna: una realtà diversa. Dalla genetica alla terapia interventistica e all'impatto psicosociale della
malattia prima causa di morte nel sesso femminile”, coordinato dall’Ospedale Niguarda, Regione
Lombardia e finanziato dal Ministero della Salute nell’ambito del bando di ricerca Finalizzata 2007.
Per questo progetto di ricerca, partito nel 2007, un gruppo di medico-ricercatrici italiane ha deciso di
combinare insieme le loro conoscenze per adottare una prospettiva globale di genere nell’approccio alla
patologia cardiovascolare, che spaziasse dalla genetica alla trascrittomica e proteomica, all’epidemiologia,
cardiologia interventistica e alla valutazione dell’impatto psico-sociale.
La ricerca si è focalizzata sull’analisi dell’infarto miocardico acuto nella donna su 4 livelli e con 4 obiettivi
principali:
1. valutare le differenze di genere con le tecnologie genetiche disponibili (genotipizzazione con
genome wide association, trascrittomica e proteomica) nell’infarto miocardico,
2. valutare le differenze di genere nelle caratteristiche di esordio, di accesso alle cure e la loro
relazione con la prognosi dell’infarto miocardico utilizzando un database della regione Lombardia,
3. valutare le differenze di genere nel trattamento dell’infarto miocardico acuto dal punto di vista
interventistico, accesso alle cure, rischio di sanguinamento e mortalità nel database regionale
delle angioplastiche coronariche dell’Emilia-Romagna,
4. valutare le risposte gender specifiche alla malattia cardiaca acuta, l’interazione con gli aspetti
psico-sociali, i fattori comportamentali che influenzano la prognosi e valutare le possibili
correlazioni con le caratteristiche genetiche e familiari.
I risultati preliminari di queste ricerche sono stati in parte presentati a congressi nazionali e internazionali
e in parte pubblicati su riviste peer reviewed.
116
Partecipazione all’Osservatorio Nazionale sulla Salute della Donna
Nel corso del 2013 l’Azienda ha partecipato al Bando Bollini Rosa di O.N.Da, Osservatorio Nazionale
sulla Salute della Donna. Bollini Rosa è un programma speciale di valutazione degli ospedali basato sul
loro livello di “women friendship” inteso come grado di attenzione posta non solo nei confronti dei
campi della medicina dedicati alle patologie femminili, ma anche verso le esigenze specifiche delle
donne ricoverate.
Alle strutture ospedaliere, che possiedono i requisiti identificati dall’Osservatorio e dunque di eccellenza
nella prevenzione e nella cura delle patologie femminili, vengono assegnati da uno a tre bollini rosa con
validità biennale, con lo scopo di attestare il loro impegno. I Bollini Rosa rappresentano un punto di
partenza per favorire la crescita della “prospettiva di genere” da identificarsi come fattore strategico di
qualità nell’erogazione delle cure nell’ambito delle strutture sanitarie.
Risultati raggiunti Sulla base del punteggio conseguito in ciascuna sezione del questionario, un algoritmo matematico
assegna automaticamente il numero di Bollini Rosa con la seguente corrispondenza: 0-50 punti (0
Bollini), 51-65 punti (1 Bollino), 66-85 punti (2 Bollini), >85 punti (3 Bollini).
Le Strutture candidate alla partecipazione sono la Neonatologia, Endocrinologia, Dietologia e Nutrizione
clinica, Diabetologia, Neurologia, Reumatologia, Senologia, Medicina della Riproduzione, Violenza sulle
donne, i Servizi per l’Accoglienza, Ginecologia e Ostetricia, Malattie e Disturbi dell’Apparato
Cardiovascolare ed Oncologia.
L'algoritmo matematico ha elaborato per l’Azienda un punteggio complessivo pari a 90, corrispondente
quindi a 3 bollini. La candidatura è stata poi esaminata dalla Commissione di esperti che, considerate le
informazioni qualitative inserite nel questionario (in particolare nei campi 'fiori all'occhiello'), ha
confermato 3 bollini. L’Azienda in seguito alla partecipazione al Bando Nazionale Bollini Rosa 20142015 ha conseguito 3 Bollini Rosa, il massimo riconoscimento.
Interventi in fase di sviluppo o in corso
Il riconoscimento ha validità dal 1° gennaio 2014 al 31 dicembre 2015. Garantire il diritto alla salute delle persone detenute
Per il 2013, nell’ambito dell’attuazione del Programma salute negli istituti penitenziari, l’Azienda ha
puntualmente rispettato tutti i bisogni di salute della popolazione detenuta sia per quanto riguarda il
regime di ricovero in degenza ordinaria che in regime ambulatoriale, per prestazioni con carattere di
urgenza e programmate. L’attività erogata è stata svolta modulando le necessità assistenziali rispetto
alle risorse disponibili per i posti letto della Sezione ad hoc esistente. Il complesso delle attività è stato,
inoltre, fortemente espresso anche attraverso una copiosa azione di rilievo medico-legale anche al fine
di rispondere a quesiti contingenti posti dai Magistrati di Sorveglianza rispetto a casi o situazioni
specifici. 117
3. Obiettivi istituzionali e strategie aziendali
Favorire la globalità del trattamento sanitario nei confronti del paziente recluso, assicurare la
interdisciplinarietà degli interventi assistenziali, attraverso una maggiore integrazione tra assistenza
primaria e prestazioni specialistiche, in particolare della psichiatria, infettivologia, dipendenze
patologiche e pronto soccorso.
3.3 Centralità del cittadino
La capacità dell’Azienda di rapportarsi proficuamente ai propri utilizzatori e di adattarsi alle loro esigenze
ponendoli al centro del proprio operare è il profilo sotto il quale assumono rilevanza qualitativa le
iniziative riportate in questa parte del volume e che documentano, seppur in parte, lo sforzo compiuto
dall’Azienda nel proporre un servizio il più possibile a misura di cittadino.
Promozione della partecipazione attraverso i Comitati Consultivi Misti
3. Obiettivi istituzionali e strategie aziendali
Nel corso dell'anno 2013, il CCM ha ritenuto di porre maggiormente l'attenzione alla prosecuzione e al
rafforzamento delle attività di rilevazione della percezione dalla parte del cittadino sulla qualità dei servizi
ricevuti.
Sono stati effettuati incontri mensili con i professionisti che erogano l'assistenza sempre con la presenza
della Direzione Aziendale.
Ha approfondito l'argomento della mediazione linguistico-culturale che l'Azienda ha avviato con il servizio
helpvoice, attivo 24 ore su tutti i telefoni dell'Ospedale, che permette di mettere in contatto l'operatore
sanitario con il mediatore linguistico.
La Direzione ha organizzato con i componenti del CCM visite presso il Nuovo Ospedale di Bambini “Pietro
Barilla”, di recente inaugurazione, presso la Pneumologia del padiglione Rasori e al nuovo Centro per la
Cura del Diabete presso il padiglione Cattani.
Nel corso del 2013 con i Professionisti medici e infermieristici sono stati esaminati i percorsi assistenziali
offerti dall’Azienda.
I componenti del CCM hanno partecipato alla rilevazione “Check List per la valutazione del grado di
umanizzazione delle strutture di ricovero". Un componente è stato nominato Componente del Comitato
Ospedale senza dolore e del Comitato Buon Uso del Sangue.
Le relazioni con i cittadini attraverso la rilevazione della qualità
percepita
La qualità di un Servizio Sanitario non può essere valutata solo considerando l'adeguatezza tecnica
delle prestazioni sanitarie erogate, ma anche con la soddisfazione degli utenti in rapporto alle loro
aspettative. L'Azienda Ospedaliero-Universitaria di Parma intende garantire alti livelli di partecipazione
dei cittadini, favorendo il loro contributo attivo alla valutazione della qualità dei servizi attraverso l'uso
di strumenti idonei per l'ascolto e la comunicazione.
Risultati raggiunti
L’Azienda ha partecipato all’iniziativa interaziendale “Analisi della qualità della cura dal lato delle utenti
nei servizi dedicati all’interruzione volontaria di gravidanza delle Aziende della RER”. La realizzazione
dell’indagine interaziendale sul territorio provinciale ha previsto una stretta collaborazione tra l’Azienda
Ospedaliero-Universitaria e l’Azienda USL di Parma, che hanno condiviso un protocollo metodologico
congiunto. Come previsto dal protocollo metodologico, i dati sono stati trasmessi all’ASSR.
Sono state inoltre realizzate in Azienda, su specifica richiesta dei Responsabili di struttura, le seguenti
indagini sulla qualità percepita:
Struttura Radiologia Polo Emergenza Urgenza rilevazione effettuata utilizzando il questionario
regionale relativo alle aree di diagnostica, opportunamente adattato (n=280 questionari
raccolti).
UO Immunoematologia e Medicina Trasfusionale, realizzazione di un’indagine costruita ad hoc
rivolta ai Donatori (n=499 questionari raccolti) e ai Pazienti sottoposti ad autotrasfusione e
pazienti afferenti all’ambulatorio di Medicina Trasfusionale (n=39 questionari).
- Qualità Percepita del Servizio di Ristorazione all’interno del Nuovo Ospedale del Bambino (n=82
questionari).
118
Curare la relazione per prendersi cura della persona (progetto per
l’impiego di volontari in servizio civile in Italia)
Il progetto per i giovani di servizio civile fa parte di in un disegno più ampio in cui sono previste una serie
di attività formative e organizzative che si propongono di ridurre e limitare gli elementi spersonalizzanti
del luogo di cura inteso in senso classico con una precipua attenzione agli elementi di “umanizzazione”.
Tale prospettiva muove dal ripensamento del concetto stesso di salute che tiene in considerazione gli
aspetti di carattere squisitamente fisico, ma anche quelli psicologici e sociali, riconoscendo che gli uni
condizionano fortemente gli altri in un intreccio, connubio inscindibile.
Fra le diverse iniziative realizzate in Azienda che riguardano appunto la relazione, si portano due esempi
relativi agli anni 2011 e 2012, il primo è il Master denominato “Management in comunicazioni e relazioni
in ambito socio-sanitario”, rivolto ai professionisti della salute, il secondo: “L’umanizzazione delle cure
attraverso le Terapie Intensive aperte”.
Per quanto riguarda la Medicina Narrativa sono stati promossi dal 2012 - 2014 i seguenti progetti:
“Sperimentare la narrazione nell’accertamento infermieristico: un progetto di formazione e ricerca presso
l’U.O. L.I.D.I.” rivolto a tutti i professionisti afferenti all’U.O.; “Il nursing narrativo in Emodialisi: principali
problematiche per il professionista”, rivolto a tutti i professionisti dell’Emodialisi; e il progetto praticoformativo “Pratica Narrativa e qualità dei percorsi di cura” rivolto a tutti i professionisti sanitari dell’Ente.
Lo scopo di queste iniziative e delle altre in corso è quello di sensibilizzare circa il valore terapeutico della
relazione, attraverso l’acquisizione di competenze e abilità spendibili nell’esercizio quotidiano
professionale.
Il progetto di servizio civile “Curare la relazione per prendersi cura della persona” parte da riflessioni su
un luogo di cura come il Dipartimento Medico Geriatrico Riabilitativo, dove la relazione ha particolare
valore e significato, sia per le caratteristiche dell’utenza (particolarmente fragile e sempre più numerosa)
119
3. Obiettivi istituzionali e strategie aziendali
Interventi in fase di sviluppo o in corso
Eventuali problematiche riscontrate
Nel corso del 2013 l’Azienda ha partecipato ai lavori È in definizione il nuovo protocollo metodologico
dell'Agenzia Sanitaria e Sociale Regionale (ASSR) - Regionale (comprensivo della valutazione della
Area Comunità, Equità e Partecipazione, aderendo:
Responsiveness).
- allo studio pilota per la validazione del Protocollo
Metodologico Regionale di rilevazione della
Qualità Percepita sul Percorso Senologico che sarà
condotto nel biennio 2014-2015;
- a una ricerca, promossa da Agenzia Nazionale per
i servizi sanitari regionali (Agenas) e dalla
Agenzia sanitaria e sociale regionale EmiliaRomagna (Assr), finalizzata a considerare il punto
di
vista
degli
utenti/cittadini,
grazie
al
coinvolgimento attivo dei Comitati Consultivi Misti
Aziendali, per valutare la qualità dei servizi di
degenza della regione attraverso l’uso della
“Check List per la valutazione del grado di
umanizzazione delle strutture di ricovero”.
L’iniziativa, in linea con il protocollo metodologico,
è stata realizzata nei primi mesi del 2014, grazie
alla partecipazione attiva dei professionisti del
Dipartimento
Materno
Infantile
e
dei
rappresentanti del Comitato Consultivo Misto
(n=12).
Note o approfondimenti
Il 17 aprile 2013 presso l’ASSR si è tenuto l'incontro di presentazione delle esperienze di rilevazione
della Qualità Percepita nelle degenze della Regione Emilia - Romagna nel triennio 2010 - 2012 dal titolo
“La qualità percepita nei servizi di degenza. Potenzialità informative e confronto con altri modelli
internazionali”. Per l'Area Vasta Emilia Nord l'AOUPR è stata chiamata a presentare i risultati del
proprio modello Aziendale.
Il 12 giugno 2013 è stato realizzato un evento formativo interno accreditato ECM dal titolo “La Qualità
Percepita nell’Azienda Ospedaliero - Universitaria di Parma. Presentazione degli esiti e strategie di
miglioramento per la realizzazione del Progetto Regionale”, aperto a tutti i professionisti dell’Azienda.
L’evento ha permesso di dare spazio alle esperienze realizzate attraverso la metodologia di indagine
regionale nel corso del biennio 2010-2012 all’interno dell’Azienda ed ha potuto contare anche sulla
presenza dei Referenti Regionali.
3. Obiettivi istituzionali e strategie aziendali
sia per le condizioni specifiche del ricovero, che in genere è prolungato rispetto alla durata media dei
ricoveri nei reparti per acuti.
Con una certa frequenza, si tratta di utenti fragili e polipatologici, che si caratterizzano per la contestuale
presenza di più malattie cronico-degenerative, fragilità, disabilità, limitate riserve funzionali, depressione
(anche causata da isolamento sociale e solitudine) e minore capacità di recupero.
La noia e il senso di solitudine, che possono portare alla depressione, sono i grandi nemici del paziente
costretto a ricoveri prolungati, in particolare se anziano.
L’anziano ricoverato, in effetti, è spesso costretto a trascorrere molte ore a letto o in attesa, con poco da
fare. Mentre il paziente in riabilitazione trascorre lunghi periodi di ricovero, spesso scanditi dalle diverse
attività di riabilitazione che deve svolgere, che sono faticose non solo dal punto di vista fisico.
I volontari, una volta conosciuti i pazienti attraverso colloqui quotidiani, propongono diverse attività
consistenti essenzialmente nell’ascolto, nel dialogo, nella lettura a voce alta di riviste o libri, nell’ascolto
di musica, nella visione di film e attività ludiche di gruppo come il gioco delle carte o della tombola. Le
attività dei giovani, quando possibile, vengono svolte in piccoli gruppi per promuovere la socializzazione e
inserendosi in maniera armonica nelle attività assistenziali. L’attività formativa sui volontari, svolta
all’inizio del progetto e in itinere, si propone di preparare gli stessi al debutto e alla permanenza nelle
unità di cura e all’acquisizione di conoscenze e abilità da spendere nella relazione con gli anziani
ricoverati. Per ogni anziano preso in carico, il volontario stila un Piano di Sostegno Relazionale
Personalizzato scritto, che viene aggiornato nel tempo; lo scopo è quello di rilevare:
• i bisogni relazionali attraverso un colloquio narrativo,
• gli obiettivi da raggiungere rispetto ai bisogni relazionali rilevati,
• la pianificazione delle azioni che si sarebbero svolte,
• la valutazione in itinere e finale dei risultati raggiunti.
L’influenza dell’ambiente, come numerosi studi hanno provato, evidenzia che, se adeguato, può rivelarsi
come strategicamente terapeutico per il benessere psichico e il recupero della persona ricoverata e
questo è vero, soprattutto, se l’ambiente offre un supporto relazionale continuativo, adeguato e
soddisfacente.
Il valore della partecipazione alla vita sociale e la cura della relazione nell’anziano è riconosciuto anche
dalla Carta europea dei diritti e delle responsabilità degli anziani bisognosi di assistenza e di cure a lungo
termine (Progetto Eustacea, Programma Daphne III, novembre 2010) che all’articolo 6 dichiara:
“Qualora nell’invecchiamento ti trovi a dover dipendere dall’aiuto e dalla cura di altri, permane il diritto ad
interagire con gli altri…..”
Il Progetto si propone di “curare” la relazione e superare il senso di solitudine attraverso l’azione dei
volontari in servizio civile, in continuità con l’esperienza del bando 2011 e con l’esperienza del progetto
2012 attualmente in corso.
Il progetto parte dall’assunto che i giovani che svolgono il servizio civile sono una potenziale e preziosa
risorsa e se questi sono inseriti in un percorso organizzativo strutturato che prevede formazione,
sensibilizzazione e supporto, durante tutta l’esperienza di volontariato, possono rivelarsi strategici e
determinanti per il superamento della solitudine dell’anziano ricoverato. Rispetto a questo assunto il
progetto ha dato positivi riscontri. In particolare, riflettendo sui sentimenti che sono stati riportati dai
volontari, che hanno svolto la loro esperienza di servizio civile presso l’Azienda, possiamo ritenere che
questa esperienza abbia promosso nei giovani crescita personale ricca, seppur in un contesto difficile e
doloroso come è ineludibilmente quello di un ospedale.
Health literacy e buone pratiche di comunicazione
Lo sviluppo e la disseminazione di competenze di comunicazione adeguate alla Health literacy degli
utenti e dei familiari implica un cambiamento culturale importante, che richiede tempo e un’azione di
divulgazione che parte dai professionisti coinvolti nelle giornate formative regionali.
Il progetto Health literacy intende favorire la comprensione dell’utente attraverso una chiarezza del
linguaggio scritto e parlato, nonché sensibilizzare i professionisti sanitari e diffondere i principi e la pratica
della HL nella relazione tra gli operatori e gli assistiti e nella redazione di materiale informativo. Nel
percorso formativo il professionista è stimolato a riconoscere, promuovere e sostenere la capacità dei
pazienti di ottenere, processare e capire informazioni sanitarie e di cura necessarie per prendere decisioni
sanitarie appropriate e soprattutto più consapevoli e partecipate
Nel corso del 2013, è stato realizzato un percorso formativo, in due edizioni (8 ore per edizione), che ha
coinvolto personale dell’Oncologia degenza e DH Oncologico per un totale di 30 professionisti formati.
Ogni edizione era rivolta agli operatori dell’UO Oncologia Medica.
120
Inoltre, è stata effettuata una revisione della documentazione rivolta ai pazienti che ha riguardato Schede
terapie domiciliari, Carta accoglienza e Preparazione alla colonscopia, con il coinvolgimento di infermieri
e medici della UO Oncologia medica e raccogliendo le segnalazioni pervenute da pazienti e familiari che
hanno costituito il punto di partenza per l’analisi e la revisione dei materiali.
Per quanto concerne il percorso formativo è stato rilevato un alto gradimento e interesse per l’iniziativa,
tuttavia la ricaduta sulle competenze agite ovviamente deve essere valutata su un periodo di tempo più
esteso, considerando peraltro che il progetto è tutt’ora in corso.
Valorizzare le Buone Pratiche di comunicazione
Interventi in fase di sviluppo o in corso
Eventuali problematiche riscontrate
L’evoluzione del progetto potrà permettere il Gli strumenti già diffusi nel sito internet
confronto tra i professionisti sugli strumenti elaborati aziendale sono considerati già validati e
e validati per l’adozione di azioni di miglioramento. pertanto non sono stati inviati dai professionisti
L’esperienza, presentata in fase di lancio al Comitato in adesione all’iniziativa di raccolta.
Consultivo Misto dell’Azienda (espressione della
rappresentanza dei Cittadini), nel corso del 2014
verrà ulteriormente valorizzata in tale sede al fine di
promuovere una pratica aziendale consolidata a
sostegno dell’impegno dei professionisti nella
promozione della Health Literacy.
Note o approfondimenti
In occasione della XXII Conferenza Internazionale tenutasi a Barcellona (23-25 aprile 2014) promossa
dalla rete Health Promoting Hospital dell'Organizzazione Mondiale della Sanità è stata presentata
l’esperienza “Dalla raccolta alla diffusione delle buone pratiche di Health Literacy dell’Azienda
Ospedaliero-Universitaria di Parma” (From collection to diffusion of good practices of Health Literacy
into the University Hospital of Parma).
Consolidare i processi di cure palliative e di terapia del dolore
L’Azienda Ospedaliero-Universitaria di Parma, in coerenza con i dettami della legge del 15 marzo 2010
n. 38 “Disposizioni per garantire l’accesso alle cure palliative e alla terapia del dolore”, ha definito un
approccio per la lotta contro il dolore con l’intento di far diventare la gestione del dolore parte
integrante della cura.
121
3. Obiettivi istituzionali e strategie aziendali
Sono sempre più numerose le iniziative promosse dai professionisti per creare e diffondere strumenti
informativi/comunicativi quali brochure, poster illustrativi, eccetera. Tali strumenti sono consegnati a
pazienti e/o familiari al fine di garantire uno scambio di informazioni efficace per la qualità e la
sicurezza dei processi clinico – assistenziali.
L’Azienda, in collaborazione con il Comitato Consultivo Misto, ha aperto un’iniziativa rivolta a tutte le
Strutture e i professionisti in essa operanti per raccogliere tutti gli strumenti comunicativi, editi a
stampa o su altri formati, in uso e finalizzati al passaggio di informazioni a pazienti e/o familiari.
Obiettivi dell’iniziativa sono stati:
Garantire una prima mappatura aziendale delle iniziative di informazione/educazione sanitaria
di pazienti e/o familiari promosse e agite dai professionisti nelle diverse Strutture.
Valorizzare le iniziative e gli sforzi dei professionisti volti a promuovere Health Literacy.
Valutare e validare gli strumenti forniti ai pazienti e/o familiari.
- Promuovere l’ulteriore diffusione/pubblicazione degli strumenti attraverso il sito Internet e
Intranet dell’Azienda.
Risultati raggiunti
All’iniziativa hanno risposto 29 Strutture (circa 1/3 delle Strutture dell’Azienda e l’82% dei
Dipartimenti) che hanno presentato 49 strumenti. Fra gli strumenti raccolti il 51% fornisce informazioni
utili all’accesso alle strutture/servizi, mentre il 49% ha promosso educazione sanitaria per pazienti e/o
familiari (ad es. su patologie specifiche, fasi clinico/assistenziali, stili di vita sani, eccetera). La
trasmissione delle iniziative, in molti casi, ha permesso la revisione di strumenti e l’avvio di alcuni
progetti di miglioramento che hanno anche previsto il diretto coinvolgimento dei pazienti nella fase di
valutazione.
3. Obiettivi istituzionali e strategie aziendali
Risultati raggiunti
La gestione del dolore richiede l'ascolto, il dialogo, il rispetto per l'individuo e la sua sofferenza e
richiede che ogni professionista sanitario porti uno sguardo attento sulla salute dell’«altro».
Quest’approccio pone la persona malata al centro della cura e della relazione terapeutica basata su un
vero e proprio lavoro di squadra in cui ognuno porta le proprie competenze per l'identificazione, la
valutazione, il monitoraggio e il trattamento del dolore. A ragione di tanto l’Azienda, individuata come
centro hub per il trattamento del dolore, mirando a migliorare il sollievo nei pazienti ospedalizzati, ha
implementato il Foglio Unico di Terapia - Terapia del Dolore (FUT) concretizzato da gruppi
interdisciplinari dipartimentali e, per incoraggiare i propri professionisti a fare ogni sforzo per
ottimizzare la gestione del dolore, ha costituito una rete interaziendale di organizzazione e gestione del
paziente con dolore cronico. Nondimeno per essere efficace, predetto approccio deve consolidarsi nel
tempo e richiede per tutto il personale sanitario (medici e infermieri) il regolare aggiornamento delle
conoscenze. In tale prospettiva, già dall’anno accademico 2011/2012, l’Azienda Ospedaliera, con
l’intento di comprovare il costante impegno a riconoscere il dolore come problema prioritario, insieme
con l’Università degli Studi di Parma, ha attivato due Master universitari di I livello, della durata di un
anno, in “Cure palliative e terapia del dolore”, uno indirizzato alle professioni sanitarie e l’altro al
personale medico.
I master, di durata annuale, intendono contribuire alla formazione di figure professionali per
incrementare sia la conoscenza che il senso di responsabilità nella gestione del dolore dacché questi
ultimi sono significativamente correlati alla conoscenza della politica di gestione del dolore da parte
dell'organizzazione e le cui implicazioni per la pratica comportano una più profonda comprensione e un
miglioramento nella gestione del dolore.
Più precisamente essi hanno l’obiettivo di: far acquisire competenze professionali specifiche sulle
tematiche relative alla Medicina Palliativa e alla Terapia del Dolore; far maturare conoscenze per
garantire l'assistenza e la cura del malato con dolore acuto, cronico, o durante la fase terminale della
sua vita, con elevata qualità assistenziale. I professionisti formati saranno in grado di lavorare in
équipe multidisciplinari, interagendo con i Servizi Socio-Sanitari pubblici e privati, profit e no profit sia
ospedalieri sia sul territorio; per tutta la durata dei corsi tempereranno le capacità di interazione con il
gruppo professionale multidisciplinare per il conseguimento di una risposta multidimensionale della
patologia dolorosa, concorrendo alla realizzazione di percorsi assistenziali integrati e affinando le
competenze in materia etica.
Per incrementare sia la conoscenza sia il senso di responsabilità nella gestione del dolore presso
l’Azienda sono già stati realizzati eventi formativi in più edizioni individuati come pomeriggi formativi
rivolti a tutti gli operatori delle diverse UU.OO. dei Dipartimenti Medico polispecialistico e Geriatricoriabilitativo.
A far tempo dal mese di Novembre 2012 preso la Azienda è attivo il percorso parto-analgesia inteso
come strumento tecnico che la moderna medicina mette a disposizione e come aiuto che l’Azienda offre
per determinare una libera scelta e per contribuire a realizzare, con la sedazione del dolore, un
maggior grado di consapevolezza e partecipazione all’evento nascita da parte della donna.
Allo scopo di diffondere la cultura del sollievo presso l’opinione pubblica e gli operatori sanitari, la
nostra Azienda nell’anno 2013 ha, come sempre, aderito alla campagna di sensibilizzazione e
comunicazione, organizzando, in concomitanza della giornata nazionale del sollievo, eventi per la
cittadinanza con la specifica finalità di fornire informazioni sulla normativa vigente in materia di
disposizioni per garantire l’accesso alle cure palliative e alla terapia del dolore e chiarimenti in merito al
dolore oncologico e non, al dolore acuto e cronico, al dolore cardiologico, al dolore in soggetti affetti da
disturbi cognitivi nonché del parto indolore, offrendo altresì alla cittadinanza la possibilità di visitare la
struttura aziendale ad alta specializzazione di terapia antalgica.
122
3.4 Qualità dell'assistenza ed efficienza gestionale
Sicurezza delle cure e qualità
Gestione del rischio
Il Piano Programma per la gestione del rischio 2013 è stato redatto per promuovere l’analisi dei dati
provenienti dai vari sistemi aziendali propri della gestione del rischio e promuovere la cultura della
sicurezza nei Dipartimenti dell’Azienda.
L’Azienda Ospedaliero-Universitaria di Parma promuove la ricerca del miglioramento continuo della
qualità dell’assistenza e si prefigge di supportare lo sviluppo del governo clinico, finalizzato
all’erogazione di elevati livelli di prestazioni, espressione dell’eccellenza professionale, clinica,
organizzativa attraverso un’attenzione concreta e specifica alla sicurezza e allo sviluppo di una cultura
professionale positiva, orientata all’apprendimento dall’errore, alla prevenzione, all’adozione di buone
pratiche tecnico-professionali nei vari ambiti prestazionali.
Risultati raggiunti
Nel corso del 2013, anche sulla base delle indicazioni redatte e diffuse dall’ASSR Area Valutazione, è
stato predisposto il primo “Piano Programma Gestione del Rischio - il Sistema di Segnalazione
Aziendale per la Sicurezza e la Gestione del Rischio”, condiviso con il Collegio di Direzione. Il Piano
programma è stato quindi diffuso ai Dipartimenti e a tutte le articolazioni organizzative dell’Azienda. Il
Piano Programma Gestione del Rischio dell’Azienda Ospedaliero-Universitaria di Parma è stato redatto
con il contribuito attivo di diversi Servizi Aziendali.
Il Piano Programma vuole essere un primo contributo per il Collegio di Direzione, le Strutture e i Servizi
dell’Azienda per avere una visione più completa della gestione del rischio e quindi dei pericoli e delle
azioni protettive e di contenimento degli eventi.
Le metodologie utilizzate sono state:
Analisi dei dati relativi ai principali fenomeni in cui è previsto un sistema di segnalazione
aziendale e confrontati, laddove presenti, con i dati provenienti dai sistemi Regionali.
Lettura dei dati aziendali, effettuata anche mediante il confronto con gli indicatori regionali,
oltre che con le Buone Pratiche Regionali e Nazionali.
Al fine di facilitare la diffusione delle informazioni relative alle principali aree di intervento della
gestione del rischio e ai correlati obiettivi annuali riportati in tale documento, anche questo
elaborato è presente nella pagina Intranet: Direzione>GovernoClinico>GestionedelRischio.
Interventi in fase di sviluppo o in corso
Nel corso del 2014 dovrà essere implementato il Sistema Aziendale di Valutazione con il contributo del
Nucleo Strategico Aziendale e con il programma per il controllo delle ICA e ATB.
Note o approfondimenti
L’esperienza è stata inoltre valutata come Buona Pratica Potenziale da parte dell’Osservatorio Buone
Pratiche per la Sicurezza dei Pazienti AGENAS. L’iniziativa infatti è stata sottoposta alla valutazione
mentre i dati relativi all’AUDIT non erano ancora ultimati; per l’anno 2014 l’iniziativa potrà essere
sottoposta a nuova valutazione.
Consolidare la cultura della gestione del rischio fra i professionisti - Cadute
Le cadute sono un problema di Salute Pubblica a livello mondiale. L’ospedalizzazione aumenta il rischio
di caduta a causa dell’ambiente non familiare, dello stato patologico e dei trattamenti ricevuti.
Approssimativamente la letteratura indica che dal 2% al 12% dei pazienti cadono almeno una volta in
ospedale. La prevenzione delle cadute rappresenta un tema della gestione del rischio sul quale è alta
l’attenzione sia a livello nazionale (Raccomandazione n. 13 Ministero Salute 2012) che a livello
Regionale (2° evento segnalato nelle schede generali e 1° evento segnalato per gravità) che ha
attivato un progetto di “rete” per il confronto delle esperienze realizzate dalle Aziende Sanitarie della
Regione Emilia Romagna.
123
3. Obiettivi istituzionali e strategie aziendali
Consolidare la cultura della gestione del rischio fra i professionisti
Risultati raggiunti
Già a partire dal 2012, anche a seguito dell’attivazione del Gruppo di lavoro Multiprofessionale
“Prevenzione Cadute”, si è giunti alla definizione di uno strumento per il monitoraggio del fenomeno in
Azienda: Scheda Cadute-Incident Reporting.
Lo strumento distribuito alle Strutture nell’agosto 2012 ha permesso di poter effettuare una prima
lettura del “fenomeno caduta” nella nostra Azienda (6 mesi di rilevazione). Nel Piano Programma un
capitolo è stato dedicato alla prevenzione del fenomeno caduta e all’analisi dei dati relativi al primo
periodo di osservazione.
Nel corso del 2013 sono stati elaborati i dati del I Semestre 2013, i dati sono stati diffusi e
successivamente pubblicati nella pagina Intranet Aziendale della Gestione del Rischio.
Le Schede Caduta-Incident Reporting dell’Azienda del 2013 sono stati redatti dai professionisti in modo
trasparente e agiti singolarmente nell’ottica della ricerca del miglioramento delle prestazioni (N=295).
Il Report Aziendale Cadute relativo all’anno 2013 è stato trasmesso e successivamente inserito nella
pagina Intranet della Gestione del Rischio.
A riprova del fatto che il progetto è stato positivamente riconosciuto da professionisti, sono pervenute
numerose segnalazioni descrittive di cadute senza gravi conseguenze, questo dimostra un buon
impegno a monitorare il fenomeno.
Interventi in fase di sviluppo o in corso
Dal sistema di segnalazione aziendale possono e devono essere messe in rilevo le Azioni di
Miglioramento di Struttura di Dipartimento o di Azienda (utilizzo del Format Aziendale “Azioni di
Miglioramento” correlato alla procedura P004AOUPR Gestione delle Azioni Correttive, Preventive e di
Miglioramento).
Nel corso del 2014 la promozione dello sviluppo del sistema di gestione del rischio avrà come focus le
azioni di miglioramento.
Note o approfondimenti
Questa esperienza è stata presentata a livello regionale e ha contribuito alla definizione di buone prassi
regionali e nazionali e internazionali (AGENAS 2012; FIASO, 2013; 22° Conferenza Internazionale HPH
– Ospedali per la Promozione della Salute – World Health Organization, Barcellona 2014).
3. Obiettivi istituzionali e strategie aziendali
Supporto ai professionisti nell’apprendimento tecniche gestione del rischio
La Gestione del Rischio si avvale dello strumento formazione per condividere le finalità, le metodologie
e gli indicatori di verifica delle azioni messe in campo per la sicurezza dei pazienti, degli operatori e
dell’Azienda.
In linea con la programmazione regionale e aziendale nel 2013 è stato prodotto un Programma Annuale
per la Gestione del Rischio che è stato poi inserito nel Piano Aziendale della Formazione 2013.
Risultati raggiunti
I principali interventi formativi/informativi condotti nel 2013 sono stati rivolti al sistema di segnalazione
aziendale Incident Reporting, alla Prevenzione della Morte Materna (Raccomandazione Ministero Salute
n 6 Prevenzione della morte materna correlata al travaglio e/o parto), alla implementazione in Azienda
dello Strumento Significant Event Audit, alla prevenzione del fenomeno cadute. In particolare le
principali iniziative aziendali sono state le seguenti:
- Gestione del rischio: dall’Incident Reporting alle Azioni di Miglioramento (6 edizioni 2013, crediti
ECM, 208 professionisti).
- Gestione del rischio: Eventi critici & Significant Event Audit (una edizione 2013, crediti ECM, 35
professionisti).
- Governo clinico Gestione del rischio-Raccomandazioni Ministeriali - Il fenomeno cadute in ospedale
(2 edizioni 2013, crediti ECM, 107 professionisti).
- La Mortalità Materna in Italia e il modello di sorveglianza dell'ISS, il protocollo operativo (2 edizioni
2013, crediti ECM, 40 professionisti).
Numerose sono state le iniziative esterne in cui sono stati presentati i lavori realizzati in Azienda con i
professionisti di volta in volta interessati. Tra queste si citano:
- Dal sistema di sicurezza delle Sale Operatorie al Piano Programma Aziendale - Arezzo 8° Forum Risk
Management in Sanità (26 -29 Novembre 2013), promosso dal Ministero della Salute, dall’Istituto
Superiore di Sanità, dalla Regione Toscana, dalla Fondazione Sicurezza in Sanità, con il patrocinio
della Conferenza delle Regioni e delle Province Autonome.
- Monitoraggio epidemiologico di reazioni ed eventi avversi da farmaci in pronto soccorso (Mereafaps)
nell'Azienda Ospedaliero-Universitaria di Parma - 17-20 Ottobre 2013, Torino. XXXIV Congresso
Nazionale 2013 "Progettare insieme il futuro tra continuità e cambiamento: sanità, professioni e
cittadini" promosso dalla SIFO.
Interventi in fase di sviluppo o in corso
Nel mese di gennaio 2014 in linea con il “Piano Programma Gestione del Rischio - il Sistema di
Segnalazione Aziendale per la Sicurezza e la Gestione del Rischio” è stato definito il nuovo Programma
Annuale per la Gestione del Rischio.
124
Partecipazione alle Call Nazionali e Internazionali sulle Buone Pratiche
Nel corso del 2013 l’Azienda ha inoltre nuovamente partecipato alla Call 2013 promossa
dall'Osservatorio Buone Pratiche per la Sicurezza dei Pazienti (AGENAS), presentando 3 esperienze:
1. Il Piano Programma per la Gestione del Rischio come occasione di integrazione dei flussi informativi
nell’Azienda Ospedaliero-Universitaria di Parma (giudicata Buona Pratica Potenziale);
2. Dalla ricognizione alla riconciliazione farmacologica: la validazione di una scheda la prescrizione
sicura della terapia farmacologia (giudicata Buona Pratica Potenziale);
3. Qualità e sicurezza delle cure in ambito oncoematologico: il Progetto UMaCA nell’Azienda
Ospedaliero-Universitaria di Parma (giudicata Buona Pratica).
Infine, l’Azienda ha partecipato alla 21st International Conference on Health Promoting Hospitals and
Health Services (HPH), promosso dalla rete HPH dell' Organizzazione Mondiale della Sanità (WHO)
presentando due importanti esperienze aziendali:
1. Dose reduction strategies in pediatric CT examinations (Ottimizzazione degli esami TC pediatrici del
distretto corpo)
2. Empowerment of professionals in organizational network, in order to promote healthcare safety in
the Teaching - Hospital of Parma (Empowerment dei professionisti nella rete organizzativa per la
promozione della sicurezza delle cure nell'Azienda Ospedaliero -Universitaria di Parma).
Interventi in fase di sviluppo o in corso
Nel corso del 2013 l’esperienza “Qualità e sicurezza delle cure in ambito oncoematologico: il Progetto
UMaCA nell'Azienda Ospedaliero-Universitaria di Parma” è stata valutata come Buona Pratica (giudicata
dall’Osservatorio Buone Pratiche - AGENAS, mediante le linee guida SQUIRE). L’esperienza è stata
inoltre selezionata nell'ambito del sistema Joint Action PaSQ (www.pasq.eu <http://www.pasq.eu>)
per essere condivisa tra i Paesi Europei delle buone pratiche per la sicurezza dei pazienti.
Le Buone Pratiche valutate come “potenziali” da Agenas potranno essere sottoposte ad una nuova
valutazione da parte dell’Osservatorio nel corso del 2014-2015: sarà infatti possibile aggiornare e/o
integrare la documentazione relativa alle esperienze già contenute nel database dell'Osservatorio così
da consentire la piena e completa comprensione delle esperienze realizzate e dei risultati conseguiti.
Ricognizione come premessa alla prescrizione
La conoscenza puntuale della terapia farmacologica corrente del paziente costituisce un passaggio
fondamentale a garanzia della sicurezza nella prescrizione dei medicinali e della conseguente
appropriatezza delle cure. La ricognizione farmacologica è un processo sistematico eseguito dal
125
3. Obiettivi istituzionali e strategie aziendali
Obiettivi:
o promuovere e divulgare le esperienze di miglioramento della sicurezza dei pazienti ampliando la
base di conoscenza dell'archivio web disponibile per la consultazione sul sito dell'Agenas,
o favorire il monitoraggio regionale delle buone pratiche per la sicurezza dei pazienti,
o promuovere e favorire il trasferimento delle buone pratiche sulla sicurezza e sulla promozione della
salute,
o promuovere azioni volte a diffondere la cultura dell'autovalutazione e della valutazione esterna
della qualità, della sicurezza e della promozione della salute,
o informare i cittadini/pazienti in merito alle iniziative attivate sul territorio nazionale e
internazionale, nonché sulla localizzazione e l'impatto di esse.
Risultati raggiunti
Nel corso del 2013 l’Azienda ha aderito alla Call promossa dall’Osservatorio FIASO “Pratiche di Buona
Sanità”. Delle 75 esperienze italiane selezionate dall'Osservatorio per essere pubblicate da FIASO nel
Libro Bianco 2013, 7 esperienze sono dell'Azienda Ospedaliero-Universitaria di Parma.
Le sette esperienze selezionate dall’Osservatorio sono state:
1. PDTA integrati come strumento di Governo Clinico per il miglioramento della Qualità dell’assistenza;
2. Applicazione del braccialetto identificativo al paziente degente nell'Azienda OspedalieroUniversitaria di Parma;
3. Sistema di Segnalazione e Prevenzione delle Cadute accidentali nell'Azienda OspedalieroUniversitaria di Parma;
4. Strategia di riduzione della dose erogata in esami TC pediatrici;
5. Tecniche e strumenti del Metodo Lean applicate ai processi diagnostici in Medicina Nucleare;
6. Migliorare le sicurezza del processo di dimissione dall'Ospedale al Territorio del paziente anziano –
la check-list “Dimissione del paziente;
7. Collegamento in Rete dei Centri Emofilia e Network con i Pronto Soccorso della Regione EmiliaRomagna.
Proprio quest’ultima esperienza, unica in Italia, oltre ad essere selezionata per essere pubblicata
all’interno del Libro Bianco 2013 come le restanti, è stata ulteriormente valorizzata grazie alla
“segnalazione di merito” (Libro Bianco della Sanità, 2013, pag. 206). Il Libro Bianco è stato presentato
il 10 Dicembre 2013 presso l’Ara Pacis Augustae a Roma.
personale sanitario che consiste nella raccolta di informazioni complete e accurate su farmaci e altri
prodotti (anche non convenzionali) assunti dal paziente.
La riconciliazione è il processo nell’ambito del quale si confrontano i farmaci assunti dal paziente, così
come evidenziati nella Ricognizione, con quelli indicati per la cura nella particolare circostanza, in
funzione di una decisione prescrittiva corretta e sicura. Ricognizione e riconciliazione sono attività
cliniche importanti, centrate sul paziente, che precedono la prescrizione. La nuova prescrizione o le
eventuali modifiche dei trattamenti precedenti, conseguenti alla Riconciliazione, devono essere
documentate e comunicate ai soggetti interessati e coinvolti nel processo di cura.
Già a partire dal 2010 l’Azienda Ospedaliero-Universitaria ha svolto un’indagine attraverso la
somministrazione di un questionario rivolto ai Coordinatori, volto ad esplorare le procedure seguite
nelle UU.OO. e valutare quanto queste si avvicinassero effettivamente alle indicazioni contenute nella
Raccomandazione regionale “Sicurezza nella terapia farmacologica: la Ricognizione premessa alla
Prescrizione”.
L’indagine ha evidenziato che molte informazioni erano rilevate, ma non in modo omogeneo. Gli
strumenti utilizzati per la ricognizione erano numerosi e non strutturati; la ricognizione era svolta
prevalentemente da più operatori con l’utilizzo di più di uno strumento, determinando sovrapposizioni,
ridondanze e rischi.
Risultati raggiunti
A partire dal 2011 una nuova scheda aziendale é stata diffusa in tutta l’Azienda.
Da aprile 2013, in occasione del “Programma AUDIT Clinici nell’ambito della Sicurezza nella Gestione
Clinica dei Farmaci”, promosso dalla ASSR Emilia Romagna, l’AOUPR ha condiviso con i professionisti
un progetto di verifica del processo di ricognizione-riconciliazione farmacologica per una prescrizione
corretta e sicura.
I professionisti dell’Azienda, dopo aver collaborato alla redazione e diffusione di una scheda unica
aziendale per la ricognizione-riconciliazione si sono appropriati della metodica Audit Clinico, come
strumento di verifica per la definizione di ulteriori azioni di miglioramento.
3. Obiettivi istituzionali e strategie aziendali
Interventi in fase di sviluppo o in corso
Un possibile sviluppo rispetto all’applicazione
della ricognizione farmacologica è che questa
potrà essere estesa, oltre che al maggior
numero di strutture di ricovero, anche alle
strutture territoriali delle Aziende sanitarie.
Eventuali problematiche riscontrate
L’Audit ha verificato che l’89,2% del totale delle
Cartelle Cliniche (CC) analizzate (n=232) dispone
della la scheda (si consideri che l’assenza della
scheda è stata rilevata fra le CC di una sola
struttura).
Note o approfondimenti
L'esperienza dell'Azienda è stata presentata in occasione del Workshop Internazionale, promosso dalla
Agenzia Sanitaria e Sociale Regionale, “Per la sicurezza dei pazienti - Patient Safety Practices” tenutosi
a Bologna il 9 settembre 2013.
L’esperienza è stata valutata come Buona Pratica Potenziale da parte L’Osservatorio Buone Pratiche per
la Sicurezza dei Pazienti AGENAS. L’iniziativa infatti è stata sottoposta alla valutazione mentre i dati
relativi all’AUDIT non erano ancora ultimati; per l’anno 2014 l’iniziativa potrà essere sottoposta a
nuova valutazione.
Gestione del contenzioso
Al fine di perseguire gli obiettivi di prevenire il verificarsi di un danno (cure sicure), di prevenire il
ricorso alla soluzione legale delle vertenze e di assicurare una compensazione rapida ed equa ai
danneggiati, la Regione Emilia-Romagna ha previsto l’introduzione della gestione diretta dei sinistri da
parte del Servizio sanitario regionale. La D.G.R. n. 1350/2012 “Approvazione del programma regionale
per la prevenzione degli eventi avversi e la copertura dei rischi derivanti da responsabilità civile nelle
aziende sanitarie” e la legge regionale n. 13 del 7 novembre 2012 “Norme per la copertura dei rischi
derivanti da responsabilità civile negli enti del servizio sanitario regionale“, nonché la Delibera di Giunta
Regionale n. 2079 del 23/12/2013, pongono direttamente in capo alle singole Aziende sanitarie e alla
Regione il compito di gestire il contenzioso e l’eventuale relativo risarcimento derivante da “eventi
avversi” in sanità, oggi, per lo più, ancora affidati alle compagnie di assicurazione.
La Regione ha provveduto a organizzare il servizio di gestione assicurativa dei rischi di responsabilità
civile prevedendo due fasce per la liquidazione del danno: 1) importi fino a € 250.000,00 di
competenza diretta delle Aziende Sanitarie; 2) importi oltre € 250.000,00.
Risultati raggiunti
L’avvio della gestione diretta del rischio assicurativo richiede l’adozione di nuove modalità organizzative
e sostanziali da parte di ogni Azienda, idonee a garantire la gestione diretta dei sinistri. In particolare,
la Regione individua la necessità della costituzione di un Comitato di valutazione dei sinistri, quale
organismo di primaria importanza nella procedura di negoziazione, così come previsto anche dalla nota
del 02/08/2012 del Direttore Generale Sanità e Politiche Sociale della Regione Emilia-Romagna che ha
fornito le prime indicazioni operative, procedurali e organizzative in merito.
126
L’Azienda Ospedaliero-Universitaria di Parma, già dotata di un Comitato di Valutazione dei Sinistri
(CVS) istituito con deliberazione n. 142 del 10.9.2007, ha provveduto a modificare (con deliberazione
n. 235 del 7.9.2012) la composizione del CVS al fine di adeguarla, tra l’altro, alle indicazioni regionali
per l’implementazione del Programma regionale di gestione diretta dei sinistri. L’indicazione della
Regione di dotarsi di un Medico Legale interno - in quanto essendo dipendente e conoscendo i
meccanismi organizzativi interni risulta in grado di gestire i casi con maggior cura rispetto ai consulenti
esterni – è già attuata dalla Azienda: tutta l’istruttoria medico legale, la valutazione del danno e la
produzione di relazioni medico legali calate nella realtà dell’Azienda sono seguite dai Medici del Settore
Medico Legale con possibilità di collaborare con i professionisti interessati.
Nell’ambito dell’attività di gestione del rischio assicurativo aziendale e nell’ottica dello sviluppo di una
cultura della sicurezza, l’Azienda ha emanato una circolare che ha stabilito compiti e responsabilità nei
processi di gestione del contenzioso dell’Azienda, con particolare riferimento alle fasi di apertura del
sinistro, di istruttoria documentale e valutazione medico-legale del sinistro, nonché di disamina del
caso in sede di Comitato Valutazione Sinistri. La procedura si rivolge e vede attivamente impegnati,
oltre al Settore Medico Legale e al Servizio Attività Giuridico Amministrativa aziendale, anche tutte le
strutture aziendali che siano luogo di accadimenti di incidenti ai pazienti nonché i singoli professionisti
interessati dall’evento.
Rischio infettivo e sorveglianza e controllo delle malattie infettive e
parassitarie
Nel vasto ed articolato panorama delle attività di gestione del rischio nelle strutture sanitarie, si
inserisce la prevenzione delle complicanze infettive correlabili alle pratiche assistenziali.
Le varie tematiche igienico-preventive, vengono sviluppate e realizzate nel rispetto degli obiettivi ed
indicazioni contenute nel Piano regionale di prevenzione, che sottolinea e conferma la necessità che
le strutture sanitarie consolidino programmi di sorveglianza e controllo delle infezioni correlate
all’assistenza in ambito nosocomiale, esplicitando specifici obiettivi riguardanti diverse tematiche:
programmi di gestione del rischio, attività di sorveglianza, progetti aziendali mirati a promuovere le
sicurezza in aree critiche (igiene delle mani, precauzioni d’isolamento, profilassi antibiotica
perioperatoria, eccetera).
Risultati raggiunti
In stretta sinergia con l’Agenzia Sanitaria e Sociale Regionale – Area Rischio Infettivo, che coordina la
rete dei Comitati di Controllo delle Infezioni (CIO) la nostra Azienda, tramite i propri Referenti, ha
partecipato in modo costante alle riunioni periodiche ed alle attività regionali poste in essere in tema di
prevenzione del rischio infettivo correlato ai processi di cura ed assistenza.
Si sono svolte con regolarità le riunioni del CIO (Comitato Infezioni Ospedaliere) aziendale: durante gli
incontri sono state trattate le tematiche di maggior rilievo e che richiedevano una valutazione collegiale
(strategie di attuazione, condivisione di percorsi e procedure, eccetera) rispetto alle azioni da
intraprendere.
Nel mese di aprile, l’uscita della D.G.R. 318/2013 “Linee di indirizzo alle Aziende Sanitarie per la
gestione del rischio infettivo: Infezioni Correlate all’Assistenza e uso responsabile degli antibiotici”, ha
determinato l’esigenza di ridefinire l’infrastruttura aziendale per il governo del rischio infettivo in ambito
assistenziale.
E’ stato realizzato un documento interno di indirizzo presentato, discusso ed approvato dal Collegio di
Direzione nel mese di luglio, all’interno del quale sono stati declinate le linee strategiche per il
raggiungimento degli obiettivi previsti nel documento di indirizzo ed individuate le componenti
professionali che costituiscono il Nucleo Strategico e dei Due Nuclei Operativi ICA (Infezioni Correlate
all’Assistenza) e ATB (Utilizzo appropriato Antibiotici).
Nelle Terapie Intensive (TI) aziendali, è proseguita l’attività di sorveglianza delle infezioni e la
partecipazione al “Monitoraggio delle Infezioni in reparti a rischio - SiTiER – Sorveglianza delle infezioni
in terapia intensiva”. La 1^ e 2^ Anestesia e Rianimazione, partecipano alla rilevazione, attraverso il
Progetto GiViTi - Gruppo Italiano di Valutazione degli Interventi in TI - Margherita, petalo infezioni,
coordinato dall’Istituto Mario Negri, che riconosce come obiettivo primario la raccolta sistematica dei
dati, tramite programma informatico Margherita Due, per la valutazione continua della performance
delle TI.
Nei reparti ad elevata complessità assistenziale, quali le TI e i CO, sono proseguiti i sopralluoghi volti a
monitorare le condizioni igieniche e di sicurezza ambientale, l’adeguatezza delle procedure in essere e il
rispetto delle modalità comportamentali da adottare all’interno dell’area critica.
E’ proseguita l’attività di prevenzione e controllo delle infezioni in endoscopia. Si è provveduto ad
implementare un programma di controllo qualità, che prevede la realizzazione sistematica (due volte
all’anno) di controlli microbiologici sulla strumentazione endoscopica utilizzata in Endoscopia Toracica.
127
3. Obiettivi istituzionali e strategie aziendali
Sorveglianza e controllo delle infezioni correlate all’assistenza
Inoltre, a seguito dell’introduzione di un nuovo disinfettante a base di acido peracetico, in sostituzione
della glutaraldeide per la disinfezione chimica dei broncoscopi in dotazione presso la 1^ e 2^
Rianimazione e dei fibroscopi utilizzati in ORL e Otoneurochirurgia (ambulatori e degenza), sono state
realizzate specifiche istruzioni operative ed effettuati alcuni incontri di formazione sul campo riguardanti
il reprocessing della strumentazione endoscopica, con particolare riguardo allo sviluppo di strategie per
migliorare la tracciabilità del processo.
Per quanto riguarda il grosso capitolo dell’impiego appropriato degli antibiotici, sono continuate le
attività di consulenza dei Medici Infettivologi (antimicrobical stewardship) nelle UU.OO. richiedenti per
supportare i Clinici nella scelta appropriata dei farmaci antimicrobici in corso di processi infettivi, unita
al monitoraggio dei consumi, effettuato dal Servizio di Farmacia, con particolare riguardo alle terapie
mirate a pazienti particolarmente a rischio ed all’appropriatezza prescrittiva delle molecole ad elevato
costo.
Interventi in fase di sviluppo o in corso
In linea con la D.G.R. 318/2013, nell’ambito delle riunioni del Nucleo Strategico è stata effettuata
l’analisi sullo “stato dell’arte” rispetto all’attuazione dei programmi di gestione del rischio infettivo a
livello locale e ridefiniti i programmi annuali di intervento in base alle priorità individuate, con mandato
a ciascun Nucleo Operativo (ICA e ATB) insediato, di realizzare le specifiche attività per il
raggiungimento/allineamento agli specifici obiettivi regionali previsti a medio e lungo termine. Sono
state realizzate diverse tabelle sinottiche che hanno preso in esame i vari aspetti declinati nella
precitata D.G.R.. Per ogni argomento sono state definite tempistiche e modalità di realizzazione.
Il Gruppo Operativo ICA ha il compito di proporre ed attuare le misure decise di gestione del rischio
infettivo per quanto concerne il controllo delle infezioni e di rendicontare sui risultati raggiunti.
Il Nucleo Operativo ATB ha il compito di proporre e attuare le misure di gestione del rischio infettivo per
quanto concerne le politiche aziendali di governo dell’uso responsabile degli antibiotici (antimicrobial
stewardship) e di rendicontare sui risultati raggiunti.
I due gruppi lavoreranno separatamente, ma dovrà essere garantita la costante collaborazione e
l’interscambio di informazioni, in modo da operare in modo costruttivo e sinergico.
E’ in fase di sviluppo un programma formativo ad hoc, rivolto ai Responsabili e Coordinatori delle
UU.OO., quali Referenti di UU.OO. in tema di prevenzione delle infezioni Correlate all’Assistenza ed
utilizzo appropriato degli antibiotici.
3. Obiettivi istituzionali e strategie aziendali
Prevenzione del rischio infettivo
In stretta sinergia con altre funzioni aziendali, è stato mantenuto il presidio delle tematiche antisepsi,
disinfezione e sterilizzazione, di rilevanza strategica in tema di prevenzione e controllo delle Infezioni
Correlate
Tali pratiche rappresentano momenti fondamentali di una buona pratica sanitaria, per l’ampio riflesso
che le stesse determinano sul fenomeno delle Infezioni Correlate all’Assistenza e sulla qualità
dell’assistenza erogata.
Com’è noto, la criticità dei pazienti trattati, la continua evoluzione della tecnologia sanitaria, la
presenza di microrganismi di particolare rilevanza epidemiologica, impongono un’attenzione costante
sui processi effettuati, a tutela degli aspetti igienici e di sicurezza correlati.
Risultati raggiunti
Anche quest’anno ampio spazio è stato lasciato alla realizzazione e diffusione di procedure ed istruzioni
operative condivise, al fine di uniformare i comportamenti tra le figure professionali coinvolte nei
processi clinico-assistenziali.
Di seguito si segnalano gli aspetti di maggiore rilievo affrontati:
o la richiesta di inserimento nell’attività assistenziale ed in situazioni codificate di salviettine preinumidite di clorexidina al 2% per l’igiene personale dei pazienti colonizzati/infetti da microrganismi
multidrug-resistent;
o l’introduzione dell’acido peracetico quale disinfettante ad alto livello per la disinfezione degli
endoscopi, con la realizzazione di specifiche istruzioni operative ed iniziative di formazione sul
campo degli operatori coinvolti nel ricondizionamento dei dispositivi medici;
o la realizzazione/revisione di diverse procedure ed istruzioni operative in essere nelle Unità
Operative afferenti al Dipartimento Nefrologico, al Centro Immunotrasfusionale e nel Dipartimento
Materno-infantile. In particolare si evidenzia la predisposizione di un’apposita procedura di lavoro
per la preparazione delle sacche di NPT (Nutrizione Parenterale Totale) in Neonatologia, realizzata
in collaborazione con il Servizio di Farmacia che tenesse conto dei cambiamenti avvenuti
(trasferimento all’interno del Nuovo Polo Pediatrico) e del nuovo sistema di lavoro (acquisizione di
un isolatore).
Nell’ambito delle gare per l’acquisizione di dispositivi medici, si è provveduto ad effettuare le
valutazioni sulla campionatura e sulla documentazione (schede tecniche, progetti di fornitura, eccetera)
presentate dalle varie ditte concorrenti, per la seguente tipologia di materiale:
TNT sterile destinato ai CO ed Ambulatori Chirurgici
Dispositivi per la valutazione dei corpi cavi (helix-test)
128
In tema di sicurezza igienica legata all’impiego di attrezzature sanitarie e dispositivi medici, si è
provveduto alla valutazione delle schede tecniche, relative alle attrezzature/presidi sanitari, sia di
nuova acquisizione, sia di impiego corrente, al fine di fornire indicazioni puntuali per il trattamento e
ricondizionamento, in relazione al rischio infettivo correlato all’impiego. L’attività si è sviluppata con la
realizzazione di protocolli operativi specifici. Da sottolineare la realizzazione delle istruzioni operative
per il trattamento di pulizia/disinfezione dei dispositivi di protezione individuale di protezione
dall’esposizione di radiazioni ionizzanti (es.: camici, eccetera).
Programma di promozione dell’igiene delle mani - Progetto “Clean care is
safety care”
L’impatto sulla salute delle infezioni correlate all’assistenza sanitaria (ICA) è enorme, con centinaia di
milioni di pazienti coinvolti a livello mondiale ogni anno. Queste infezioni concorrono a provocare
disabilità e morte nei pazienti, promuovono la resistenza agli antibiotici ed aumentano la spesa
sanitaria in modo non indifferente.
Da alcuni anni infatti l’OMS promuove una campagna mondiale “Clean Care is Safer Care”, sostenuta
anche dal Ministero della Salute in collaborazione con le Regioni, con l’obiettivo specifico di ridurre le
infezioni correlate all’assistenza, principalmente attraverso la promozione della corretta igiene delle
mani, ritenuta da tutta la letteratura di riferimento, misura di provata efficacia per la prevenzione della
trasmissione di potenziali patogeni durante i processi clinico-assistenziali.
A livello aziendale già da diversi anni è stato avviato un percorso a sostegno del Progetto, al fine di
accrescere la consapevolezza degli operatori sanitari per migliorare la qualità dell'assistenza e della
sicurezza dei pazienti.
Risultati raggiunti
In piena sintonia con la campagna di sensibilizzazione WHO SAVE LIVES - Clean your hands e gli
obiettivi regionali, anche nel corso del 2013 sono state realizzate diverse attività, tra cui:
ƒ
Monitoraggio dei consumi del gel idroalcolico per l’igiene delle mani, al fine di favorirne l’impiego
soprattutto nelle Strutture in cui i consumi sono risultati esigui.
ƒ
Verifica della compliance dell’igiene delle mani presso le UU.OO. aziendali, tramite l’esecuzione di
audit ripetuti secondo la metodica messa a punto dall’OMS, che hanno preso in considerazione i
seguenti aspetti:
percezione degli Operatori sanitari sull’igiene delle mani, tramite la somministrazione di
specifico questionario a quanti coinvolti nei processi clinico-assistenziali;
adesione alla pratica di igiene delle mani, tramite lo svolgimento di indagine osservazionale
durante l’esecuzione delle attività diagnostico-terapeutiche;
adeguatezza dei parametri strutturali ed organizzativi implementati in ogni singola U.O.
129
3. Obiettivi istituzionali e strategie aziendali
Per quanto riguarda la sterilizzazione dei presidi e strumenti sanitari in ambito ospedaliero, sono state
realizzate in particolare le seguenti iniziative volte a:
effettuare precisi controlli sulla qualità del materiale inviato alla sterilizzazione, con segnalazione
scritta delle “non conformita” alle UU.OO coinvolte nelle criticità rilevate,
curare la formazione sul campo di diversi operatori socio sanitari aziendali, realizzando brevi stage
presso la Centrale di Sterilizzazione, al fine di migliorare la gestione complessiva del processo di
ricondizionamento dei dispositivi medici di tipo riutilizzabile.
Interventi in fase di sviluppo o in corso
In tema di antisepsi:
•
è in fase di valutazione l’introduzione di confezioni monodose di clorexidina al 2% in soluzione
alcolica, quale antisettico per la cute in preparazione del sito di introduzione dei cateteri venosi
centrali e prima dell’esecuzione di emocolture,
•
è in approfondimento la tematica dell’antisepsi in ambito neonatale,
•
è in corso la revisione del materiale informativo destinato agli utilizzatori, in modo da mantenere
aggiornate le indicazioni d’uso ed i principi attivi impiegati in azienda, al fine di favorirne il corretto
impiego.
Per quanto riguarda la sterilizzazione:
•
valutazione, dal punto di vista organizzativo, della possibilità di introdurre il test di penetrazione
corpi cavi, quale controllo periodico a verifica della processo di sterilizzazione a vapore.
•
Realizzazione delle modalità di gestione delle “non conformità” rilevate sul materiale da sterilizzare,
con realizzazione di uno specifico modulo di segnalazione.
•
Aggiornamento dell’attuale sistema di rintracciabilità del materiale prodotto sterile (DM
riutilizzabili) tramite sostituzione del software specifico in dotazione.
•
Valutazione delle tempistiche di conservazione della documentazione comprovante l’avvenuta
sterilizzazione dei DM (fogli di lavoro, grafici delle macchine sterilizzatrici, eccetera) alla luce delle
normative vigenti.
3. Obiettivi istituzionali e strategie aziendali
La metodologia applicata si è dimostrata efficace in quanto il personale sanitario ha collaborato
attivamente, con un coinvolgimento importante anche in termini di rilevazione e individuazione
delle aree di miglioramento e nella predisposizione delle soluzioni operative ritenute efficaci.
L’analisi dei dati raccolti ha permesso di focalizzare le criticità esistenti:
necessità di una specifica informazione/formazione ai professionisti, soprattutto per quelli
ancora inseriti nei percorsi di formazione (Medici, Infermieri, OSS, eccetera);
miglioramento delle componenti gestionali ed organizzative legate all’Igiene delle mani;
coinvolgimento della leadership di ogni singola Struttura, al fine di sostenere le iniziative di
miglioramento nell’adesione alla pratica di igiene delle mani.
ƒ
In occasione della Giornata Mondiale dell’Igiene delle Mani (5-7 maggio) è stato dato ampio risalto
alla tematica preventiva con la divulgazione sulla home page della rete intranet aziendale, di
remainder visivi specifici che richiamassero l’attenzione degli operatori.
ƒ
Aggiornamento, anche tramite la pubblicazione sulla rete intranet aziendale, della bibliografia di
riferimento e delle ultime indicazioni dell’OMS e della RER.
Interventi in fase di sviluppo o in corso
Come ogni anno, il 5 maggio, giornata mondiale dell’igiene delle mani, in collaborazione con l’Agenzia
Sanitaria e Sociale Regionale, sono state previste iniziative (divulgazione poster, video, eccetera)
aziendali volte a ricordare ai Professionisti l’importanza che tale pratica riveste nella prevenzione delle
infezioni correlate all’assistenza.
La prosecuzione del percorso tracciato è di fondamentale importanza per indurre un cambiamento
sostanziale nella routine quotidiana. Pertanto, oltre al recepimento delle iniziative proposte dai canali
istituzionali (OMS, Ministero della Salute, Agenzia Sanitaria e Sociale regionale), sulla scorta delle
criticità evidenziate sono state pianificate precise azioni di miglioramento che vedranno
l’implementazione delle seguenti attività:
ƒ
introduzione di un sistema di autocontrollo per le UU.OO. che analizzi le componenti gestionali ed
organizzative legate all’Igiene delle mani e la conseguente individuazione dei problemi chiave che
necessitano di attenzione e miglioramento,
ƒ
predisposizione di iniziative informative e formative che vedranno l’impiego di materiale
multimediale,
ƒ
realizzazione di audit interni, che coinvolgeranno progressivamente tutte le Unità Operative, in
modo da monitorare l’adesione all’igiene delle mani e mantenere viva l’attenzione sulla tematica.
ƒ
sostegno e promozione dell’impiego del gel idroalcolico, aumentando ove necessario, le postazioni
di reperimento del gel.
PROGETTO SICHER – Sorveglianza delle infezioni del sito chirurgico nella
regione Emilia-Romagna
La sorveglianza delle ISC (Infezioni del Sito Chirurgico) consente il monitoraggio costante
dell’insorgenza di un evento infettivo a carico della ferita chirurgica: inizia al momento in cui il paziente
è sottoposto ad intervento chirurgico, prosegue fino alla dimissione e termina a 30 giorni
dall'intervento. Per gli interventi in cui è stato utilizzato materiale protesico la sorveglianza si protrae
fino ad un anno dall'intervento stesso.
L’ASSR ha posto come obiettivo a lungo termine che il sistema di sorveglianza diventi attività prioritaria
e continuativa dei percorsi organizzativo-gestionali delle UO Chirurgiche Generali e Specialistiche. La
sorveglianza, infatti, oltre a fornire dati epidemiologici, determina un maggior presidio delle attività
correlate alla prevenzione del rischio infettivo e fornisce alcuni degli elementi specifici per
l'accreditamento delle strutture sanitarie, tra cui il tasso di infezioni correlate all'assistenza, considerato
indicatore di valutazione della performance. Da alcuni anni la sorveglianza delle ISC è ricompressa tra
gli obiettivi di budget aziendali per le strutture chirurgiche.
Risultati raggiunti
L’attività di rilevazione è proseguita con il mantenimento della sorveglianza attiva di alcune categorie
selezionate di intervento quali:
ƒ
Sostituzione Totale dell'Anca (PTA), elettiva e non a seguito di trauma, realizzata presso le
ortopedie (follow-up ad un anno),
ƒ
Quadrantectomia in elezione, effettuata presso le chirurgie generali.
Nel corso dell’anno la sorveglianza è stata estesa anche alle unità operative chirurgiche del
Dipartimento Materno Infantile. Vengono sorvegliati in modo continuativo gli interventi (effettuati sia in
urgenza che elezione, per un periodo di follow-up previsto a 30 giorni) di:
ƒ
Taglio cesareo,
ƒ
Isterectomia addominale ed alcuni interventi a carico di ovaie e strutture correlate,
ƒ
Appendicectomia, pilomiotomia, ipospadia, orchidopessi.
130
Nel corso dell’anno sono stati sorvegliati complessivamente 1340 interventi di cui:
Quadrantectomie
Anno 2013
312
PTA
119
Taglio cesareo
648
Interventi
Ginecologici
197
Interventi
Chirurgia
Pediatrica
64
I dati sono stati inviati per la necessaria elaborazione, ASSR, secondo i flussi informativi definiti dal
Protocollo generale, pertanto nel corso del 2014 saranno disponibili i report degli interventi sorvegliati
nel 2013 e degli interventi protesici sorvegliati nel 2012.
Al fine di migliorare la rilevazione dei dati e superare i vincoli legati al sistema di raccolta in formato
cartaceo, sulla base del programma di inserimento dati del CCM, è stato sviluppato un programma
informatizzato di rilevazione delle infezioni del sito chirurgico, legato all’applicativo di Registro
Operatorio aziendale. L’informatizzazione della raccolta dati, operativa da febbraio 2014, consentirà di
estendere la sorveglianza informatizzata a tutte le unità operative chirurgiche (generali e
specialistiche) e a tutte le categorie di intervento previste dal Progetto di Sorveglianza stesso
(Protocollo SNICh – Sistema Nazionale di Sorveglianza delle ISC).
Eventuali problematiche riscontrate
Durante
l’uso
del
programma
informatizzato
sono
emerse
alcune
criticità
che
hanno
richiesto
la
realizzazione di diverse modifiche con il
fine di migliorarne la performance
d’utilizzo.
Prevenzione e controllo del rischio infettivo da legionella in ospedale
La malattia dei Legionari è in aumento, non solo perché ora può essere diagnosticata rapidamente
attraverso test specifici, ma perché è legata a stili di vita e caratteristiche della popolazione che
tendono a favorire ed amplificare la presenza nell’ambiente del microrganismo responsabile, ad
aumentare le occasioni espositive e ad agevolarne la trasmissione all’uomo per l’incremento dei
soggetti a rischio. Infatti Legionella spp. è un germe acquatico opportunista che trova il suo habitat
ideale negli ambienti caldo umidi, è capace di sopravvivere in condizioni sfavorevoli agli altri germi e si
moltiplica in nicchie ecologiche particolari, costituendo un elemento di rischio in tutte le situazioni in cui
è in funzione un sistema di condizionamento, di umidificazione o di trattamento dell’aria o di
ricircolarizzazione delle acque (ospedali, case di cura, residenze per anziani, alberghi, terme, piscine,
centri sportivi, eccetera).
Per tali motivi il problema Legionellosi ha suscitato e continua a suscitare un crescente interesse, in
quanto rappresenta un tema di sanità pubblica emergente, tanto da vedere l’emanazione di apposite
linee guida sia internazionali (OMS, EWGLI), che nazionali/regionali, che prevedono l’implementazione
di sistemi di sorveglianza specifici.
L’obiettivo fondamentale, in tema di prevenzione del rischio Legionellosi in ospedale, è quello di
assicurare adeguati standard di sicurezza igienica agli utenti ricoverati, in base alla valutazione del
rischio correlato, attraverso:
ƒ
la sorveglianza attiva di tutte le polmoniti con diagnosi differenziale per legionella,
ƒ
il monitoraggio microbiologico della rete idrica aziendale e degli impianti di condizionamento,
ƒ
la predisposizione di eventuali interventi di bonifica degli impianti in caso di riscontro di “non
conformità”,
ƒ
l’acquisizione di filtri antibatterici per terminali idrici per le strutture aziendali censite a maggior
rischio.
131
3. Obiettivi istituzionali e strategie aziendali
Interventi in fase di sviluppo o in corso
A gennaio 2014 è stato realizzato un corso di
aggiornamento, con il fine di formare/informare i
Professionisti coinvolti nelle varie unità operative ed
illustrare l’utilizzo del nuovo programma informatizzato. Il
corso si è svolto in due modalità una denominata “Base”
(2 incontri) rivolta alle chirurgie specialistiche e una
denominata “Refresh” (4 incontri) per le UU.OO. di
Chirurgia Generale ed Ortopedia, già inserite nel Progetto.
Al corso, nelle due edizioni, hanno partecipato
complessivamente 326 tra Medici, Infermieri e Personale
in Formazione.
La sorveglianza con il nuovo sistema informatizzato ha
preso avvio il 1 febbraio 2014. Allo stato attuale si sta
monitorando il livello di adesione al progetto tramite il
controllo sistematico delle schede SIChER compilate ed il
richiamo alle UU.OO. coinvolte in cui il livello di adesione è
risultato non soddisfacente.
La rete dei referenti SIChER, che hanno il compito di
monitorare l’andamento della rilevazione nelle singole
strutture di appartenenza, è in fase di rinnovo e
riorganizzazione.
3. Obiettivi istituzionali e strategie aziendali
Risultati raggiunti
In piena sintonia con i D.G.R. 21.07.2008 n. 1115 “Approvazione linee guida regionali per la
sorveglianza ed il controllo della Legionellosi”, così come previsto dallo specifico programma di
controllo in vigore, redatto sulla scorta del documento aziendale “Valutazione del rischio da Legionella”,
sono state mantenute le seguenti attività:
o Coordinamento del Gruppo Multidisciplinare Gestione Rischio Legionella Aziendale, che ha il
compito di presidiare il fenomeno in ambito locale, aggiornare il documento di valutazione del
rischio legionella e porre in atto gli interventi di prevenzione e controllo in base agli esiti dei rilievi
effettuati.
o Sorveglianza e controllo di tutte le polmoniti, attraverso il monitoraggio prospettico dell’incidenza
delle polmoniti sostenute da Legionella spp., tramite la diagnosi differenziale con la ricerca
dell’antigene urinario e degli anticorpi specifici. I dati non hanno evidenziato casi ad insorgenza
nosocomiale, a dimostrazione che le misure preventive e di controllo messe in atto in Azienda sono
state efficaci.
o Aggiornamento della valutazione del rischio dei diversi Padiglioni ospedalieri, con particolare
riguardo alle strutture di nuova attivazione, quali ad esempio il Nuovo Ospedale dei Bambini.
o Esecuzione, in collaborazione con l'Unità di Sanità Pubblica del Dipartimento di S.Bi.Bi.T
dell'Università di Parma, dei monitoraggi microbiologici della rete idrica aziendale, nel rispetto del
programma di controllo messo a punto dal Gruppo Legionella, sulla base della valutazione dei rischi
correlati alla tipologia dei pazienti assistiti, alle pratiche assistenziali effettuate e dello storico degli
esiti dei monitoraggi microbiologici effettuati presso le varie UU.OO. Sono state monitorate anche
tutte le aree di nuova attivazione. Complessivamente il totale dei campionamenti significativamente
positivi è inferiore alla soglia definita dal DGR del 30% del totale dei punti campionati. Le verifiche
hanno consentito anche di evidenziare alcune criticità dal punto di vista tecnico-impiantistico,
prontamente segnalate ai vari settori di competenza.
o Coordinamento e monitoraggio del cottimo fiduciario per la fornitura, l’installazione e la gestione
dei filtri monouso antibatterici per terminali idrici, installati presso le UU.OO. aziendali valutate a
maggior rischio (R3). La Ditta appaltatrice ha svolto il servizio in modo puntuale e conforme alle
clausole contrattuali. Nell’anno vi è stato un leggero incremento dei punti filtrati, a causa del
trasferimento di alcuni Reparti presso nuove sedi, senza però superare la percentuale di scarto (in
più o in meno) prevista da Capitolato. Gli esiti dei test di integrità di membrana dei filtri esausti
eseguiti con cadenza mensile, hanno mostrato la corretta funzionalità dei dispositivi, anche al
termine del periodo di impiego previsto (30 gg).
o Aggiornamento delle modalità, tempistiche e verifiche relative all’esecuzione della procedura di
flussaggio dei terminali idrici aziendali, attività supportata sia dalla letteratura di riferimento, sia
dagli Organi di Vigilanza, quale intervento di fondamentale importanza per la prevenzione delle
infezioni sostenute da Legionella spp.
o Partecipazione dei referenti aziendali agli incontri del gruppo di lavoro Legionellosi Regionale
istituito con Determina 16993 del 29.12.2011, al fine di mettere a punto una metodologia condivisa
per la valutazione del rischio, in particolare di quello impiantistico, che consenta di affrontare
l’argomento in modo strutturato in tutte le Aziende Sanitarie regionali.
Interventi in fase di sviluppo o in corso
La sorveglianza e il controllo della legionellosi in ospedale è attività in progress, in quanto in relazione
ai cambiamenti strutturali e clinico-organizzativi (tipologia di paziente e/o di prestazione sanitaria) in
essere a livello aziendale, è necessaria la rivalutazione periodica dello specifico documento di
valutazione del rischio e, conseguentemente dei programmi di sorveglianza e controllo da attuare.
Nel corso del 2014, grazie al rinnovo della Convenzione stipulata con l'Unità di Sanità Pubblica del
Dipartimento di S.Bi.Bi.T dell'Università degli Studi di Parma, proseguirà la sorveglianza microbiologica
della rete idrica aziendale tramite l’esecuzione di puntuali monitoraggi.
Verranno altresì predisposte le pratiche per il rinnovo del Cottimo fiduciario per la fornitura dei filtri
antibatterici monouso per terminali idrici, in scadenza nel mese di aprile 2014.
Alla luce della Circolare Regionale 304501/2013 “Sorveglianza e controllo della legionellosi nelle
strutture sanitarie delle Aziende sanitarie della Regione Emilia Romagna”, che delinea il modello al
quale le Aziende sanitarie possono far riferimento per la predisposizione e l’aggiornamento del
documento di valutazione dei rischi, si provvederà a:
- Predisporre revisione del Documento Aziendale “Programma di controllo della Legionella”, sulla base
delle modifiche apportate al Documento di Valutazione del Rischio.
- Informare le varie Ditta coinvolte a livello aziendale nella gestione e manutenzione degli impianti
idrici, circa le raccomandazioni contenute nel nuovo Documento Regionale, verificandone
contestualmente la corretta applicazione.
132
L’igiene e la sicurezza degli ambienti in cui vengono effettuate prestazioni sanitarie rappresentano
requisiti irrinunciabili per le aziende. L’ambiente, le superfici, l’aria e l’acqua sono tutti fattori che
devono essere attentamente monitorati negli ambienti di ricovero e cura dei pazienti e valutati in base
alla criticità (immunodepressi/immunocompetenti) degli utenti ivi trattati, a livello di complessità
clinico-assistenziale (CO, Terapia Intensiva, eccetera), al fine di rispettare gli standard richiesti dalla
letteratura e dalle linee guida di riferimento per la prevenzione del rischio infettivo.
Le attività sviluppate si articolano in modo costante e devono rispondere alle continue esigenze e
variazioni strutturali e organizzative, che intervengono all’interno dell’area ospedaliera, soprattutto
legate al sorgere di nuove strutture sanitarie, unità operative, servizi.
Risultati raggiunti
Anche nel corso del 2013, nella nostra Azienda sono proseguite le verifiche, effettuate a cura degli
organismi preposti, volte ad ottenere l’autorizzazione e l’accreditamento delle unità operative aziendali.
In tale contesto l’attività di verifica e controllo è stata ulteriormente consolidata, al fine di
salvaguardare e mantenere condizioni di sicurezza igienica ambientale, idonee agli standard di
riferimento previsti per l’ottenimento delle certificazioni.
Il programma di intervento si è sviluppato attraverso:
• la verifica e il mantenimento del controllo degli aspetti igienico preventivi di maggiore criticità negli
ambienti assistenziali ed in particolare in quelli ad alto rischio (comparti operatori, terapie
intensive);
• la realizzazione, ove necessario, in caso di “non conformità” rilevate, di immediati interventi
correttivi;
• lo sviluppo di interventi informativi/formativi del personale, volti ad implementare le buone pratiche
igienico-assistenziali, partendo dalla rilevazione di eventuali comportamenti “non conformi”,
osservati nel corso dei sopralluoghi effettuati, specie in quelli svolti nelle strutture a maggior rischio.
E’ stata mantenuta la verifica e il controllo degli aspetti igienico sanitari legati ai servizi in gestione
appaltata inseriti nel Global Service Economale, con il fine di garantire adeguati standard di sicurezza
igienica, contenendo il rischio infettivo correlato alle attività di pulizia/disinfezione degli ambienti,
lavanoleggio biancheria ed effetti letterecci, disinfestazione e derattizzazione, igiene degli alimenti,
eccetera.
Nello specifico, si è provveduto a:
• verificare la corretta applicazione delle indicazioni e disposizioni igieniche inserite nel capitolato
d’appalto di pulizia e sanificazione ambientale in vigore, segnalando le “non conformità” rilevate agli
ambiti aziendali coinvolti;
• curare la stesura, revisione e verifica dei protocolli di sanificazione/sanitizzazione su specifiche
UUOO/Servizi ad elevata complessità, quali “Laboratorio lavorazione sangue ed emoderivati” dell’UO
Immunoematologia e Medicina Trasfusionale, “Laboratorio di radiofarmacia” dell’UO Medicina
Nucleare, “Sale Angiografiche” dell’UO Neuroradiologia, “Sala Operatoria adibita a trattamenti
Oncologici Locoregionali ipertermici”, eccetera;
• mantenere aggiornata, ai fini igienico-preventivi, la mappatura delle destinazioni d’uso dei locali
aziendali;
• verificare la corretta applicazione delle indicazioni e disposizioni igieniche inserite nel capitolato
d’appalto lavanoleggio biancheria ed effetti letterecci in vigore, segnalando le “non conformità”
rilevate agli ambiti aziendali coinvolti;
• realizzare e diffondere precise disposizioni, al fine di garantire adeguati standard igienici durante
l’esecuzione di lavori edili di ristrutturazione/manutenzione all’interno delle aree aziendali, con
particolare riguardo per quelle sanitarie;
• coordinare e controllare le attività previste dal Servizio Appaltato di Disinfestazione e
Derattizzazione Ambientale in tutte le aree aziendali, per la prevenzione e contenimento della
diffusione degli infestanti. L’attività si è articolata su più livelli, pianificando incontri mensili con i
tecnici della ditta appaltatrice per valutare gli esiti degli interventi programmati e le problematiche
emergenti, proponendo interventi volti ad individuare e risolvere criticità strutturali e
programmando, ove necessario, interventi di manutenzione e bonifica;
• individuare, all’interno delle varie strutture aziendali, percorsi adeguati per l’accesso dell’utenza e
degli operatori, l’approvvigionamento del materiale pulito e lo smaltimento del materiale sporco e
dei rifiuti, nel rispetto ai vincoli strutturali e di cantiere esistenti. Inoltre si è provveduto ad
effettuare il controllo sull’aderenza delle disposizioni fornite nel rispetto dei percorsi stabiliti;
• realizzare e trasmettere precise disposizioni, al fine di garantire adeguati standard igienici durante
gli interventi di manutenzione con l’interruzioni di acqua calda e fredda sanitaria, di energia elettrica
nei padiglioni aziendali. Le attività previste sono state effettuate sia con interventi programmati,
che con interventi urgenti;
Di particolare rilievo, nel corso dell’anno, l’attivazione del Nuovo Ospedale dei Bambini (NOB), struttura
133
3. Obiettivi istituzionali e strategie aziendali
Sicurezza igienico-ambientale
complessa ed articolata studiata per rispondere ai bisogni dei piccoli pazienti e delle loro famiglie. Il
trasferimento delle UU.OO pediatriche presso il nuovo complesso ha comportato un impegno costante
durato alcuni mesi.
Le attività svolte hanno riguardato:
richiesta e verifica delle schede tecniche dei materiali impiegati per la costruzione e l’allestimento
delle diverse aree (pavimenti, tinteggi, arredi, rivestimenti, eccetera), al fine di valutare le
metodologie ed i prodotti più appropriati per il mantenimento di adeguati standard igienici.
classificazione delle destinazioni d’uso di tutti i locali, con conseguente attivazione dei servizi
appaltati, diversificati rispetto alle peculiarità di ciascuna area censita e revisione contestuale dei
protocolli di bonifica ambientale di tutte le UU.OO. pediatriche afferenti al nuova struttura:
Osservazione Breve, Lattario, Ambulatorio Generale e d’Urgenza, Day Hospital Polispecialistico e
Day Surgery Pediatrico, C.O. Chirurgia Pediatrica, Oncoematologia, Neonatologia e Degenza
Comune Pediatrica.
3. Obiettivi istituzionali e strategie aziendali
Il Sistema di monitoraggio microbiologico ambientale delle aree ad alto
rischio
L’ospedale rappresenta un particolare modello di ambiente confinato, che si caratterizza per la sua
complessità e coesistenza di tipologie architettoniche, funzionali ed operative molto diversificate. Nel
suo contesto si ritrovano, oltre a quelli generalmente presenti nell’aria “indoor”, taluni inquinanti
biologici derivati dai processi clinico-assistenziali che in esso vengono svolti. L’esecuzione di procedure
altamente invasive e la presenza di pazienti con difese immunitarie ridotte, impongono la verifica ed il
controllo del potenziale rischio infettivo derivante dalla contaminazione di veicoli di infezione quali aria
e superfici.
La progettazione degli ambienti sanitari, in particolar modo di quelli che devono garantire una
contaminazione microbiologica controllata, è regolamentata da numerose normative, che definiscono
anche i livelli di pulizia dell’aria all’interno dei locali, consentendo quindi la classificazione e la
certificazione degli stessi in relazione alla classe di appartenenza.
La determinazione della carica microbica ambientale (aria e superfici) e del particolato presente in
sospensione nell’aria, che può fungere da carrier per i microrganismi ivi presenti, diventa un indicatore
della sicurezza igienica degli ambienti, in quanto consente di mantenere monitorati i seguenti aspetti:
il buon funzionamento degli impianti di ventilazione,
l’aderenza alle modalità comportamentali da parte degli operatori,
- l’applicazione dei protocolli di sanificazione/sanitizzazione ambientale predisposti per ciascuna area.
Risultati raggiunti
In conformità a quanto previsto dalle UNI EN ISO 14644:2001, 14698:2004 e 11425:2011, nonché
dalla letteratura e linee guida di riferimento (ISPESL 2009, GMP Annex 1 2008, eccetera) anche per il
2013, è stata realizzata l’attività di monitoraggio ambientale sia di tipo particellare, che microbiologico,
nelle aree aziendali definite ad “alto rischio”, quali i blocchi operatori, il Centro Ustioni, il CTMO,
l’UmaCA, la Centrale di Sterilizzazione, eccetera.
I monitoraggi sono stati eseguiti in condizioni di:
“at rest”, cioè con i locali vuoti, ma pronti per essere utilizzati, per la valutazione del funzionamento
dell’impianto VCCC e la corretta esecuzione dei protocolli di sanificazione/disinfezione ambientale,
“operational”, cioè con in locali in attività: per valutare principalmente l’osservanza delle procedure
comportamentali unita al corretto funzionamento dell’impianto di VCCC.
In esito ai controlli, sono state predisposte le opportune azioni correttive e di miglioramento.
I controlli microbiologici sono stati svolti con sistema di campionamento di tipo “attivo” (standardizzato
per tempo e volumi di aria aspirata), in modo programmato con frequenza semestrale ed in modo
estemporaneo dopo l’esecuzione di consistenti interventi di tipo tecnico sull’impianto di
condizionamento ed in casi particolari, come ad esempio l’esecuzione di opere di manutenzione edile,
l’apertura di locali di nuova attivazione, eccetera.
I controlli particellari svolti tramite un contatore di particelle conforme a quanto stabilito dalla norma
tecnica UNI EN 13205:2002, quantificano le particelle aerodisperse all’interno dei locali, consentendo
quindi la classificazione degli ambienti, secondo quanto previsto dalle normative di riferimento.
L’elaborazione statistica dei risultati, rilasciata automaticamente dalla strumentazione al termine del
campionamento, è condotta per ogni tipologia di locale esaminato, secondo quanto riportato dalla
Norma UNI EN ISO 14644 per le sale operatorie e da EU GMP Annex 1 per le camere bianche. Sono
stati eseguiti sia per la classificazione di aree di nuova attivazione (es. NOB), sia per riqualificare gli
ambienti sottoposti ad interventi tecnico-strutturali di manutenzione.
134
Interventi in fase di sviluppo o in corso
In conformità con la Circolare Regionale del Servizio Strutture Sanitarie e
Socio-Sanitarie - prot. PG/2012/188026 del 31/07/2012 “Applicazione
nelle Aziende Sanitarie dell’Emilia Romagna della norma UNI EN ISO
11425:2011”, tramite il coordinamento dello specifico Gruppo di lavoro
multisciplinare aziendale, sono in fase di sviluppo le seguenti attività:
redazione del “Documento di progetto” dei Blocchi Operatori presenti
in Azienda
calendarizzazione dei monitoraggi microbiologici e particellari in
ottemperanza a quanto previsto dalla Normativa in questione.
Eventuali problematiche
riscontrate
Complessa articolazione
della programmazione
Prevenzione e controllo delle malattie trasmissibili
Il Sistema di Sorveglianza delle Malattie Infettive, degli eventi epidemici e dei microrganismi con profilo
di resistenza inusuale
Nell’ambito del Sistema Regionale di Sorveglianza delle Malattie Infettive (SMI) è stato mantenuto il
controllo sistematico del flusso di denunce di malattie infettive provenienti dalle singole UU.OO. e delle
segnalazioni di microrganismi “sentinella” (alert-organism) inviate dal Laboratorio di Microbiologia,
finalizzato a perseguire i seguenti obiettivi:
sorvegliare gli eventi infettivi, gli eventi epidemici e gli eventi sentinella, in ambito nosocomiale;
prevenire/controllare la diffusione dei microrganismi, con particolare riguardo ai ceppi
multifarmacoresistenti o epidemiologicamente importanti, tramite la tempestiva messa in atto delle
misure di controllo, garantendo quindi la sicurezza dei pazienti, dei visitatori e degli operatori;
attivare i servizi territoriali preposti, per le opportune considerazioni epidemiologiche e gli eventuali
interventi preventivi post-esposizione.
Risultati raggiunti
In specifico, per quanto riguarda il sistema di notifica delle Malattie Infettive, con l'intento di
migliorare la qualità dei dati trasmessi al Dipartimento di Prevenzione dell'AUSL di Parma, è proseguita
la valutazione dell'appropriatezza dei dati riportati nella Scheda di segnalazione.
Il monitoraggio ha riguardato la raccolta ed analisi tramite data base dedicato di 1431 segnalazioni di
Malattia Infettiva accertata/sospetta e sono state riscontrate 269 (pari al 18%) non conformità, legate
ad un'incompleta/sommaria compilazione dei dati richiesti. Le schede incomplete sono state oggetto di
sistematica notifica ai Referenti di Unità Operativa coinvolta, con richiesta di completamento e richiamo
sull'importanza del dato ai fini preventivi e medico-legali.
Sulla base delle indicazioni pervenute dall’Assessorato regionale, sono state date indicazioni specifiche
per la sorveglianza, prevenzione e controllo di alcune malattie, di particolare rilievo epidemiologico, tra
cui il Botulismo, Tetano, Nuovo Coronavirus, Poliovirus, Meningite da meningococco, Epatite A, Tetano
e Leismaniosi.
Per quanto riguarda la sorveglianza dei microrganismi sentinella, è stato mantenuto il
monitoraggio costante delle oltre duemila segnalazioni di isolamenti dei microrganismi
multifarmacoresistenti, trasmesse dal Laboratorio di Microbiologia.
Di particolare rilevanza in tale contesto il monitoraggio dell’andamento della diffusione dei CPE
(Enterobatteri produttori di Carbapenemasi). In stretta sinergia con l’Agenzia Sanitaria e Sociale
Regionale – Area Rischio Infettivo, la nostra Azienda ha garantito e mantenuto l’invio mensile dei dati
sulla sorveglianza attuata (prevalenza ed incidenza dei pazienti colonizzati/infetti), la ricerca attiva dei
pazienti colonizzati infetti ed il controllo sull’applicazione delle misure preventive di contenimento,
attività ritenute prioritarie per il controllo della diffusione in ambito nosocomiale.
La sorveglianza ha consentito di:
• mantenere aggiornata la “mappatura”, in ambito locale, della diffusione dei microrganismi
multidrug resistent (MDR),
• verificare costantemente l'andamento del fenomeno, in modo da intercettare tempestivamente
eventuali aumenti significativi d’incidenza in un breve arco temporale, al fine di predisporre
specifiche misure di controllo, volte al contenimento dello stesso,
• inviare a cadenza periodica, a tutte le UU.OO. aziendali, i report riepilogativi delle segnalazioni
di MDR, al fine di agevolare le opportune valutazioni a carattere clinico ed epidemiologico,
• realizzare specifici audit clinici, con lo scopo di verificare la corretta applicazione delle misure
assistenziali previste per ogni caso di specie, promuovendo, ove necessario, eventuali azioni di
miglioramento rispetto alle eventuali “non conformità” riscontrate.
Nel corso dell’anno, nel rispetto delle indicazioni pervenute dal Ministero della Salute e riprese nella
circolare della Regione Emilia-Romagna “Sorveglianza e controllo delle infezioni da enterobatteri
135
3. Obiettivi istituzionali e strategie aziendali
a) Sorveglianza delle malattie infettive
produttori di carbapenemasi – CPE” con l’intento di monitorare la frequenza e la distribuzione
geografica della infezioni invasive sostenute da enterobatteri non sensibili ai carbapenemi e/o
produttori di carbapenemasi, la nostra Azienda ha garantito il flusso informativo dei dati relativi al
riscontro di batteriemie sostenute da CPE riscontrate a livello aziendale.
Interventi in fase di sviluppo o in corso
Con l’intento di migliorare la gestione del paziente
colonizzato/infetto
da
microrganismi
multifarmacorestistenti o affetto da patologia infettiva
(accertata/sospetta)
nel
corso
dell’anno
verranno
ulteriormente promosse azioni, con particolare riguardo
alla formazione del personale e al potenziamento delle
verifiche nelle varie UU.OO., volte ad aumentare
l’adesione, da parte degli operatori sanitari, alle
precauzioni standard e alle precauzioni specifiche per
patologia,
durante
l’assistenza,
al
riconoscimento
tempestivo e isolamento dei pazienti infetti/colonizzati da
MDR, all’identificazione e contenimento degli eventi
epidemici.
Eventuali problematiche riscontrate
La
lotta
ai
microrganismi
multifarmacoresistenti rappresenta una
delle più rilevanti sfide della medicina
moderna.
L’importanza clinica è legata alla rapida
comparsa di resistenza anche a nuove
molecole di antibiotici, che determinano
problemi terapeutici, aumento della durata
della degenza, aumento dei costi e
soprattutto aumento della mortalità.
L’attenzione delle aziende sanitarie al
fenomeno è alta ed è uno degli obiettivi
più importanti ricompresi nei programmi
di gestione del rischio infettivo nelle
strutture sanitarie e socio-sanitarie.
3. Obiettivi istituzionali e strategie aziendali
b) Programmi di controllo specifici
Piano di eliminazione del Morbillo e della Rosolia Congenita
La Regione Europea dell’OMS ha posto come obiettivo di eliminare entro il 2015 il morbillo e la rosolia e
di ridurre l’incidenza della rosolia congenita a <1 caso ogni 100.000 nati vivi. Tali obiettivi sono stati
ricompresi nel Piano Nazionale per l’eliminazione del morbillo e della rosolia congenita
(PNEMoRc) 2010-2015 recepito nel D.G.R. 916 del 27.06.2011, nei cui contenuti è enfatizzata
l’importanza di:
• raggiungere coperture elevate ed omogenee per la prima dose di MPR mediante offerta attiva ed
opportune strategie di recupero dei suscettibili non vaccinati nell’infanzia,
• raggiungere la copertura vaccinale supplementare (seconda dose) rivolte a popolazioni suscettibili
ben identificate,
• ridurre la percentuale di donne in età fertile suscettibili alla rosolia,
• migliorare il sistema di sorveglianza aumentando l’accuratezza della notifica del morbillo anche
attraverso il ricorso alla conferma di laboratorio e introducendo la sorveglianza nazionale
dell’infezione rubeolica in gravidanza e dell’infezione congenita da rosolia e delle sue manifestazioni
cliniche.
Risultati raggiunti
Nell’Azienda Ospedaliera è proseguita l’attività di controllo del Morbillo e Rosolia ed è stato individuato
il percorso di sorveglianza e controllo aziendale che prevede:
nei casi accertati/sospetti compilazione della scheda di segnalazione di malattia infettiva e la
compilazione della scheda di notifica di sorveglianza specifica “Scheda di sorveglianza integrata
Morbillo-Rosolia”, con notifica all’Azienda USL di competenza sul territorio,
messa in atto delle precauzioni di isolamento previste nei singoli casi di specie
nei casi sospetti, esecuzione ed invio delle indagini sierologiche ove previsto, e il rispetto dei criteri
clinici e microbiologici esplicitati nella definizione di “caso”.
Al riguardo e come di consueto sono state fornite specifiche indicazioni in merito alla compilazione della
scheda di sorveglianza, alle modalità di accesso ai Laboratori di riferimento regionale per la ricerca del
virus del morbillo o della rosolia e la loro eventuale tipizzazione.
Nel luglio di quest’anno la Regione ha trasmesso la circolare del Ministero della Salute “Sorveglianza
della rosolia congenita e dell’infezione da virus della rosolia in gravidanza alla luce del nuovo PNEMoRc
2010-2015”, che ha introdotto le nuove definizioni di caso, aggiornato le schede di sorveglianza nelle
parti riguardanti le informazioni cliniche ed ostetriche, gli esami di laboratorio e la classificazione del
caso, e ha previsto procedure per il follow-up dei casi di rosolia congenita e dell’esito delle gravidanze.
In tema di sorveglianza sanitaria ai dipendenti, è proseguita l’attività di controllo sierologico per la
verifica dell’immunizzazione ed il controllo dello stato vaccinale sia degli operatori sanitari strutturati,
sia del personale in formazione. Il protocollo prevede che in caso di operatore suscettibile sia offerta la
vaccinazione MPR.
Interventi in fase di sviluppo o in corso
E’ in fase di realizzazione una revisione delle linee di indirizzo aziendali sull’argomento.
136
Prevenzione e controllo delle malattie trasmesse da vettori (CHIKUNGUNYA,
FLAVIVIRUS)
DENGUE, WEST NILE DISEASE, E ALTRI
Risultati raggiunti
In linea con il “Piano di sorveglianza e controllo malattie di West-Nile Disease, Chikungunya, Dengue e
altri arbovirus in Emilia – Romagna 2013”, sono state mantenute/realizzate diverse attività, volte a
prevenire, monitorare e contenere l’eventuale infestazione da zanzara a livello aziendale.
In particolare sono state realizzate le seguenti attività:
•
fornire indicazioni comportamentali, quali le modalità di isolamento, gli accorgimenti per limitare
l’attrattiva degli insetti, l’acquisizione e impiego di repellenti cutanei;
•
monitoraggio dei casi clinici riscontrati in ambito nosocomiale con il fine di verificare
l’appropriatezza del percorso diagnostico-terapeutico;
•
trasmettere a tutte le UU.OO. aziendali le Linee Guida Ministeriali e le Disposizioni della Regione
Emilia Romagna, in merito alla sorveglianza e prevenzione della Malattia West-Nile, pubblicando
contestualmente i documenti sulla rete intranet aziendale e predisponendo il percorso interno di
segnalazione e di conferma diagnostica, secondo le indicazioni regionali;
•
diffondere le nuove indicazioni e i relativi aggiornamenti periodici alle strutture interne coinvolte
(Immunoematologia e Trasfusionale, Cl. Ch. Trapianti d’organo, Genetica Medica, eccetera) in
merito alla trasmissione del WNV mediante trapianto d’organo, tessuti e cellule nella stagione
estivo-autunnale 2013, inviate dalla Regione Emilia Romagna e AIRT, motivate dal rinvenimento di
zanzare infette dal virus in più province della regione;
•
realizzare interventi strutturali, quali l’installazione di zanzariere, la corretta gestione e
manutenzione delle aree verdi esterne e delle aree di cantiere, per limitare l’infestazione all’interno
e all’esterno delle strutture;
•
eseguire, d'intesa con l’Azienda municipalizzata e con le strutture dell’Azienda USL, su tutto il
territorio aziendale, una serie di attività riguardanti la lotta alla zanzara tigre, tra cui: la pulizia dei
pozzetti fognari prima dell’inizio della lotta antilarvale e al bisogno, l’organizzazione degli interventi
anti-larvali
nell’ambito
del
controllo
igienico-gestionale
delle
attività
di
disinfestazione/derattizzazione appaltata, le disinfestazioni adulticide mirate in presenza di
infestazione particolarmente significativa.
In relazione ai dati epidemiologici, l’attenzione e il monitoraggio del fenomeno è costante con
aggiornamenti periodici delle linee di indirizzo ed intervento a cura del Ministero della Salute.
Interventi in fase di sviluppo o in corso
Eventuali problematiche riscontrate
Anche per il 2014 sono in corso, sia gli interventi di L’inverno particolarmente mite appena
prevenzione
ambientale,
finalizzati
a
contenere trascorso induce a prevedere un aumento
l’infestazione dei vettori sul territorio aziendale, sia la della presenza di zanzare. Tale criticità
sensibilizzazione dei Professionisti sul tempestivo potrà coinvolgere anche le aree ospedaliere
vista la presenza di aree verdi, con un
riconoscimento e sulla corretta gestione degli eventuali
conseguente prevedibile aumento degli
casi.
interventi volti al contenimento della
diffusione.
Prevenzione sorveglianza e controllo della tubercolosi
La Tubercolosi, a tutt’oggi, rappresenta un problema clinico e di sanità pubblica di importante rilevanza
a livello mondiale. La malattia è in continua crescita sia nei pazienti immunocompromessi che nei
soggetti immunocompetenti; aspetti rilevanti che rendono ancora più complessa la gestione di questa
patologia sono, inoltre, la difficoltà diagnostica, sia dell’infezione attiva che di quella latente, la scarsa
aderenza alle misure igienico-preventive e il sempre più frequente riscontro di ceppi resistenti (anche
in Italia sono stati identificati casi di XDR-TB – forma estensivamente resistente per la quale non
esistono farmaci).
Nel rispetto del documento di indirizzo “Controllo della Tubercolosi: obiettivi di salute, standard ed
indicatori 2013-2016” e delle linee di intervento, raccomandate dal Servizio di Sanità Pubblica
dell’Assessorato Politiche per la Salute della Regione, in sintonia con quanto disposto dal Ministero della
Salute con specifica nota prot. DGPREV 0019776-P-23/08/2011 “Misure di prevenzione e controllo della
Tubercolosi”, si sintetizzano di seguito:
o puntuale implementazione delle attività raccomandate,
137
3. Obiettivi istituzionali e strategie aziendali
Le malattie a trasmissione vettoriale rappresentano un problema emergente a livello mondiale da
diversi anni, la Regione Emilia-Romagna ha avviato un sistema di sorveglianza e controllo delle
malattie trasmesse da vettori, in particolar modo per Chikungunya, Dengue e West Nile Disease.
L’Azienda applica con sistematicità, il Piano Regionale per la sorveglianza ed il controllo delle malattie
trasmesse da Aedes albopictus (Chikungunya e Dengue) e Culex (West-Nile Disease), con l’obiettivo di
contenere la diffusione di tali malattie, già endemiche nel territorio regionale e ridurre la probabilità che
patologie importate sviluppino focolai autoctoni.
o rafforzo della sorveglianza e controllo in ambito assistenziale e in contesti ad aumentato rischio,
o stretta sinergia tra ospedale e territorio per l’implementazione degli interventi di prevenzione,
o sensibilizzazione/informazione degli operatori sanitari.
Risultati raggiunti
Anche quest’anno sono state mantenute e rafforzate le misure di sorveglianza e controllo ritenute
efficaci e a suo tempo già implementate a livello aziendale, in specifico:
la tempestiva segnalazione degli eventi infettivi sospetti/accertati individuati in ambito
nosocomiale, agli Organi istituzionali preposti per gli opportuni adempimenti di competenza (sono
state effettuate circa 50 segnalazioni di casi accertati e sospetti comprese le forme
extrapolmonari);
- la messa in atto delle misure di prevenzione e controllo della tubercolosi in ambito ospedaliero nei
casi individuati;
- la sorveglianza sanitaria degli operatori, secondo protocollo aziendale, sia periodica che a seguito di
esposizione, mirata all’esclusione di forme tubercolari in atto e alla prevenzione della malattia
tramite la profilassi. Il percorso di sorveglianza non ha evidenziato particolari criticità, rilevando
percentuali di infezione sovrapponibili ai tassi rilevati nella popolazione generale.
Interventi in fase di sviluppo o in corso
E’ stato inserito a PAF un corso di formazione aziendale con l’intento di riproporre ed approfondire sia
gli aspetti epidemiologici, diagnostici, preventivi e terapeutici, sia quelli legati al rischio occupazionale.
Prevenzione sorveglianza e controllo della sindrome influenzale
3. Obiettivi istituzionali e strategie aziendali
La prevenzione dell’influenza rappresenta un importante intervento di sanità pubblica sia per l’impatto
dell’epidemia stagionale sulla popolazione, specie le persone con condizioni di rischio, sia per l’impegno
dei servizi sanitari nella campagna vaccinale antinfluenzale.
Il Ministero della Salute, in stretta sinergia con le Regioni, da alcuni anni, promuove interventi efficaci e
sicuri per la gestione dei pazienti affetti da influenza e coordina una serie di attività a 360° che
comprendono:
• sviluppo di sistemi di sorveglianza e controllo della diffusione dei ceppi sul territorio nazionale,
• campagna di prevenzione, mirata a favorire la diffusione delle indicazioni igieniche (lavaggio mani,
utilizzo delle precauzioni in caso di tosse, eccetera), sostenere ed incentivare la pratica vaccinale,
• fornire indicazioni sulla gestione del paziente in regime di ricovero, eccetera,
• stretta sinergia ospedale – territorio.
Anche quest'anno, in linea con le indicazioni dell'Assessorato Politiche per la Salute della Regione
Emilia-Romagna, si è provveduto alla realizzazione della campagna di vaccinazione antinfluenzale, con
ampia informazione al personale sanitario sulla necessità di sottoporsi alla vaccinazione e
sull’importanza che essa riveste in termini di prevenzione del rischio infettivo nei luoghi di cura ed
assistenza. Inoltre, sono state riproposte le raccomandazioni per la prevenzione ed il controllo, i criteri
sia per la richiesta di consulenza ai centri della rete ECMO, sia per la segnalazione e sorveglianza dei
casi gravi e complicati di influenza che necessitano di ricovero in UTI, nonché le modalità di accesso ai
Laboratori di riferimento regionale per la diagnosi di influenza (ricerca virus influenzali).
Interventi in fase di sviluppo o in corso
Negli anni, l’impegno rivolto alla prevenzione e controllo delle sindromi influenzali in ospedale è
continuo e costante, ed è strettamente correlato all’intensità dei picchi epidemici nella popolazione
assistita.
Politica del farmaco e governo della spesa farmaceutica e dispositivi
medici
Assistenza farmaceutica ospedaliera
Nell’ambito dell’obiettivo generale di politica del farmaco e governo della spesa farmaceutica ospedaliera,
le attività dell’AOU di Parma sono state in particolare orientate all’adesione alle gare in unione d’acquisto
regionali (Intercent-ER) e di Area Vasta Emilia Nord (AVEN), al progetto di integrazione logistica
centralizzata, al monitoraggio e analisi dell’appropriatezza dei trattamenti, al monitoraggio dei consumi e
all’implementazione dell’erogazione diretta dei farmaci ai pazienti in dimissione da ricovero ospedaliero e
da visita ambulatoriale.
Il Prontuario Terapeutico di Area Vasta (PT-AVEN), dinamicamente aggiornato, è stato applicato
rispettando i vincoli regionali e gli orientamenti della Commissione Regionale del Farmaco (CRF) operando
138
anche in sinergia con il Nucleo Operativo Provinciale nell’adozione delle decisioni della Commissione del
Farmaco AVEN e della CRF per l’inserimento di nuovi farmaci nella pratica clinica.
E’ stata garantita continuità alle attività di CF-AVEN e di coordinamento con la CRF al fine di rendere
omogenee le azioni e la versione del PT-AVEN con quello regionale. Sono stati recepiti e divulgati tutti i
documenti scientifici prodotti dalla CRF collegati all’applicazione del PT-AVEN e quelli elaborati dai gruppi
multidisciplinari RER.
L’andamento dei consumi e della spesa per l’assistenza farmaceutica ospedaliera si pone, nell’anno 2013,
in linea con l’obiettivo che il documento della relativa programmazione regionale prevedeva come
contenimento della spesa rispetto al 2012. Il sistema di governo clinico messo in atto sull’appropriatezza
prescrittiva ha consentito di contenere i consumi e la spesa per farmaci nei tetti d’aumento previsti dalla
Regione Emilia-Romagna: “Spesa Ospedaliera” 36.905.994€ (+ 6,4% , entro il tetto RER di 37.217.633€
pari al +7,3%) e “Erogazione Diretta fascia A” 1.915.870 € (-3,58%, entro il tetto RER di 2.256.544€)
contenendo l’incremento di spesa complessiva al +5.6% (valore complessivo 38.821.864€) rispetto al
tetto di aumento complessivo previsto dalla RER per l’AOU di Parma del + 7.6 % (39.474.177€) [fonte
AFO RER dato definitivo].
Nel 2013 l’attività di prescrizione ed erogazione di farmaci a pazienti in dimissione da ricovero dai Reparti
e dai Servizi dell’Azienda si è ulteriormente consolidata e ha raggiunto un numero di pazienti assistiti pari
a 20.026 con 1.844.851 unità posologiche erogate.
EROGAZIONE FARMACI AI PAZIENTI IN DIMISSIONE ANNO 2012 vs 2013 1 gennaio – 31 dicembre 2012 1 gennaio – 31 dicembre 2013 Numero dei pazienti dimessi con farmaci 19.778 20.026 Numero pezzi erogati (unità posologiche: fl, cpr, cer,…) 1.769.010 1.844.851 Spesa ospedaliera sostenuta (in euro al netto dell'IVA) 317.327 euro 297.055 euro Per il 2013 il risparmio del SSN è stimabile nell’intervallo tra 1.160.732 € e 1.057.517 € (l’intervallo tra i
valori min-max è stimato in relazione alle differenti tipologie di farmacie sul territorio (rurali o urbane,
sussidiate o non sussidiate) e al loro fatturato e in relazione alle differenti percentuali di sconto per fascia
di prezzo dei medicinali (parametri di scontistica pubblicati da Federfarma, aggiornamento del 18 ottobre
2013).
Per quanto riguarda i farmaci in compensazione, l’importo complessivo erogato è stato nel 2013 pari a
24.124.918 € iva compresa [fonte Controllo di Gestione].
Si rappresenta di seguito il dettaglio più significativo dell’attività di assistenza farmaceutica ospedaliera e
dell’andamento dei consumi e della spesa per farmaci nell’anno 2013.
Tabella 3 Consumi e spesa totali (categoria “farmaco” e “non farmaco”) , anno 2013
Totale pezzi Totale valore 19.119.624 36.600.901 [fonte software aziendale Sisifo. Consumi rilevati come flussi di “Trasferimento alle UU.OO.” Valore senza IVA ]
Nella tabella 3 è riportato il valore di spesa totale per materiali sanitari erogati ai reparti e servizi nel
2013 comprensivo quindi di tutti i farmaci e dei prodotti definiti “non farmaco” quali materiali di
medicazione, disinfettanti, materie prime, alimenti, strisce reattive.
Tabella 3a Consumi e spesa per tutta la categoria " farmaco” (inclusi i farmaci erogati in
dimissione)*, anno 2013
Totale unità posologiche Totale valore 10.306.691 34.924.735 * Non sono comprese le categorie definite “non farmaco“ (materie prime, alimenti, diagnostici in vitro, reagenti, alcuni
disinfettanti, prodotti per dialisi, ecc.) e “dispositivo“ (medicazioni, disinfettanti, prodotti per oculistica, colle istologiche,
strisce glicemia, eccetera) [fonte software aziendale Sisifo. Consumi rilevati come flussi di “Trasferimento alle UU.OO.” Valore
senza IVA]
La tabella 3a riporta il dato di consumo e di spesa di specialità medicinali in Prontuario Terapeutico AVEN
(PT AVEN) ed extra-PT AVEN, compresa l’erogazione dei farmaci a pazienti in dimissione, comprensivo
139
3. Obiettivi istituzionali e strategie aziendali
[fonte software aziendale Sisifo. Consumi rilevati come flussi di “Trasferimento alle UU.OO.” Valore senza IVA ]
anche di soluzioni di largo volume, emoderivati, farmaci diagnostici e mezzi di contrasto, stupefacenti,
galenici, sieri e vaccini e farmaci esteri nell’intero anno 2013, inclusa la somma a compensazione
economica
Nel 2012 la spesa corrispondente era stata di € 33.575.707 che, rapportata alla spesa di 34.924.735 €
del 2013 determina un valore entro la soglia prevista dai documenti di programmazione regionali.
Se dal valore totale di spesa per farmaci nel 2013 si sottrae il valore della compensazione economica si
osserva un consumo interno dei farmaci per pazienti ricoverati sostanzialmente inalterato rispetto al
2012.
Tabella 3b
Tot unità posologiche erogate anno 2013 10.306.691 Tot valore anno 2013 Unità erogate in dimissione anno 2013 Valore erogato in dimissione anno 2013 Unità erogate al netto da dimissione Valore erogato al netto da dimissione 34.924.735 1.844.851 297.055 8.461.840 34.627.680 Fonte software Sisifo. Consumi rilevati come flussi di “Trasferimento alle UU.OO.” Valore senza IVA
3. Obiettivi istituzionali e strategie aziendali
La tabella 3b si riferisce alle sole specialità medicinali presenti nel Prontuario del Farmaco Aven o
acquistate in deroga ad esso secondo le decisioni assunte dalla Commissione del Farmaco AVEN, inclusa
la somma a compensazione economica.
Nell’anno 2012 la corrispondente spesa per farmaci in valore totale al netto dall’erogazione ai pazienti in
dimissione era stata di € 33.258.654. Quindi la spesa di € 34.627.654 per farmaci intra ed extra PTA al
netto dall’erogazione ai pazienti in dimissione ha fatto registrare nel 2013 un aumento di circa il 4,1 %
rispetto a quella del 2012.
Nelle successive tabelle 4 e 4a sono descritte le evidenze che mostrano i riferimenti agli andamenti
rilevati.
Tabella 4 Andamento dei consumi e spesa nell’anno 2013 dei farmaci, suddivisi per categorie
terapeutiche secondo la classificazione ATC (sistema di classificazione dei farmaci Anatomico
Terapeutico Chimico)
ATC Descrizione Unità 2013 Valore 2013 % sul % valore cumulativa totale L Farmaci antineoplastici e immunomodulatori 267.626 15.629.709 44,8 44,8 J Antimicrobici generali per uso sistemico 1.662.623 9.774.456 28,0 72,8 B Sangue e organi emopoietici 2.713.549 4.506.077 12,9 85,7 S Organi di senso 65.255 1.461.295 4,2 89,9 V Vari 165.796 926.604 2,7 92,6 N Sistema nervoso 1.200.491 691.198 2,0 94,6 A Apparato gastrointestinale e metabolismo 1.418.087 590.106 1,7 96,2 M Sistema muscolo‐scheletrico 368.836 423.773 1,2 97,5 R Sistema respiratorio 290.659 342.768 1,0 98,4 C Sistema cardiovascolare 1.536.331 173.917 0,5 98,9 H Preparati ormonali sistemici, esclusi gli ormoni sessuali 405.084 127.787 0,4 99,3 G Sistema genito‐urinario e ormoni sessuali 80.936 118.881 0,3 99,6 D Dermatologici 51.683 89.363 0,3 99,9 P Farmaci antiparassitari, insetticidi e repellenti 44.426 33.113 0,1 100,0 TOTALE 10.271.382 34.889.047 *Nota: nella tabella mancano i farmaci privi di classificazione ATC (es. alcuni farmaci galenici, farmaci esteri ecc.) che
costituiscono la differenza tra €34.924.735 della tabella 3a e € 34.889.047 della tabella 4. [fonte software Sisifo. Consumi
rilevati come flussi di “Trasferimento alle UU.OO.” Valore senza IVA]
Come appare dalla tabella 2, le prime tre classi ATC - farmaci Antineoplastici ed Immunomodulatori,
farmaci Antimicrobici e farmaci del Sistema Sangue - costituiscono una spesa pari all’85,7% della
spesa totale.
140
Tabella 4a
A Descrizione T C L Unità 2013 Delta unità Valore 2013 Valore 2012 Delta valore 279.030 ‐11.404 15.629.709 14.853.486 776.224 1.732.185 ‐69.562 9.774.456 9.771.295 3.162 B Farmaci antineoplastici immunomodulatori Antimicrobici generali per sistemico Sangue e organi emopoietici 2.713.549 2.692.849 20.700 4.506.077 4.025.568 480.508 S Organi di senso 65.255 88.332 ‐23.077 1.461.295 602.928 858.367 V Vari 165.796 165.547 249 926.604 982.694 ‐56.090 N Sistema nervoso 1.200.491 1.139.018 61.473 691.198 871.298 ‐180.099 A e 1.418.087 1.455.152 ‐37.065 590.106 894.689 ‐304.584 M Apparato gastrointestinale metabolismo Sistema muscolo‐scheletrico 368.836 370.848 ‐2.012 423.773 614.391 ‐190.618 R Sistema respiratorio 290.659 273.835 16.824 342.768 342.426 342 C Sistema cardiovascolare 1.536.331 1.529.721 6.610 173.917 179.923 ‐6.006 H Preparati ormonali sistemici, esclusi 405.084 gli ormoni sessuali 397.873 7.211 127.787 151.706 ‐23.918 G Sistema genito‐urinario e ormoni 80.936 sessuali Dermatologici 51.683 82.493 ‐1.557 118.881 147.425 ‐28.544 J D P e 267.626 Unità 2012 uso 1.662.623 Farmaci antiparassitari, insetticidi e 44.426 repellenti Totale 10.271.382 50.341 1.342 89.363 83.147 6.216 42.780 1.646 33.113 25.106 8.007 10.300.004 ‐28.622 34.889.047 33.546.080 1.342.967 La tabella 4a mostra l’andamento dei consumi e dei costi relativi per farmaci suddivisi per categoria
terapeutica come da classificazione ATC nel confronto tra 2012 e 2013. In particolare la categoria dei
farmaci antineoplastici ed immunomodulatori (ATC L) ha fatto registrare nel 2013 un aumento della spesa
relativa di circa l’5% rispetto a quella del 2012.
La categoria dei farmaci del sangue (ATC B) ha fatto registrare un aumento della spesa rispetto al 2013
con particolare riferimento al trattamento di pazienti emofilici.
La categoria dei farmaci per organi di senso (ATC S) ha registrato un forte aumento di spesa derivante
dai trattamenti intravitreali con Lucentis (ranibizumab) in seguito alle disposizioni di AIFA che hanno
sostanzialmente modificato l’orientamento prescrittivo di fatto escludendo la terapia intravitreale con
Avastin (bevacivumab) a costi rilevantemente più bassi. La tabella mostra il dettaglio dei consumi di
Lucentis correlati a un costante aumento del numero di pazienti e l’andamento della spesa 2012-2012 in
parte temperato da una riduzione del costo/fiala (€ 1044.99 nel 2012 fino a € 667,53 nel corso del
2013).
Tabella di dettaglio Lucentis intravitreale
Unità Unità 2012 Delta 2013 Unità ranibizumab (Lucentis ) 1.841 563 1.278 Valore 2013 Valore 2012 Delta Valore 1.321.414 511.681 809.733 Si sono registrati risparmi nelle categorie dei farmaci del sistema nervoso (ATC N) e dell’apparato
muscolo scheletrico (ATC M) principalmente come conseguenza di scadenza brevettuali e dell’immissione
in commercio di farmaci generici con una complessiva riduzione dei costi. La riduzione della spesa per i
farmaci dell’apparato gastrointestinale (ATC A) è correlato alla sospensione di trattamenti per pazienti
con malattia rara (1 paziente trattato con alglucosidasi Myozime - € 244.977 e 1 paziente trattato con
idursulfase Elaprase - € 37.896)
La tabella 5 mostra il dettaglio dei primi 35 farmaci in ordine decrescente di spesa nell’anno 2013 ed il
loro rapporto differenziale con l’anno 2012.
141
3. Obiettivi istituzionali e strategie aziendali
Fonte software aziendale Sisifo. Consumi rilevati come flussi di “Trasferimento alle UU.OO.” Valore senza IVA
Tabella 5 Primi 35 articoli per spesa 2013
Unità Unità ATC Articolo 2013 2012 L04 S01 L04 J05 L01 J05 L01 L04 B02 J05 L01 L04 L01 3. Obiettivi istituzionali e strategie aziendali
J05 L01 B02 J06 J02 J05 J05 L01 J02 J05 L01 L04 B02 B05 INFLIXIMAB MG 100 FL EV RANIBIZUMAB FL ML0,23 (MG 10/ML) ADALIMUMAB MG 40 FL‐
SIRINGA o PENNA ML 0,8 ABACAVIR MG 600 + LAMIVUDINA MG 300 CP RIVESTITA TRASTUZUMAB 150 MG FL EV EMTRICITABINA MG 200 + TENOFOVIR DISOPROXIL MG 245 CP RITUXIMAB 500MG/50ML FLAC. EV ETANERCEPT MG 50 SIRINGA OCTOCOG ALFA 1000U.I. ( FATTORE VIII RICOMBINANTE ) FL EV ( BHK ) EFAVIRENZ / EMTRICITABINA/TENOFOVIR DISOPROXIL ( MG 600+200+245) CP BORTEZOMIB MG 3,5 FL ECULIZUMAB MG 300 FL ML 30 EV PEMETREXED ( DISODICO) 500 MG FLAC. EV LOPINAVIR MG 200 + RITONAVIR MG 50 COMPRESSA OS BEVACIZUMAB 400 MG/ 16 ML ( CONC. PER SOLUZ. PER INFUS. ) EPTACOG ALFA ATTIVATO 5 MG (1MG/ML) 250 KUI FLl IMMUNOGLOBULINA UMANA ENDOVENOSA FL.MG 5000 AMFOTERICINA B LIPOSOMIALE 50 MG FL ATAZANAVIR SOLFATO MG 300 CP DARUNAVIR ETANOLATO MG 600 CP NILOTINIB CLORIDRATO MG 200 CP CASPOFUNGIN ACETATO MG 55,5 (= MG50) POLV + FL ML10 RALTEGRAVIR MG 400 CP RIV SUNITINIB MALATO MG 50 CP NATALIZUMAB MG 300 FL EV ML 15 EPTACOG ALFA ATTIVATO 1MG/ML ( 50 KUI ALBUMINA UMANA FL.20% ML Delta Unità Valore 2013 Valore 2012 Delta Valore Criterio di compensabilità 3.068 1.841 2.359 563 709 1.278 1.360.925 1.321.414 1.080.682 511.681 280.243 809.733 100% 100% 2.640 2.562 78 1.229.951 1.193.477 36.474 100% 98.550 99.330 ‐780 1.189.134 1.198.546 ‐9.412 100% 1.992 81.870 2.290 86.940 ‐298 ‐5.070 1.151.184 1.088.780 1.323.387 1.156.201 ‐172.203 ‐67.421 50% 100% 807 857 ‐50 1.063.779 1.129.689 ‐65.909 50% 4.416 1.337 4.500 338 ‐84 999 1.057.155 865.258 1.077.263 222.313 ‐20.108 642.945 100% 100% 37.020 34.710 2.310 732.909 687.166 45.743 100% 672 156 613 141 59 15 676.395 632.573 617.009 585.362 59.386 47.211 50% 100% 551 413 138 612.668 459.228 153.441 50% 211.560 248.280 ‐36.720 573.668 678.321 ‐104.653 100% 456 342 114 558.207 417.263 140.945 50% 161 126 35 526.349 411.926 114.424 100% 4.562 4.997 ‐435 478.793 567.831 ‐89.038 3.580 2.760 820 477.764 368.332 109.432 44.100 48.900 ‐4.800 445.777 503.643 ‐57.865 100% 53.280 49.500 3.780 426.240 396.000 30.240 100% 12.432 12.544 ‐112 405.959 409.617 ‐3.657 100% 999 593 406 400.768 237.782 162.986 47.460 2.130 226 42.300 2.040 213 5.160 90 13 375.614 362.055 356.123 377.181 346.194 335.638 ‐1.567 15.862 20.485 100% 100% 100% 533 112 421 348.502 73.231 275.271 100% 12.813 15.888 ‐3.075 344.873 428.832 ‐83.959 142
ATC L03 L01 L04 L01 L03 J01 L01 J01 Articolo Unità 2013 50 EV INTERFERONE BETA 1 A 30MCG 1.908 /0,5ML PENNA IM AZACITIDINA 100 MG 980 Unità 2012 Delta Unità Valore 2013 Valore 2012 Delta Valore Criterio di compensabilità 1.108 800 329.040 191.078 137.962 100% 250 730 313.093 79.817 233.276 1.449 1.239 210 309.434 300.391 9.043 100% 1.662 1.160 1.042 1.124 620 36 284.068 283.144 183.621 274.357 100.448 8.787 100% 4.910 3.650 1.260 262.188 194.959 67.229 GEFITINIB MG 250 CP OS 3.420 TEICOPLANINA 400MG/3ML 7.675 POLV. E SOLV. X SOL. INIETTABILE 4.560 9.753 ‐1.140 ‐2.078 249.698 247.365 332.930 318.435 ‐83.233 ‐71.070 100% LENALIDOMIDE 10 MG capsule rigide OS CETUXIMAB 100 MG FLAC EV INTERFERONE BETA 1 A CARTUCCIA SC 24.MUI/ML ( 44MCG/0.5ML) LINEZOLID 2MG/ML 300ml Le prime 35 molecole riportate in tabella 5 sono in gran parte appartenenti alle categorie terapeutiche
(ATC) prime nella classifica della spesa.
L’elenco include molti farmaci soggetti a compensazione economica completa (es.: antiretrovirali,
anticorpi monoclonali e farmaci biologici impiegati in reumatologia, dermatologia, gastroenterologia)
come osservabile nell’ultima colonna di destra della tabella.
Si conferma quindi che gli elementi rilevanti di tale tabella in riferimento alle molecole a maggior
induzione di aumento di spesa sono i farmaci antitumorali, gli anticorpi monoclonali e gli antiretrovirali
oggetto pertanto di particolari azioni di monitoraggio.
Appropriatezza d’uso di farmaci specialistici da parte di Centri Autorizzati e monitoraggio
L’attività di governo clinico ha consolidato l’analisi dell’appropriatezza d’uso dei farmaci, dell’adesione
alle indicazioni normative, ai percorsi regionali e aziendali, alle Linee Guida e Raccomandazioni Regionali,
di monitoraggio della prescrizione da parte di Centri Autorizzati.
L’azione di monitoraggio della prescrizione è stata in particolar modo diretta ai farmaci specialistici nelle
aree di oncologia, ematologia, reumatologia (uso di biologici in artrite reumatoide e artrite psoriasica),
oculistica (trattamento della DMLE), dermatologia (biologici in psoriasi), neurologia (sclerosi multipla) e ai
nuovi farmaci della coagulazione.
Tabella 6 Dettaglio classe L
ATC Descrizione Unità 2013 L01 Antineoplastici 153.175 L04 immunosoppressivi 93.164 L03 Immunostimolanti 17.019 L02 Terapia endocrina 4.268 Totale 267.626 Unità 2012 156.570 101.713 18.262 2.485 279.030 Delta unità ‐3.395 ‐8.549 ‐1.243 1.783 ‐11.404 Valore 2013 8.589.225 5.707.345 1.144.837 188.302 15.629.709 Valore 2012 7.985.843 5.515.042 1.190.619 161.982 14.853.486 Delta valore 603.382 192.303 ‐45.782 26.321 776.224 La tabella 6 mostra nel dettaglio la classe ATC L “Antineoplastici e immunomodulatori” che ha
rappresentato nel 2013 il 44,8% della spesa totale.
In particolare per la sottoclasse ATC L01 l’aumento della spesa è correlato da una parte all’immissione in
commercio di farmaci oncoematologici innovativi ad alto costo sia per uso orale che endovenoso destinati
a stadi avanzati/metastatici dall’altra ad un aumento della casistica e a trattamenti di più lungo periodo.
Nel 2013 una parte della spesa a carico degli Antineoplastici è stata controbilanciata dall’ampliamento
della lista dei farmaci oncoematologici infusionali in regime di compensazione economica al 50%.
Per la classe L03 Immunostimolanti si conferma la riduzione del consumo e della spesa già evidenziata
nel 2012: il risparmio in questa classe è determinato dal filgrastim e da alcuni interferoni per il
trattamento della sclerosi multipla (tabella 6a).
La sequenza delle tabelle 6a-6b-6c-6d mostra l’andamento dei farmaci, in particolare biologici ed
anticorpi monoclonali, nelle principali malattie a carico del sistema immunitario nel confronto tra 2012 e
2013.
143
3. Obiettivi istituzionali e strategie aziendali
Fonte software aziendale Sisifo. Consumi rilevati come flussi di “Trasferimento alle UU.OO.” Valore senza IVA
Nell’ambito del trattamento della sclerosi multipla per il 2013 si registra un aumento contenuto dei più
recenti farmaci natalizumab (Tysabri) e fingolimod (Gilenya)
Per malattia dermatologica e in reumatologia nel 2013 si registra un aumento dei pazienti trattati con
farmaci biologici rispetto al 2012.
L’effetto complessivo è di incremento. La prescrizione e l’appropriatezza prescrittiva dei farmaci vengono
monitorati costantemente per singolo paziente dal Servizio di Farmacia e Governo Clinico del Farmaco in
adesione alle linee-guida e raccomandazioni nazionali e regionali.
Una parte rilevante dei farmaci esposti nella sequenza anzidetta è a compensazione economica in quanto
erogati o somministrati in regime ambulatoriale
Tabella 6a Farmaci per sclerosi multipla
Unità 2013 Unità 2012 Delta unità Valore 2013 Valore 2012 Delta valore INTERFERONE BETA 1 A 30MCG /0,5ML PENNA IM 1.908 1.108 800 329.040 191.078 137.962 INTERFERONE BETA 1A 30MCG(6MIL.U.I.)ML 212 1.252 ‐1.040 36.560 215.911 ‐179.351 INTERFERONE BETA 1 A CARTUCCIA SC 24.MUI/ML ( 44MCG/0.5ML) GLATIRAMER ACETATO MG 20 (= MG18 BASE) FL‐SIRINGA 1.160 1.124 36 283.144 274.357 8.787 6.832 6.776 56 162.452 161.122 1.330 544 176 130.705 98.755 31.950 912 ‐324 47.842 74.203 ‐26.362 324 ‐48 16.701 19.606 ‐2.905 INTERFERONE BETA 1 A CARTUCCIA SC 12.MUI/ML 720 ( 22MCG/0.5ML) INTERFERONE BETA1‐A 44MCG/0,5ML (=12MIL U.I) SIR. 588 P.U INTERFERONE BETA 1‐A 22MCG(6 MIL. U.I.*) SIR. P.U. 1ML 276 INTERFERONE BETA‐1B 0,25MG (8MIL. U.I.)/ML FL 135 435 ‐300 4.948 16.538 ‐11.589 NATALIZUMAB MG 300 FL 226 213 13 356.123 335.638 20.485 23.625 FINGOLIMOD CLORIDRATO 0,5 MG CP 476 420 56 26.775 Totale 12.533 13.108 ‐575 1.394.290 1.410.833 3. Obiettivi istituzionali e strategie aziendali
Tabella 6b Biologici in dermatologia ( psoriasi, artrite psoriasica )
Unità 2013 Unità 2012 Delta Unità Valore 2013 3.150 ‐16.542 Valore 2012 Delta Valore INFLIXIMAB 272 305 ‐33 120.656 139.724 ‐19.068 ADALIMUMAB 208 142 66 96.905 66.149 30.756 ETANERCEPT mg 50 724 700 24 173.320 167.574 5.746 USTEKINUMAB 0.5mg 5 3 2 14214,4 8528,64 5.686 USTEKINUMAB 1mg 5 0 5 14210 0 14.210 Totale 1.214 1.150 64 419.305 381.975 37.330 Tabella 6c Biologici in reumatologia (adulti/pediatrici) ( artrite reumatoide , artrite psoriasica, spondilite anchilosante )
Unità 2013 Unità 2012 Delta Unità Valore 2013 Valore 2012 Delta Valore INFLIXIMAB 875 771 104 388.139 353.203 34.936 ADALIMUMAB 2.384 2.280 104 1.110.683 1.062.111 48.572 ETANERCEPT mg 50 3.688 3.776 ‐88 882.878 903.943 ‐21.065 CERTOLIZUMAB 48 8 40 16.393 2.732 13.661 GOLIMUMAB 44 14 30 42.820 13.625 29.195 TOCILIZUMAB 4ml 9 1 8 1.225 136 1.089 TOCILIZUMAB 10ml 1 0 1 340 0 340 TOCILIZUMAB 20ml 7 1 6 4.764 681 4.083 ABATACEPT 432 474 ‐42 134.589 152.410 ‐17.821 RITUXIMAB 500mg 38 68 ‐30 50.091 89.637 ‐39.546 Totale 7.526 7.393 133 2.631.922 2.578.477 53.446 144
REUMATOLOGIA PEDIATRICA ETANERCEPT 25mg* ABATACEPT Totale unità 2013 144 18 162 unità 2012 136 39 175 delta unità 8 ‐21 ‐13 valore 2013 17.236 5.608 22.844 valore 2012 16.279 12.540 28.819 delta valore 958 ‐6.932 ‐5.975 * in compensazione
Tabella 6d Biologici in gastroenterologia
GASTROENTEROLOGIA ADULTI unità 2013 unità 2012 INFLIXIMAB 97 169 ADALIMUMAB 6 12 Totale 103 181 GASTROENTEROLOGIA PEDIATRICA unità 2013 INFLIXIMAB 1.540 ADALIMUMAB 270 Totale 1.810 unità 2012 1.419 270 1.689 (adulti/pediatrici)
delta unità valore 2013 ‐72 43.028 ‐6 2.795 ‐78 45.823 delta unità 121 0 121 valore 2013 683.124 125.790 808.915 valore 2012 77.421 5.590 83.011 delta valore ‐34.393 ‐2.795 ‐37.187 valore 2012 650.058 125.776 775.835 delta valore 33.066 14 33.080 Tabella 7 ATC B Sangue e organi emopoietici
ATC Articolo Qta 2013 Qta 2012 B02 Antiemorragici 38.371 Delta unità 514 2.243.902 1.563.438 Delta valore 680.464 B05 Succedanei del sangue e 1.819.011 soluzioni perfusionali 1.797.922 21.089 1.303.536 1.474.819 ‐171.284 B01 Antitrombotici 769.018 767.337 1.681 783.311 762.781 20.530 B03 farmaci antianemici 86.557 89.105 ‐2.548 174.414 223.417 ‐49.002 B06 Altri agenti ematologici 78 114 ‐36 817 1.114 ‐298 Totale 2.713.549 2.692.849 20.700 4.505.980 4.025.568 480.411 38.885 Valore 2013 Valore2012 Uso razionale e sicuro dei farmaci
La registrazione dei farmaci che prevedono l’accesso ai “Registri di monitoraggio AIFA” è stata sottoposta
a un controllo strutturato sulla prescrizione e sull’erogazione.
L’attento monitoraggio sulla corretta gestione del Registro AIFA per i farmaci oncologici sottoposti a
regime di “rimborso economico” ha consentito di ottenere un recupero economico per l’anno 2013 pari a
59.141,98€ a cui si aggiunge una quota di rimborsi attesi alla riattivazione della funzione AIFA,
momentaneamente sospesa.
Le attività di farmacovigilanza indirizzate al miglioramento del monitoraggio degli aspetti di sicurezza
nell’uso dei farmaci sono proseguite e si sono consolidate nel corso del 2013 in particolare attraverso la
realizzazione dei progetti regionali nell’ambito oncoematologico e del Pronto Soccorso. È stato stilato e
diffuso il “Report Farmacovigilanza 2013”, che considera:
 l’analisi delle segnalazioni di sospetta reazione avversa da Farmaco;
 i progetti di farmacovigilanza attiva:
- Monitoraggio Epidemiologico di Reazioni ed Eventi Avversi da Farmaci in Pronto Soccorso;
- Sviluppo di una Rete Regionale integrata di Farmacovigilanza finalizzata a migliorare la Sicurezza
del Paziente oncologico.
Nell’ambito della gestione del rischio clinico in corso di terapia farmacologica è stato sviluppato un
progetto indirizzato al tema della “Ricognizione come premessa alla prescrizione”
Già a partire dal 2010 l’Azienda Ospedaliero-Universitaria ha svolto un’indagine attraverso la
somministrazione di un questionario rivolto ai Coordinatori, volto ad esplorare le procedure seguite nelle
145
3. Obiettivi istituzionali e strategie aziendali
Per la classe ATC B “Sangue e organi emopoietici” (tabella 7) si conferma sia in termini assoluti che di
scostamento rispetto al 2012 l’aumento di spesa in particolare a carico dei farmaci per il trattamento
dell’emofilia (Fattori della coagulazione, sottoposti a compensazione economica).
UU.OO. e valutare quanto queste si avvicinassero effettivamente alle indicazioni contenute nella
Raccomandazione Regionale “Sicurezza nella terapia farmacologica: la Ricognizione premessa alla
Prescrizione”.
L’indagine ha evidenziato che molte informazioni erano rilevate, ma non in modo omogeneo. Gli
strumenti utilizzati per la ricognizione erano numerosi e non strutturati; la ricognizione era svolta
prevalentemente da più operatori con l’utilizzo di più di uno strumento, determinando sovrapposizioni,
ridondanze e rischi.
A partire dal 2011 una nuova scheda è stata diffusa in tutta l’Azienda.
Da Aprile 2013, in occasione del “Programma AUDIT Clinici nell’ambito della Sicurezza nella Gestione
Clinica dei Farmaci”, promosso dalla ASSR Emilia Romagna, l’AOUPR ha condiviso con i professionisti un
progetto di verifica del processo di ricognizione-riconciliazione farmacologica per una prescrizione corretta
e sicura. L’Audit ha verificato che l’89,2% del totale delle Cartelle Cliniche (CC) analizzate (n=232)
dispone della scheda (si consideri che l’assenza della scheda è stata rilevata fra le CC di una sola
struttura).
L'esperienza dell'Azienda è stata presentata in occasione del Workshop Internazionale, promosso dalla
Agenzia Sanitaria e Sociale Regionale, "Per la sicurezza dei pazienti - Patient Safety Practices" tenutosi a
Bologna il 9 settembre 2013.
Nell’ambito dei percorsi indirizzati all’uso sicuro dei farmaci si inserisce anche l’attività di galenica clinica
sviluppata nell’Area “Preparati non sterili“, nell’Area Oncoematologica (“Rete delle Farmacie
Oncologiche”) e nell’Area di “Preparazione delle Terapie Nutrizionali in Neonatologia”.
GALENICA CLINICA: AREA “PREPARATI NON STERILI”
3. Obiettivi istituzionali e strategie aziendali
L'attività del laboratorio galenico è finalizzata all’allestimento di preparazioni farmaceutiche, reagenti
e disinfettanti in dose e non reperibili in commercio. La produzione è completamente orientata alla
personalizzazione della terapia in risposta alle esigenze del singolo paziente o di specifiche popolazioni di
pazienti (anziani, pazienti in età pediatrica, eccetera) con particolare orientamento alle situazioni ove
emerga l’assenza di alternative terapeutiche
Nell’anno 2013 le preparazioni galeniche allestite sono state 38.074. Il valore indica aumento dell’attività
(+ 6 %) rispetto all’anno precedente.
Nel dettaglio sono state allestite:
•
n° 29.690 forme orali (capsule/cartine/soluzioni/sospensioni): produzione in aumento rispetto al
2012 in particolare a carico di forme farmaceutiche in dose unica per somministrazione orale
pediatrica (+63%)
•
n° 7.574 forme topiche (antisettici/creme/soluzioni/sospensioni): produzione che fa registrare un
aumento d’attività rispetto al 2012 (+10%)
•
n° 559 disinfettanti in diluizioni pronte all’uso: produzione in leggero decremento rispetto al 2012.
•
n° 251 reagenti ad uso laboratorio: produzione numericamente stabilizzata rispetto al 2012.
GALENICA CLINICA: AREA PREPARAZIONE TERAPIE NUTRIZIONALI IN
NEONATOLOGIA
La nutrizione parenterale è parte integrante della terapia nel neonato critico, soprattutto con prematurità
estrema e nel neonato in condizioni chirurgiche. In tale contesto le specifiche necessità cliniche non
sempre consentono l’utilizzo di miscele nutrizionali prodotte industrialmente ma necessitano di una
preparazione estemporanea personalizzata.
Al fine di migliorare gli standard tecnologici di preparazione e il controllo delle miscele personalizzate nel
rispetto dei requisiti di qualità e sicurezza dei medicamenti, da agosto 2013 è stata avviata l’attività di
allestimento di miscele per nutrizione parenterale totale in una specifica area presso l’U.O. di
Neonatologia, Ospedale dei Bambini, ove è allocato un isolatore dedicato.
Tutta l’attività avviene in adesione a una specifica procedura da parte di operatori selezionati e formati.
L’organizzazione e la programmazione dell’attività e dei controlli prevede in particolare la collaborazione
della U.O. di Neonatologia, del Servizio di Farmacia e della UOC di Igiene Ospedaliera e Medicina
Preventiva.
L’attività è sottoposta a regolari controlli microbiologici/particellari effettuati secondo una procedura
predefinita. I controlli microbiologici ambientali e su sacche campione sono realizzati in collaborazione
con il Laboratorio di Allergologia e Aerobiologia dell’UO Clinica ed Immunologia Medica e con il
Laboratorio dell’Unità di Sanità Pubblica Dipartimento S.Bi.Bi.T dell’Università degli Studi di Parma a
garanzia della qualità e la sicurezza delle procedure di allestimento adottate.
146
Da agosto a dicembre, sono state allestite 293 sacche personalizzate per Nutrizione Parenterale,
prevalentemente per soddisfare i fabbisogni dei neonati pretermine.
Rete delle Farmacie Oncologiche
UMaCA, accanto agli obiettivi di assicurazione di
qualità dei medicinali allestiti e di sicurezza del
paziente e degli operatori, ha consolidato l’obiettivo di
razionalizzare l’impatto economico delle terapie
oncologiche
attraverso
la
costante
analisi
dell’appropriatezza prescrittiva per singolo paziente e
la programmazione delle preparazioni per farmaci ad
alto costo secondo “drug day” al fine di abbattere gli
scarti di produzione e i relativi costi.
I dati di produzione relativi al 2013 sono riportati nella
tabella sinottica sottostante.
Dati attività laboratorio oncologico UMaCA
2013 53.864 Totale terapie allestite (oncologiche, ancillari e sperimentali) 21.902 Totale terapie oncologiche (18.943 citotossici + 2.959* anticorpi monoclonali) 31.962 Totale allestimenti ancillari 1.781 Totale pazienti trattati (di cui 0 per Bevacizumab intravitreale) Totale accessi 15.702 Totale schemi terapeutici validati e 934 inseriti in banca dati Totale UU.OO. arruolate 33 147
2012 52.158 20.254 (17.000 citotossici + 3.399* anticorpi monoclonali) 31.904 2.082 (di cui 394 per Bevacizumab intravitreale) (1688 per altre terapie 1688 pz) 14.451 795 30 3. Obiettivi istituzionali e strategie aziendali
Il Laboratorio di Farmacia Oncologica (UMaCA - Unità Manipolazione Chemioterapici Antiblastici) ha
totalmente centralizzato la preparazione le terapie infusionali prescritte per il trattamento di patologie
oncologiche, ematologiche e di malattie autoimmuni, registrando un’ulteriore espansione dell’attività in
termini di numero totale di terapie allestite (oltre 53.000 corrispondente a +3% rispetto al 2012) e
numero di accessi (+8,6% rispetto al 2012), nonché in termini di analisi e predisposizione, in
condivisione con i medici, di nuovi schemi terapeutici nell’ambito della terapia farmacologica EBM e
nell’area dei protocolli sperimentali di ricerca: il database degli schemi terapeutici è una realtà dinamica
che viene continuamente aggiornata: nel 2013 sono stati analizzati e predisposti, in collaborazione con i
clinici, 139 nuovi schemi di terapia (+17%) per un totale di 934 schemi..
Nel corso del 2013 si è ultimato l’arruolamento dell’U.O. Oncoematologia Pediatrica, iniziato nel 2012:
sono stati presi in carico 42 pazienti (2.4% del totale) per 860 accessi (5.5% del totale).
In totale nel 2013 l’attività di UMaCA ha coinvolto 33 Unità Operative.
Nel corso del 2013 l’esperienza “Qualità e sicurezza delle cure in ambito oncoematologico: il Progetto
UMaCA nell'Azienda Ospedaliero-Universitaria di Parma” è stata valutata come Buona Pratica (giudicata
dall’Osservatorio Buone Pratiche - AGENAS, mediante le linee guida SQUIRE) [allegato n. 2]. L’esperienza
è
stata
inoltre
selezionata
nell'ambito
del
sistema
Joint
Action
PaSQ
(www.pasq.eu
<http://www.pasq.eu>) per essere condivisa tra i Paesi Europei delle buone pratiche per la sicurezza dei
pazienti.
Dettaglio ATTIVITA’ UMaCA 2013 vs 2012
* ANTICORPI MONOCLONALI: Principio attivo Bevacizumab AVASTIN® Brentuximab Vedotin Cetuximab Infliximab Ipilimumab Ofatumumab Rituximab Trastuzumab Anticorpi Monoclonali sperimentali ADCETRIS® ERBITUX® REMICADE® YERVOY® ARZERRA® MABTHERA® HERCEPTIN® Allestimenti eseguiti 2013 524 (endovena) 0 (intravitreale) 16 351 197 11 0 719 837 304 Allestimenti eseguiti 2012 449 (endovena) 870 (intravitreale) 0 224 0 3 8 742 969 134 Nel 2013 UMaCA ha registrato un’attività costante di analisi e inserimento nel database di nuovi protocolli
sperimentali di ricerca approvati dal Comitato Etico e un incremento del numero di pazienti trattati
nell’ambito di studi clinici e degli accessi per paziente (tabelle A e B).
3. Obiettivi istituzionali e strategie aziendali
Tabella A Studi sperimentali sponsorizzati o no profit presi in carico da UMaCA e suddivisi per
UU.OO
Numero studi sperimentali presi in carico da UMaCA Totale studi UO Oncologia UO Ematologia Altre UUOO Studi Studi no profit sponsorizzati 2010 17 16 1 4 13 2011 12 11 1 ‐ 7 5 2012 18 12 5 1 15 3 2013 17 10 5 2 13 4 N° totale studi 72 50 18 4 40 32 Tabella B Numero pazienti trattati nell’ambito di protocolli sperimentali
Numero pazienti trattati nell'ambito di studi sperimentali presi in carico da UMaCA Numero pazienti Numero accessi per paziente 2010 27 226 2011 57 493 2012 67 652 2013 141 1679 Governo dei Dispositivi Medici
La Commissione Aziendale sui DM (CADM) ha consolidato la sua attività di analisi e di autorizzazione
all’utilizzo dei DM in base alle evidenze scientifiche di efficacia e di sicurezza valutandone la ricaduta
gestionale e la sostenibilità economica.
Sono state condotte tutte le operazioni di anagrafica dei DM secondo la CND ed è stato costantemente
aggiornato il Repertorio Aziendale permettendo la regolare generazione del flusso sui consumi e spesa
(flusso DiMe). Nel 2013 è stato raggiunto oltre il 90% della copertura della rilevazione nel flusso DiMe
rispetto alla spesa sostenuta, del tutto in linea con la media regionale.
Sono stati recepiti e implementati i documenti d’indirizzo elaborati a livello regionale. Per i prodotti a
bassa complessità tecnologica e di largo consumo (suturatrici meccaniche, guanti monouso non chirurgici,
medicazioni per ferite, piaghe ed ulcere) si è proceduto al monitoraggio e alla revisione dell’utilizzo.
In particolare in riferimento alla razionalizzazione nell’uso delle suturatrici meccaniche (CND H02) sono
stati condotti incontri presso il Dipartimento di Chirurgia con l’obiettivo di elaborare linee d’indirizzo la cui
adozione nel 2013 ha consentito una riduzione della spesa a carico di tali DM.
148
CND H – DISPOSITIVI DA SUTURA - Sottoclasse H02 – suturatrici meccaniche
CND H0203 H0202 H0299 H0201 DESCRIZIONE CND SUTURATRICI PER VIDEOCHIRURGIA SUTURATRICI PER CHIRURGIA APERTA SUTURATRICI MECCANICHE‐ ALTRE SUTURATRICI CUTANEE TOTALE H02 SUTURATRICI MECCANICHE Q.TA’ VALORE IN € Q.TA’ VALORE IN DELTA DELTA DELTA % 2012 S/IVA 2012 2013 € Q.TA’ VALORE IN € VALORE IN ‐57
S/IVA ‐7.450 € ‐2,14 %
S/IVA 1944 348.305
1887
2013 34..855
1076 215.673
993
193.760
‐83
‐21.913 ‐ 10,16%
156 72.324
168
62442
12
‐9.882 ‐13,66%
2514 10981
2448
9549
‐66
‐1.431 ‐13,04%
5690 647.283
5496
606.607
‐194
‐40.676 ‐6,28%
In relazione all’uso dei DM “guanti monouso non chirurgici” si è proceduto nel corso del 2013 a un’analisi
dei consumi e a una progressiva sostituzione dei DM in lattice con l’alternativa in nitrile rispondenti ai
criteri di qualità e sicurezza consentendo una riduzione della spesa.
L’attività di Dispositivo-Vigilanza è stata costantemente presidiata in adesione alla normativa.
Secondo l’indirizzo regionale la gestione dei campioni gratuiti è stata inserita in uno specifico percorso
aziendale che prevede anche l’attivazione di uno registro dedicato.
L
Farmaci antineoplastici e immunomodulatori
279.029
14.853.084
%
sul
valore
totale
44,3
J
Antimicrobici generali per uso sistemico
1.732.161
9.771.320
29,1
73,4
B
Sangue e organi emopoietici
2.692.666
4.025.500
12,0
85,4
ATC
DESCRIZIONE
Unità 2012
Valore 2012
%
cumulativa
44,3
L’Azienda Ospedaliero-Universitaria di Parma ha sempre programmato annualmente l’invio della
documentazione necessaria e prevista per l’Accreditamento Istituzionale dei Dipartimenti.
Nel corso del 2013, in accordo con quanto concertato in sede di Budget, la SSD Governo clinico ha
promosso un incontro con il Responsabile di Area Accreditamento dell’ASSR per la definizione di una
programmazione di massima dell’invio delle domande e delle successive visite di Accreditamento per i
Dipartimenti dell’Azienda. Tale Programmazione si è resa indispensabile per poter meglio pianificare
tutte le attività inerenti l’aggiornamento della documentazione necessaria a dare visibilità del sistema
di qualità dell’Azienda.
Risultati raggiunti
È stato predisposto un Piano Programma Pluriennale (2013-2016) che tiene conto dei vincoli e delle
indicazioni della D.G.R. 21 gennaio 2013 n. 53 “Indicazioni operative per la gestione dei rapporti con le
strutture sanitarie in materia di Accreditamento” e che è stato oggetto di confronto in Collegio di
Direzione.Il Collegio di Direzione ha esaminato e approvato il Piano Programma nell’incontro del
7/05/2013.
Al fine di condividere con tutti i professionisti dell’Azienda la programmazione sia della realizzazione
delle domande di Accreditamento che delle visite intermedie e delle visite esterne regionali per
l’Accreditamento istituzionale, il Piano Programma Accreditamento è stato pubblicato nel sito Intranet
aziendale.
Per il 2013 era previsto l’invio all’Agenzia Sanitaria e Sociale della Regione delle seguenti domande:
•
Dipartimento Medico Polispecialistico
•
Dipartimento Testa Collo
•
Dipartimento di Patologia e Medicina di Laboratorio
•
Dipartimento di Radiologia e Diagnostica per Immagini.
Per il 2013 era prevista l’effettuazione della Visita di Accreditamento:
•
Dipartimento Cardio Nefro Polmonare
Il Piano Programma, nel corso del 2013, è stato oggetto di condivisione sia con i professionisti
dell’Azienda che hanno il titolo di Valutatori Regionali ai fini dell’Accreditamento che con i professionisti
che partecipano al Corso di Formazione Interattiva realizzati per sostenere i Dipartimenti nel processo
149
3. Obiettivi istituzionali e strategie aziendali
Pianificazione delle attività inerenti l'Accreditamento istituzionale
di Accreditamento. Il corso si è sviluppato in 8 giornate di formazione interattiva e ha previsto una
modalità di apprendimento attraverso il lavoro in piccoli gruppi multiprofessionali per ciascun
Dipartimento coinvolto (n=6); il corso, avviato a settembre 2013 e concluso a gennaio 2014, ha visto
la partecipazione di n=25 professionisti, di cui 18 hanno maturato il diritto ai crediti ECM (36 crediti).
I gruppi dei dipartimenti hanno redatto i documenti che sono stati di volta in volta verificati, discussi
negli incontri di formazione e in alcuni casi anche all’interno dei dipartimenti in riunioni di lavoro o di
Giunta.
Interventi in fase di sviluppo o in corso
Il grado di soddisfazione del Corso di Formazione Interattiva sull’Accreditamento è risultato più che
buono e utile per i professionisti che hanno espresso la richiesta che il corso venga rinnovato nel 2014
e integrato con ulteriori contenuti.
I partecipanti hanno lavorato a gruppi nella redazione dei documenti previsti, Manuale e Allegati, e si è
attivata una sinergia positiva che ha permesso ai gruppi che meglio conoscono il processo di
accreditamento di supportare i gruppi più “deboli” o con minore esperienza.
Percorsi specialistici
3. Obiettivi istituzionali e strategie aziendali
Programma Stroke
Nel 2013 si è osservato un consolidamento delle 2 aree di degenza dedicate allo stroke, che attualmente
dispongono complessivamente di 23 posti letto (pl): nove posti letto sono collocati nell’area stroke del
Dipartimento di Neuroscienze (8 pl- UU.OO. di Neurologia e 1 pl - Neurochirurgia), destinati ad
accogliere i pazienti fino a 70-75 anni e tutti i pazienti sottoposti a trombolisi i.v. e/o ad altre procedure
intra-arteriose (trombolisi intra-arteriosa, trombectomia, stent extra-intra cranico, embolizzazione di MAV
ed aneurismi). Altri 14 posti letto sono collocati nella “SS Stroke” della Clinica Geriatrica per i pazienti di
età superiore a 70-75 anni. Le due aree stroke ricoverano oltre il 70% di tutti gli ictus di questo
Ospedale.
La gestione intra-ospedaliera del paziente con stroke viene attuata nel rispetto delle indicazioni del PDT
– Ictus Cerebrale aziendale. I dati del 2013 sono sostanzialmente sovrapponibili agli anni precedenti.
L'analisi degli indicatori conferma l'esecuzione della TAC nel 100% dei pazienti che accedono con sospetto
ictus al PS, la valutazione fisiatrica entro 48 ore viene eseguita nel 100% dei pazienti, il 95% viene
correttamente allocato alla dimissione, infine il 100% esegue la prima visita di follow up a 1 mese
dall’evento acuto, la corretta allocazione dei pazienti nelle 2 aree stroke supera il 70% , in particolare, la
gestione da parte della Direzione Sanitaria del flusso dei pazienti, avviata negli ultimi 3 mesi del 2013, ha
fatto registrare un incremento dei ricoveri, soprattutto nell'area stroke della Clinica Geriatrica, del 40%.
Nel corso del 2013 l’attività ambulatoriale clinica, integrata con l’attività di diagnostica neurosonologica, è
stata ulteriormente incrementata. Tutti pazienti colpiti da stroke vengono sottoposti a regolare follow up
programmati a 1 – 6 – 12 mesi dall'evento e a successivi controlli a frequenza annuale.
La rete stroke provinciale è ben avviata e prevede la centralizzazione del paziente con stroke
principalmente presso l’Azienda Ospedaliero-Universitaria (3° livello), dove è possibile l’effettuazione
della trombolisi ev e di ogni tipo di procedura endovascolare. Per quest’ultima attività, l’Ospedale di
Parma accoglie pazienti provenienti anche dalle limitrofe provincie di Piacenza e Reggio Emilia. Nel corso
del 2013 gli interventi di trombolisi IA sono pressoché raddoppiati, mentre le procedure di trombolisi IV
hanno avuto un incremento del 30%.
Programma epilessia
Percorso Diagnostico-Terapeutico “La Prima Crisi Epilettica nell’Adulto”
L’Azienda ha definito il percorso dedicato alla Prima Crisi Epilettica nell’adulto a fine 2012 attenendosi a
quanto indicato dal documento “Linee Guida per la Diagnosi e per la Terapia della Prima Crisi Epilettica”,
elaborato dal Gruppo di Studio per la Valutazione della Prima Crisi Epilettica della Lega Italiana contro
l’Epilessia (LICE). Le diverse fasi del percorso diagnostico e terapeutico dei pazienti con una prima crisi
epilettica sono definite alla luce dei livelli di evidenza scientifica finora prodotti, che giustificano la forza
delle raccomandazioni formulate nelle Linee Guida.
Percorso Diagnostico–Terapeutico-Assistenziale “Lo Stato di Male Epilettico nell’Adulto”
Nel gennaio 2013 è stato attivato il Gruppo di lavoro multidisciplinare e multiprofessionale costituito da
professionisti dell’AOU e dell’AUSL di Parma per la stesura del Percorso Diagnostico – Terapeutico Assistenziale “Lo Stato di Male Epilettico nell’Adulto” che vuole rappresentare una guida per la gestione,
150
nella fase pre-ospedaliera e ospedaliera, dello stato di male nell’adulto, sulla base delle linee guida
internazionali.
Una significativa novità di questa versione è l’integrazione Ospedale-Territorio attraverso il
coinvolgimento dei Medici dell’ Ospedale di Vaio (Fidenza):
• è indispensabile una coordinazione tra il territorio e l’ospedale e tra le diverse competenze
specialistiche assistenziale e attraverso la condivisione di percorsi diagnostico / terapeutici
comuni
• il team multidisciplinare garantisce la vera “integrazione” tra
i professionisti sia in fase
progettuale che in fase di implementazione ed attuazione del percorso
• l’integrazione costringe tutte le componenti che
intervengono nel percorso del malato a
confrontarsi e ad attuare le più idonee e le più fattibili soluzioni per migliorare l’efficacia,
l’efficienza e la qualità
• si è tenuto conto della variabilità e disomogeneità delle prestazioni sanitarie erogate, da superare,
attraverso un’efficace omogeneità
• il PDT, elaborato dai professionisti , individua tempi e modi di esecuzione degli esami e di
erogazione dei farmaci secondo le reali necessità dei pazienti.
La gestione del paziente necessita di un approccio multidisciplinare e integrato al fine di migliorare la
compliance del malato e la qualità della vita anche attraverso l’utilizzo di una rete di servizi
ospedale/territorio in quanto questa patologia limita l’attività sociale, relazionale, richiede un notevole
impegno assistenziale.
È stata individuata la disponibilità delle strutture, del personale e della strumentazione di entrambe le
Aziende, al fine di agevolare l’iter del paziente e al contempo ottimizzare la qualità dell’intervento
medico. Un sensato e coordinato approccio potrà contribuire a evitare ricoveri o terapie improprie.
I pazienti seguiti dal Centro ambulatorialmente sono circa 350, di cui 220 hanno effettuato visite nel
corso del 2011. Di questi, 51 erano nuovi accessi al Centro, 22 dei quali presentavano una sclerosi
multipla di recente insorgenza (casi incidenti). La metà dei casi incidenti (11 pazienti) è pervenuta al
Centro attraverso il Pronto Soccorso, mentre l’altra metà attraverso canali diversi (oculistica, medico di
base, altri specialisti eccetera).Dei rimanenti 31, 20 hanno effettuato visite di consulenza (per una
seconda opinione oppure per diagnosi differenziale), mentre 9 pazienti si sono trasferiti da altri Centri.
In accordo con la letteratura, i pazienti sono in maggioranza (79% circa) femmine e di giovane età
(oltre il 70% ha meno di 50 anni). Le visite ambulatoriali effettuate nel corso di un anno c/o il centro
SM sono circa 750, a cui si devono aggiungere una cinquantina di pazienti seguiti in DH/DS (dati
2011).
Risultati raggiunti
L’Azienda, recependo i suggerimenti della Giunta Regionale, aveva promosso la definizione di un PDTA
per la Sclerosi multipla (SM). Il progetto proponeva di realizzare un percorso interdisciplinare
sull’assistenza del paziente con SM. Si é partiti a livello locale con la costituzione di un Gruppo di
Lavoro, avvantaggiandosi della presenza all’interno dell’Azienda di un Centro dedicato per la Sclerosi
Multipla, già operativo da quasi 30 anni.
Nella descrizione delle diverse fasi del percorso diagnostico terapeutico il GLM si è attenuto, pur con
alcune modifiche legate alla situazione della realtà locale, a quanto indicato dal documento “PERCORSO
REGIONALE (EMILIA-ROMAGNA)DI DIAGNOSI E TERAPIA DELLA SCLEROSI MULTIPLA”, elaborato dal
Gruppo Neurologi Sclerosi Multipla della Regione Emilia-Romagna e dal CReVIF-Centro Regionale
Valutazione e Informazione sui Farmaci.
La strutturazione del PDT intende essere atto preliminare alla realizzazione di un modello assistenziale
integrato migliorativo indirizzato a fornire una guida al personale sanitario nelle diverse circostanze in
cui, sia nella fase iniziale della diagnosi che nella successiva presa in carico, viene in contatto con
pazienti con SM.
I primi obiettivi perseguibili del percorso sono rivolti a ottimizzare l’appropriatezza e l’efficacia delle
prestazioni con riguardo a tutte le figure coinvolte. Per il paziente questo intende tradursi nel
semplificarne il percorso, rendere più agile la programmazione delle indagini e soprattutto garantirne la
presa in carico per tutti gli aspetti riconducibili alla malattia. Per il personale sanitario gli obiettivi
restano quelli di coordinare al meglio gli interventi, garantire la continuità assistenziale ed ottimizzare
le risorse.
Il percorso assistenziale assicura la presa in carico del paziente e garantisce: la diagnosi tempestiva di
malattia; il monitoraggio clinico-strumentale; il trattamento secondo un progetto personalizzato;
trattamenti rivolti a modificare l’evoluzione della malattia (terapia con farmaci immunomodulanti,
biologici, immunosoppressori, altro); terapie sintomatiche; e un percorso dedicato alla “donna con
Sclerosi multipla”.
Il PDTA “Sclerosi Multipla”, validato da tutti i professionisti coinvolti, si è concluso nel novembre 2013.
151
3. Obiettivi istituzionali e strategie aziendali
PDTA “Sclerosi Multipla”
Il PDTA, corredato da un “Reminder” contenente una sintesi del lavoro e la flow-chart, è stato inserito
nella Intranet aziendale.
Interventi in fase di sviluppo o in corso
La strategia di implementazione e diffusione prevede: un convegno di presentazione del PDTA in cui è
prevista anche la sensibilizzazione dei Medici di Medicina Generale
Sistema delle cure in area critica
Centralizzazione dei pazienti con trauma maggiore (ISS > 15) e politraumi complessi e/o instabili
Nel 2013 presso la Rianimazione dell’AOU di Parma sono stati ricoverati 165 pazienti con diagnosi di
trauma, con ISS medio (Injury Severity Score, un punteggio che valuta la gravità del trauma) di 28±14,
età media di 47±22, SAPS medio di 37±21.
In 30 casi l’accesso all’Hub di Parma è stato per centralizzazione secondaria e la provenienza dei pazienti
è evidenziata nella tabella che segue.
Bergamo Bologna Castel San Giovanni Castelnovo Monti Crema Fidenza 1 2 2 1 1 3 Fiorenzuola Modena Piacenza Reggio Emilia Altro 4 2 9 3 2 Dai dati regionali ad oggi disponibili (fino al 2011), per quanto riguarda il SIAT Emilia Occidentale si può
evidenziare un trend in aumento della centralizzazione primaria e in diminuzione di quella secondaria.
Centralizzazione primaria in Hub
3. Obiettivi istituzionali e strategie aziendali
SIAT Emilia Occidentale ‐ AOSPU Parma Anno 2007 2008 2009 2010 2011 Totale 177 185 156 148 169 % centralizzazione primaria N. % riga 119
67,2
143
77,3
120
76,9
122
82,4
136
80,5
Centralizzazione secondaria in Hub
SIAT Emilia Occidentale Anno 2007 2008 2009 2010 2011 Totale Totale 143
236
230
198
238
1.045
Centralizzazione secondaria ISS N. % riga mediano 38
26,6
25
32
13,6
26
29
12,6
25
11
5,6
25
14
5,9
25
124
11,9
25
Centralizzazione dei pazienti con gravi cerebrolesioni
Nel 2013 nella Rianimazione dell’AOU di Parma sono stati ricoverati 98 pazienti con grave cerebrolesione
acquisita non traumatica (causa emorragica o ischemica). L’età media è di 61±14, SAPS medio di
46±17.
Di questi, 26 pazienti sono transitati da un altro ospedale prima di accedere all’Hub e la provenienza è:
Borgotaro/Fidenza Piacenza e provincia 4 23
Reggio Emilia e provincia
Altro 152
12
1
Funzionamento in rete delle terapie intensive
Il funzionamento in rete delle terapie intensive in ambito di ciascun SIAT è finalizzato a migliorare i
percorsi clinico-assistenziali.
Nel 2013, 15 pazienti traumatizzati gravi e 18 con grave cerebrolesioni acquisita (tot 33) sono stati
trasferiti dalla Terapia Intensiva Hub alle TI Spoke. La degenza media dei pazienti in TI resta invariata
rispetto al 2012: 9 gg per i traumi, 11gg per le cerebrolesioni.
Traumi Trasferiti dalla TI Hub c/o TI Spoke Cerebrolesioni trasferite dalla TI Hub c/o TI Spoke: Piacenza Fiorenzuola Castel San Giovanni Fidenza Reggio Guastalla Montecatone Crema Bergamo Altro Piacenza
Castel San Giovanni
Reggio
Guastalla
Modena
Correggio
Brescia
Altro
3 2 2 1 1 1 1 1 1 2 6 4 2 2 1 1 1 1 Formazione sul trauma maggiore
Nel 2013 sono stati effettuati i seguenti eventi formativi interni all’azienda:
Criteri di centralizzazione del trauma grave
Packing pelvico extraperitoneale
IL TRAUMA PEDIATRICO: triage preospedaliero, criteri di centralizzazione e percorsi diagnostico
terapeutici
Profilassi antibiotica nel trauma grave
Coagulopatia nel trauma grave
Prosegue inoltre la collaborazione dei Centri Hub nell’organizzazione degli eventi Trauma Update che,
ogni anno vengono organizzati a Bologna (evento principale) e nelle altre sedi regionali Hub, oltre che nei
Centri Traumi nazionali quali Milano (Niguarda) e Roma (San Camillo).
Debito informativo verso il registro sul trauma maggiore
Il debito informativo verso la regione viene assolto per quanto riguarda i traumi gravi ricoverati c/o la
Terapia Intensiva. Alla compilazione del registro traumi partecipano 7 medici che inseriscono
settimanalmente i dati nel registro traumi. Trimestralmente il servizio informativo aziendale, dopo la
verifica da parte di un medico preposto dell’Anestesia e Rianimazione della completezza dei dati, invia in
regione le informazioni raccolte secondo le procedure concordate e nel rispetto della privacy. Per l’anno
2013 sono stati inseriti sempre dalla Rianimazione i dati relativi ai pazienti con accesso in PS della nostra
Azienda con codice rosso per causa traumatica, ricoverati in UUOO non TI e con ISS > 15.
Pronto soccorso
Nel 2013 sono entrate nella piena operatività strutturale e funzionale sia l’OBI che il Punto Bianco per
dare risposta ai bisogni di salute dei cittadini-utenti.
Nel 2012 era stato realizzato uno studio propedeutico, che ha visto coinvolti il Pronto Soccorso e tutte le
Unità Operative di area internistica, volto alla definizione di percorsi organizzativi congrui ad evidenziare
e rispondere alle necessità cliniche nella processazione dei pazienti e in grado di poter garantire le
necessità di posti letto in occasione di iperafflusso notturno, festivo e prefestivo. Tale studio, supportato
dalla elaborazione di un apposito software atto ad aiutare i sanitari di ogni UO internistica a registrare per
153
3. Obiettivi istituzionali e strategie aziendali
Commissione SIAT
Nel 2013 la commissione SIAT si è riunita 3 volte. Sono stati condivisi i criteri di centralizzazione delle
fratture di bacino all’interno del SIAT Emilia Occidentale ed è iniziata la stesura del relativo protocollo di
area. Inoltre è stato predisposto un nuovo sistema di trasferimento delle immagini dai centri Spoke al
centro Hub di Parma per il Trauma Center e sono già iniziate le prime sperimentazioni del nuovo sistema.
singolo paziente le variazioni di condizioni cliniche tali da permetterne di prevederne la dimissione e la
conseguente disponibilità del posto letto, ha consentito nel 2012 di individuare archi temporali settimanali
e fasce orarie di particolare criticità cui rispondere con iniziative di carattere organizzativo. A tal
proposito, nel 2012 sono stati attivati presso la UO di Lungodegenza Critica c/o Padiglione Barbieri (14 pl)
e presso la Clinica Medica (5 pl) posti letto internistici per acuti “dedicati alle necessità di ricovero da PS”
la cui attivazione è immediatamente operativa durante specifici periodi della settimana a seguito di
valutazioni contingenti di bisogno, poste in essere dalla Direzione Sanitaria sulla scorta dei dati
epidemiologici di andamento degli accessi in PS e delle conseguenti necessità di ricovero. Tale studio e le
azioni poste in essere nel 2012 sono stati propedeutici alla definizione della funzione di bed management
sviluppata nel 2013.
Il Bed Manager è stato individuato nel maggio 2013 ed è stato operativo dal settembre 2013. Il
programma informatico a supporto del bed manager è stato attivato nel 2013. Si tratta di un applicativo
di ADT che è stato costruito attraverso una mappatura fisica dei posti letto iniziata a inizio Marzo 2013 e
la sperimentazione è iniziata ad Aprile 2013 sui seguenti reparti:
• Clinica e immunologia medica
• Clinica e terapia chirurgica
• Clinica chirurgica e trapianti
• Ortopedia
• Clinica Ortopedica.
Il programma consente di visualizzare i posti letto disponibili in reparto.
La figura del bed manager è attiva in modo trasversale su tutta l'Azienda e ha operato anche sul
dipartimento Materno-infantile coordinando l'attività dei due bed manager presenti dentro il dipartimento;
ha inoltre operato nei dipartimenti Testa-collo e Chirurgico per armonizzare l'attività di sala operatoria
con la disponibilità dei posti letto programmati.
Efficienza gestionale
3. Obiettivi istituzionali e strategie aziendali
Pianificazione dell’attività negoziale e politiche di acquisto
Gli obiettivi in materia di acquisto di beni e servizi sono stati individuati dalla Regione nella
ottimizzazione dei sistemi che possano determinare l’incremento degli acquisti condivisi (in Appendice è
riportata la “RELAZIONE AVEN 2013”).
Risultati raggiunti
• Nel 2013 la funzione del Dipartimento Interaziendale Acquisti a livello di Area Vasta è divenuta
gestionale, questo per rafforzare il controllo dell’attività e monitorare meglio l’andamento delle
gare e la loro gestione, rispondendo quindi pienamente agli obiettivi regionali.
• L’Azienda ha mantenuto ai massimi livelli l’adesione alle convenzioni Intercent-ER e ha attivamente
partecipato alle gare di Area Vasta, in particolare seguendo come capofila la complessa fase
valutazione e aggiudicazione della fornitura di protesi ortopediche, di interesse strategico a livello
regionale e con un risultato economico eccellente, avendo consentito un risparmio a livello di Aven
di circa € 5.000.000 in tre anni di contratto. Sono state inoltre concluse nel 2013 67 gare
aggregate per € 118.540.030,42, considerando tutte le gare di Area vasta, con un risparmio del
18,76% pari a € 24.963.200,36 rispetto alle precedenti quotazioni, oltre alla consistente gara
farmaci espletata in collaborazione con Intercent-ER per € 581.552.351,00 con un risparmio
dell’8,50% pari a € 54.003.977 rispetto alle precedenti quotazioni. Sono stati infine effettuati a
livello aziendale 92 gare/ordini diretti sul Mercato Elettronico della PA per un importo complessivo
di € 1.250.000.
• Al fine di avviare quanto prima il percorso di condivisione delle gare di servizi economali, è stato
definito con l’azienda AUSL di Parma un progetto di ottimizzazione e programmazione dei percorsi
di acquisto con delega all’Azienda USL dell’espletamento di tutte le gare europee.
• Il settore di Coordinamento delle acquisizioni dei beni, allo scopo di aggiornare l’inventario dei beni
mobili e, di conseguenza, razionalizzare il contratto di manutenzione collegato agli arredi in uso,
ha avviato il complesso processo di censimento degli arredi aziendali che si concluderà nei primi
mesi del 2014 e coinvolgerà tutti i locali aziendali, sia sanitari che tecnico/amministrativi. Nel 2013
è stato altresì aggiornato il testo del regolamento per la tenuta dell’inventario.
• La costante attività di monitoraggio della spesa relativa ai beni sanitari, pur nel massimo rispetto
della qualità, ha consentito per il 2013, anche a fronte di significative riduzioni di finanziamento
legate all’applicazione delle leggi di c.d. spending review, il rispetto delle previsioni di bilancio.
154
Interventi in fase di sviluppo o in corso
Si è strutturato l’ufficio preposto alla gestione del
conto deposito, questo ha consentito di ridurre i
tempi di riordino e quindi una maggiore coerenza
tra i dati di consumo e i dati di bilancio. Si è inoltre
ipotizzato di creare all’interno del Coordinamento
acquisizione di beni e servizi un ufficio dedicato
all’analisi e verifica dei dati di inventario, al fine di
monitorare
e
supportare
costantemente
l’alimentazione dei dati relativi a tutti i beni mobili.
Eventuali problematiche riscontrate
A livello di Area Vasta e di Intercent-ER in molte
procedure di gara (soprattutto in quelle
particolarmente innovative o complesse) si
rileva come criticità l’eccessiva durata delle
stesse, dovuta principalmente al coinvolgimento
di numerose professionalità e numerosi uffici
dislocati in diverse aziende. Il nuovo sistema di
monitoraggio
e
rendicontazione
della
tempistica, presentato dalla Direzione Operativa
di AVEN nel 2013, rappresenterà un importante
riferimento
per
tutti
i
professionisti
amministrativi e sanitari coinvolti nei processi di
approvvigionamento.
Azioni di razionalizzazione in ambito ICT
Promozione Fascicolo Sanitario Elettronico (FSE)
Relativamente alla promozione del Fascicolo Sanitario Elettronico si è partecipato alla campagna
dell’Azienda territoriale tramite il proprio portale online, organizzando eventi informativi per operatori
interni ed esterni e giornate di attivazione dedicata per gli operatori interni.
In ottemperanza alla Circolare 5 della Regione Emilia–Romagna è stato definito un piano di adeguamento
delle integrazioni dei sistemi informatici aziendali con l’architettura SOLE per la consegna al FSE dei
referti. Il piano è stato presentato all’interno del workshop che la regione ha organizzato per la
pianificazione della diffusione del FSE.
Significativa, anche in ottica di consegna on line del referto, l’integrazione avvenuta tra il sistema
informatico di laboratorio e il Polo Archivistico Regionale per la conservazione sostitutiva dei documenti
firmati digitalmente.
Anche allo scopo di favorire la diffusione del FSE si è perseguito l’obiettivo di aumentare i volumi di invio
dei documenti sanitari. I volumi possono essere di seguito riassunti:
Documento Pronto Soccorso Laboratorio Radiologia Specialistica Lettera di Dimissione Volumi 2011
24.648
72.571
7.034
0
233
Volumi 2012
62.597
81.060
65.497
55
1.584
Volumi 2013
81.177 87.966 66.592 3.636 4.792 Nel contesto del sistema informativo di Anatomia Patologica si è proseguito, coerentemente con i lavori
del gruppo regionale, nella revisione delle funzionalità tecnologiche dello stesso per permettere il
successivo invio alla piattaforma SOLE del referto.
Dematerializzazione ricetta
Il progetto di dematerializzazione della ricetta è stato perseguito andando a definire di concerto con
Cup2000 le modalità di implementazione sui sistemi informatici aziendali delle interfacce di
comunicazione. In particolare sono stati identificati i percorsi informatici di prenotazione, accettazione e
prescrizione: in continuità con le attuali modalità organizzative è stato identificato il software CUP
provinciale (in gestione all’AUSL) per le prenotazioni ed erogazioni e il software di gestione ambulatoriale
aziendale per la prescrizione.
Entro l’anno 2013 è stato adeguato il software di prescrizione dematerializzata, la cui messa in funzione è
dipendente dalla messa in funzione degli adeguamenti al sistema CUP provinciale.
155
3. Obiettivi istituzionali e strategie aziendali
Le azioni di razionalizzazione individuate dalla Regione Emilia-Romagna in ambito ICT, anche al fine di
risparmi diretti e/o indiretti, che hanno coinvolto l’Azienda Ospedaliero – Universitaria di Parma sono
diverse.
3. Obiettivi istituzionali e strategie aziendali
Centralizzazione gestione informatizzata delle risorse umane
Per quanto concerne il progetto regionale di centralizzazione del sistema informatico di gestione del
personale l’Azienda Ospedaliero–Universitaria di Parma ha partecipato al gruppo di lavoro di definizione
del capitolato di gara.
Adozione di un sistema di monitoraggio e governo dell’appropriatezza in ambito di analisi di
Laboratorio
Rispetto al tema dell’appropriatezza in ambito laboratoristico l’Azienda Ospedaliero – Universitaria di
Parma ha effettuato una complessa analisi attraverso i sistemi informatici esistenti per indagare le aree di
maggiore inappropriatezza in fase prescrittiva.
A partire dall’indagine effettuata si è evidenziata la convenienza di disporre di un sistema informatico che
verifichi preventivamente l’appropriatezza della prescrizione e supporti il medico richiedente in tale
verifica. Il sistema è stato acquisito nel corso del 2013 ed è attualmente in fase di configurazione.
Le azioni di governo dell’appropriatezza in ambito di analisi di laboratorio hanno interessato anche
l’attività svolta per pazienti degenti. Su tale obiettivo strategico si è costruito un progetto aziendale
(l’esperienza è stata presentata alla 9a Conferenza Nazionale GIMBE, Evidenze e Innovazioni per la
Sostenibilità della Sanità Pubblica a Bologna il 14 marzo 2014), che è entrato a far parte del processo di
budget delle U.O. coinvolte. Il Progetto per la riduzione della quota di richieste inappropriate in medicina
di laboratorio è parte integrante del processo di budgeting e ha avuto come oggetto la riduzione della
quota di inappropriatezza di esami diagnostici di laboratorio richiesti presso l’Azienda OspedalieroUniversitaria di Parma. Un’analisi sistematica preliminare nel database del sistema informatico del
laboratorio ha consentito di identificare una serie di esami che rivelassero un elevato profilo di
inappropriatezza (compreso dal 5 al 50%) secondo le linee guida nazionali o internazionali, in termini
temporali (richiesta di esami in arco temporale incongruo), in termini clinici (associazione di esami priva
di fondamento biologico), o perché richiesti nell’ambito di “profili” prestabiliti.
I dati dell’inappropriatezza relativa agli esami in questione (colesterolo totale e HDL, emoglobina glicata,
ferritina, marcatori tumorali, peptidi natriuretici e fattori della coagulazione) e le relative indicazioni
prescrittive sono stati quindi diffusi a tutte le UU.OO. dell’Azienda, al fine di migliorare l’appropriatezza
prescrittiva, ponendo come standard una riduzione del 15% della quota totale di esami oggetto del
monitoraggio e strutturando, di conseguenza, un reporting sistematico e specifico per dare piena
attuazione alla logica del Plan-Do-Check-Act.
Le azioni intraprese hanno permesso, nel corso del 2013, un miglioramento dell’appropriatezza
prescrittiva con una riduzione complessiva delle prestazioni rispetto al 2012 pari a -11,5%, passando da
192.545 prestazioni a 170.461. Il processo di miglioramento dell’appropriatezza prescrittiva e il relativo
monitoraggio, che nel 2013 sono decollati a partire dal 2° trimestre, vengono confermati anche nel corso
del 2014.
•
•
•
•
•
Altre azioni in ambito ICT
Implementazione del sistema di monitoraggio delle infezioni da sito chirurgico (SichER):
nel 2013 è stato realizzato, dopo l’analisi e l’implementazione, il sistema di monitoraggio delle
infezioni del sito chirurgico funzionale al progetto ministeriale SichER.
Progettazione e implementazione del sistema di gestione dei posti letto:
- nel contesto di riorganizzazione delle piattaforme delle degenze, è stato sviluppato il sistema
informativo di gestione dei posti letto.
Prosecuzione nell’attività di riduzione degli strumenti proprietari a favore di strumenti Open Source.
Progetto di aggiornamento del sistema informatico di laboratorio di microbiologia.
Progetto di unificazione della cartella diabetologica in relazione al trasferimento delle diverse unità
operative nel Centro per la cura del diabete (cfr. il paragrafo “Gestione Integrata Diabete” nel
presente capitolo).
156
3.5 Promozione dell'eccellenza tecnologica, clinica e
organizzativa
Strategie e percorsi di integrazione interaziendali e di Area Vasta
In un periodo così critico in termini di risorse disponibili, lo sprone per migliorare la qualità dell’offerta e
dell’efficienza nella produzione di servizi non può che venire da strategie innovative che vedono nei
processi di integrazione di attività e funzioni tra Aziende condizioni per il miglioramento della sostenibilità
del sistema sanitario attraverso la razionalizzazione di risorse tecnologiche, materiali, umane e
finanziarie, favorendo la collaborazione, l’integrazione e concentrando strutturalmente le funzioni
amministrative, tecnico-professionali e sanitarie a prevalente carattere generale e di supporto tecnicologistico.
L’Azienda Ospedaliero-Universitaria ha inteso l’indicazione espressa dalla Regione nella D.G.R. n.
199/2013 come una opportunità da cogliere sia sul piano interaziendale che in ambito di Area Vasta.
Strategie di integrazione in area vasta
Il governo dei processi di acquisto di beni e servizi
Il settore degli acquisti è stato sicuramente un ambito prioritario dell’attività di AVEN per l’anno 2013. La
sottoscrizione della “Convenzione attuativa per lo svolgimento integrato dell’attività di acquisizione di
Beni e Servizi delle Aziende dell’Area Vasta Emilia Nord”, avvenuta in corso d’anno, istitutiva del
Dipartimento Interaziendale Acquisti (DIA) a valenza gestionale ha permesso, da un lato, di consolidare
ulteriormente l’attività comune di acquisto di beni e servizi, dall’altro, di avviare un percorso di
razionalizzazione organizzativa destinato a produrre i primi risultati nel corso del 2014. L’integrazione di
risorse e servizi in funzione del miglioramento della qualità dell’offerta e dell’efficienza di produzione
trova piena risposta nella definizione della citata Convenzione Attuativa, recepita con atto n. 186 del 17
luglio 2013, con cui sono stati contestualmente individuati i dipendenti che afferiscono al Dipartimento
Interaziendale Acquisti.
Tali interventi di riorganizzazione hanno consentito di ottimizzare la filiera obiettivi/risultati/risorse
configurando un percorso ritenuto il più economico ed efficace con riferimento alle politiche per l’acquisto
di beni e servizi.
Attivazione del sistema di logistica integrata di area vasta
La prima parte del 2013 è stata dedicata all’allestimento interno del nuovo magazzino di Area Vasta.
Sono stati, infatti, completati i lavori impiantistici che ancora residuavano e si provveduto
all’approntamento delle aree per la gestione dello stock e del picking dei beni gestiti. All’interno di tali
aree sono state effettuate scelte tecnologiche differenziate in base alle caratteristiche fisiche dei prodotti
(peso, volume, temperatura di conservazione) ed al loro ottimale indice di rotazione.
In particolare:
•
per i prodotti a volume medio, alta rotazione ed alta quantità di prelievo sono state montate
scaffalature a gravità;
•
per i prodotti a volume medio, alta rotazione e bassa quantità di prelievo, nonché per prodotti a
bassa rotazione è stato installato un sistema automatizzato a cassette (traslo elevatore)
caratterizzato da un’alta produttività (200 prelievi ora per postazione attiva per un massimo di 4
postazioni ed una capacità di stock di oltre 10.000 cassette);
•
nell’area dedicata ai prodotti ad alto volume o alto peso sono state collocate scaffalature porta
pallet (poco meno di 5.000 postazioni).
L’attività del nuovo magazzino di Area Vasta ha avuto inizio l’8 luglio, concluso il lavoro di allestimento
interno, e ha riguardato, nell’immediato, tre Aziende (Azienda USL di Reggio Emilia, Azienda Ospedaliera
di Reggio Emilia, Azienda USL di Modena in quota parte). Tali Aziende utilizzavano già i servizi del
magazzino precedentemente attivo presso l’Azienda USL di Reggio Emilia.
Alla metà di settembre si è completato l’ingresso dell’Azienda USL di Modena (territorio ed Ospedali di
Vignola e Pavullo) nel rispetto del programma definito. Contemporaneamente è stata assunta anche la
157
3. Obiettivi istituzionali e strategie aziendali
Il processo di integrazione tra le Aziende di Area Vasta è proseguito nel rispetto di quanto indicato dagli
indirizzi regionali e in una logica di continuità con le esperienze già maturate negli anni precedenti. Gli
obiettivi dell’Area Vasta Emilia Nord sono stati definiti in coerenza con gli indirizzi regionali.
3. Obiettivi istituzionali e strategie aziendali
completa gestione della merce in transito delle Aziende in questione. Le altre Aziende entreranno,
secondo il programma stabilito, nel corso dell’anno 2014. L’ingresso di AO Parma è previsto nella seconda
parte dell’anno.
L’ingresso di ciascuna Azienda (per quanto parziale) ha comportato un preliminare intenso e puntuale
lavoro su tre versanti:
•
messa a punto delle interfacce informatiche per la gestione degli scambi informativi tra i
gestionali aziendali e quello del magazzino;
•
allineamento delle codifiche dei prodotti aziendali con quelle del magazzino;
•
assunzione da parte dell’Azienda USL di Reggio Emilia della gestione amministrativa (contratti,
prezzi, fornitori) di competenza di ciascuna delle aziende servite dal magazzino.
Questa fase ha comportato la definizione di una metodologia di approccio e, successivamente, un lavoro
operativo che hanno impegnato rilevanti risorse.
A fine anno il magazzino aveva oltre 3.000 referenza a scorta e gestiva circa 100 ordini in transito al
giorno.
Integrazione in ambito amministrativo – gestionale e clinico – assistenziale
Sono proseguite, sia pure con modalità diversificate fra gruppo e gruppo, le attività finalizzate al
raggiungimento di obiettivi di integrazione sia in ambito amministrativo–gestionale che clinico–
assistenziale.
In particolare sono state sottoscritte dai Direttori Generali quattro Convenzioni Attuative (oltre a quella
relativa al Dipartimento Interaziendale Acquisti a valenza gestionale di cui si è trattato in precedenza) con
l’intento di rafforzare la collaborazione in ambiti ritenuti strategici:
•
gestione comune dei concorsi relativi al personale del comparto: è stato deciso, per economia di
gestione ed efficacia della stessa, di condividere procedure comuni per lo svolgimento dei
concorsi relativi al personale del comparto. All’interno della Convezione sono state definite le
modalità operative per lo svolgimento comune dei concorsi ed il successivo utilizzo delle
graduatorie;
•
Coordinamento dei Dipartimenti/Servizi Farmaceutici con l’obiettivo di garantire una costante
integrazione tra le Aziende relativamente alle competenze di ambito farmaceutico, nonché un
adeguato supporto al processo di centralizzazione degli acquisti;
•
Coordinamento dei Servizi di Ingegneria Clinica per garantire una continua collaborazione per le
attività connesse all’acquisizione e gestione delle apparecchiature/tecnologie sanitarie, nonché la
gestione unitaria ed integrata delle attività connesse all’acquisto delle apparecchiature sanitarie e
dei dispositivi medici di competenza;
•
Coordinamento dei Servizi Formazione a cui affidare la progettazione e la realizzazione di eventi
formativi di interesse comune e la progettazione e realizzazione congiunta dei corsi FAD.
I gruppi attivi sia di area amministrativo-gestionale che clinico-gestionale hanno sviluppato un proficuo
lavoro di confronto la cui attività può essere ricondotta ad alcuni ambiti principali:
•
interpretazione e applicazione omogenea della normativa: in questo ambito si segnalano in
particolare le attività svolte dai gruppi dei responsabili del personale, della libera professione e
degli odontoiatri. E’ stato avviato un confronto anche in materia di trasparenza ed anticorruzione;
•
elaborazione di specifici progetti: vanno ricordati quelli intrapresi dal gruppo dei laboratoristi
(gare in comune, monitoraggio appropriatezza ed accentramento esami rari) e dal gruppo dei
Fisici Sanitari (studio rischio radiologico e sorveglianza dosimetrica, studio modalità di controllo
attività delle RMN). Il gruppo Riabilitazione e quello Percorso Nascita hanno continuato la loro
attività secondo quanto previsto dalle linee di indirizzo regionale;
•
confronto su temi specifici per l’adozione delle migliori pratiche individuate: particolarmente attivi
in materia il gruppo gestione del Rischio Clinico e quello della Medicina Legale. Analogamente è
stato costituito un gruppo per l’analisi e diffusione delle migliori pratiche relativamente all’ambito
della protesica territoriale. E’ proseguito il confronto anche all’interno dei gruppi delle Direzioni
Infermieristiche e dei responsabili della Specialistica;
•
sviluppo di attività comuni e adozione di modelli organizzativi integrati: oltre a quelli legati alle
Convenzioni Attuative di cui si è detto (Formazione, concorsi comparto) vanno ricordate le
attività, da tempo avviate, di progressiva unificazione dei contratti di manutenzione sia di ambito
informatico che relativi alle apparecchiature biomedicali.
Va, infine, segnalato che si è concluso lo studio per la realizzazione di un’unica centrale operativa 118 tra
le Aziende di Piacenza, Parma e Reggio Emilia ed è in corso l’elaborazione del progetto per la
realizzazione del centro unico di produzione sangue ed emocomponenti.
158
Progetto Officina Trasfusionale di Area Vasta
Già nel 2012 è stata predisposta una prima bozza di progetto di ristrutturazione del Servizio Trasfusionale
di Parma, sulla base dell’ipotesi (prevista nel Piano sangue regionale 2008-2010) di centralizzazione
dell’officina di produzione in 2 sedi in AVEN, ovvero Parma per l’Area Parma-Piacenza e Modena per l’Area
Modena–Reggio Emilia. Per lo sviluppo del progetto di centralizzazione delle officine, sono state effettuate
valutazioni preliminari al fine di definirne la sede, valutarne la fattibilità, le modalità operative e le
integrazioni di tipo informatico - gestionale.
Tuttavia, nel 2012 il progetto di un’officina trasfusionale unica per la provincia di Parma e Piacenza è
stato temporaneamente sospeso, in seguito alle indicazioni provenienti dal nuovo Piano Sangue
Regionale, in bozza nel 2012, emanato nel 2013, che prevede che la centralizzazione dell’officina
trasfusionale in AVEN avvenga in un polo unico, anziché due poli, comprendente le province di Parma,
Reggio Emilia e Piacenza, con l’esclusione della provincia di Modena. Quindi nel 2013 sono ripresi i lavori
del gruppo dei Servizi trasfusionali di AVEN, con l’esclusione del SIT di Modena, per la predisposizione del
progetto di centralizzazione, con individuazione della sede e valutazione dei costi di implementazione.
In aggiunta, nel 2013 sono state avviate le procedure per l’implementazione di un sistema informatico
gestionale unico per i Servizi trasfusionali dell’intera Emilia-Romagna.
Le Aziende sanitarie di Parma hanno risposto alla sollecitazione posta dalle linee di programmazione
regionali aprendo il confronto e la verifica sulle effettive opportunità di integrazione e di fattibilità dei
relativi progetti in area sanitaria, amministrativa e tecnico professionale, fermo restando l'esercizio
dell'autonomia e della responsabilità gestionale in capo alle rispettive Amministrazioni.
Sono stati elaborati diversi progetti di integrazione/collaborazione interaziendale, presentati alle OO.SS.
il 29 maggio 2013 nell’incontro “Gli impegni della sanità pubblica provinciale” .
Il progetto complessivo è stato trasmesso in Regione con nota a firma congiunta dei Direttori Generali
delle due Aziende Sanitarie.
Per l’area amministrativa e tecnica sono state definite specifiche progettualità nelle seguenti aree:
•
Area acquisti e logistica
•
Area attività tecniche e patrimoniali
•
Area gestione risorse umane
•
Area formazione
•
Area ICT
•
Area ingegneria clinica e ICT
•
Area ingegneria clinica
In ambito sanitario le aree interessate sono:
•
Farmaceutica
•
Neurologia
•
Laboratorio
•
Insufficienza Renale Cronica
•
Riabilitazione
Rete malattie rare
L’Azienda ha proseguito le attività previste per l’implementazione della Rete delle Malattie Rare sia per le
funzioni Hub (emofilia e malattie emorragiche congenite), sia per le funzioni Spoke (tra cui talassemia e
anemie emolitiche ereditarie), così come previsto dal modello regionale per le Malattie Rare.
In particolare, è stata effettuata una ricognizione interna delle strutture aziendali in possesso dei
necessari requisiti clinici (numero di casi trattati/anno) e organizzativi per essere individuate quali Centri
Autorizzati, promuovendone le candidature. Nel 2013 è continuata l’attività di informatizzazione dei Piani
Terapeutici Personalizzati, inclusa nella rete regionale per le malattie rare.
Per quanto riguarda l’attività di Genetica Medica nella rete delle malattie rare, dal 2013 è pienamente
operativa la collaborazione con il Centro Hub di Bologna per la Sindrome di Marfan per la diagnostica di
tale patologia rara. Sono state infine incrementate le prestazioni di diagnostica prenatale per NF1,
Emofilia, Sindrome di Alport e Sindrome di Marfan.
159
3. Obiettivi istituzionali e strategie aziendali
Strategie di integrazione a livello provinciale
Miglioramento dei processi di accesso, trattamento e dimissione delle
persone con bisogno di assistenza in fase post-acuta e riabilitativa
3. Obiettivi istituzionali e strategie aziendali
Negli ultimi anni l’Azienda Ospedaliero-Universitaria di Parma ha prestato molta attenzione al tema
della polipatologia e della fragilità prospettando soluzioni innovative e percorsi diagnostico-terapeutici
all’interno del Dipartimento ad Attività Integrata (DAI) Geriatrico-Riabilitativo.
Risultati raggiunti
In estrema sintesi le azioni più importanti già attuate e/o completate nel 2013 sono le seguenti:
1. afferenza di tutte le Unità Operative di Geriatria, Riabilitazione e Lungodegenza all’interno di un
unico Dipartimento ad Attività Integrata (DAI Geriatrico-Riabilitativo);
2. collocazione fisica di gran parte dei letti di competenza geriatrica, riabilitativa e di lungodegenza
all’interno di un’unica struttura (padiglione Barbieri);
3. attivazione del percorso Stroke Unit con letti dedicati all’interno delle UO Clinica Geriatrica e
Medicina Riabilitativa;
4. attivazione del progetto Ortogeriatria in collaborazione tra l’UO Geriatria e i reparti ortopedici;
5. specializzazione dell’UOC Medicina Interna e Lungodegenza Critica nella cura del paziente
polipatologico, fragile, cronico riacutizzato e organizzazione del reparto per ”intensità di cura” : a)
Area per acuti ad alta intensità e alto turnover (Medicina per Acuti-18 letti), b) Area a media
intensità e medio turnover (Lungodegenza Critica-44 letti) e c) Area a bassa Intensità e basso
turnover (Lungodegenza Integrata a Direzione Infermieristica-LIDI-18 letti);
6. attivazione di un Ambulatorio Vulnologico, multiprofessionale a responsabilità infermieristica, per il
trattamento delle ulcere cutanee;
7. attivazione “a domanda” di un modulo flessibile di emergenza-urgenza per affrontare un
improvviso iperafflusso di pazienti al PS (“reparto soffietto”/”letti scambiatori”). Tale progetto,
effettuato con il coinvolgimento della Scuola di Specializzazione in Medicina d’Emergenza-Urgenza
dell’Università di Parma, è stato attivato il 1°/11/2012;
8. applicazione precoce di un piano personalizzato di dimissione nel rispetto della continuità
assistenziale;
9. applicazione di protocolli diagnostico-terapeutici volti ad abbattere le giornate di degenza non
necessarie ed evitabili.
La riorganizzazione della Struttura Complessa Medicina Interna e Lungodegenza Critica ha portato nel
2013 a un netto incremento dell’attività di ricovero (2237 ricoveri nel 2011, 3118 nel 2012 e 4483
nel 2013; +100.4% in 2 anni), con significativa riduzione della degenza media a parità di tasso di
rientro non pianificato a 30 giorni (5,84%). Questa percentuale di nuovi accessi in ospedale è del tutto
sovrapponibile al dato medio di tutti i reparti di medicina dell’AOU di Parma (5,80%).
Interventi in fase di sviluppo o in corso
 Perfezionamento e implementazione del protocollo aziendale del “reparto soffietto”.
 Entrata in funzione a regime del “reparto soffietto” entro due ore dalla richiesta della Direzione
Sanitaria.
 Risoluzione dell’overcrowding del PS entro 12 ore.
 Soddisfazione degli utenti e del personale valutata mediante questionari validati.
 Estensione del modello per “intensità di cura” a livello dipartimentale:
percorsi riabilitativi
percorsi nutrizionali
percorso stroke
- orto geriatria.
Governo clinico: Programma Nazionale Esiti
L’Azienda Ospedaliero-Universitaria di Parma promuove la ricerca del miglioramento continuo della
qualità dell’assistenza e si prefigge di supportare lo sviluppo del governo clinico, finalizzato
all’erogazione di elevati livelli di prestazioni, espressione dell’eccellenza professionale, clinica,
organizzativa.
La SSD Governo Clinico, gestione del rischio, qualità e accreditamento supporta i professionisti, le
Strutture Aziendali e i Servizi al fine di portare a sistema le funzioni assegnate.
Il Programma Nazionale Valutazione Esiti (PNE), gestito da Agenas per conto del Ministero della Salute,
ha reso disponibili i risultati dell'analisi su dati SDO 2005-2012, su sito web dedicato accessibile,
attraverso l'autenticazione con credenziali, a tutte le Istituzioni e i soggetti accreditati del SSN.
La nuova edizione di PNE contiene alcune rilevanti modifiche di analisi e di consultazione e, come negli
160
anni precedenti, valuta gli esiti dell'assistenza ospedaliera, per tutte le strutture ospedaliere, sia dal
punto di vista dei produttori di servizi, che da quello delle ASL, titolari delle funzioni di tutela della
salute della popolazione.
Il PNE confronta la media nazionale e, rispetto a questa, evidenzia in rosso le Aziende con un esito
negativo ed in blu le Aziende con l’esito migliore.
Interventi in fase di sviluppo o in corso
Nel corso del 2014 si prevede di lavorare con il Collegio di Direzione e i Professionisti al fine di
identificare Azioni di Miglioramento da mettere in pratica per migliorare l’esito dei singoli indicatori e
quindi la performance generale dell’Azienda.
Il confronto tra le aziende del territorio nazionale crea le condizioni atte a promuovere il dibattito nelle
organizzazioni sanitarie sia sulla significatività delle misure identificate per monitorare la qualità dei
servizi che per avviare/promuovere un processo di analisi “auditing clinico e organizzativo” per
valorizzare l’eccellenza, individuare le criticità, promuovere il miglioramento dell’efficacia e dell’equità
del SSN.
L’innovazione tecnologica
Interventistica radiologica e neuroradiologica e realizzazione di un polo di interventistica
A inizio del 2013, si è completata la realizzazione del polo di interventistica radiologica e neuroradiologica
che possa garantire l’applicazione di tecniche avanzate, comprensivo della sala interventistica ibrida.
Le apparecchiature acquisite sono allo stato dell'arte e complete con la dotazione hardware e software
necessaria ad eseguire applicazioni avanzate in ambito diagnostico e terapeutico radiologico e
neuroradiologico.
Il progetto si completa con una sala operatoria ibrida nella quale vengono combinate tecnologie utilizzate
in un ambiente tipicamente chirurgico con sistemi radiologici ad elevate prestazioni e di ultima
generazione per l'esecuzione di trattamenti percutanei e procedure endovascolari applicate all'intero
sistema vascolare a limitata invasività con conseguenti riduzioni dei tempi di recupero e minimizzazione
dei rischi operatori. Il progetto così strutturato rappresenta una soluzione estremamente avanzata, che
permette di garantire una maggior sicurezza oltre a un incremento di efficienza e qualità, riducendo
quindi i rischi di complicanze legati all’eventuale riconversione. È una scelta che si sviluppa sulla linea
dell’aggiornamento tecnologico per assicurare il massimo delle competenze e delle possibilità operatorie
ad oggi disponibili.
Il sistema è stato installato, collaudato e messo in uso.
Realizzazione di una rete integrata di condivisione di immagini e referti
Nel corso del 2013 si è avviato l’aggiornamento dell’applicativo gestionale di radiologia. Tale
aggiornamento permetterà di creare una unica piattaforma per la gestione di esami radiologici e
161
3. Obiettivi istituzionali e strategie aziendali
Risultati raggiunti
Le aree cliniche messe a confronto sono: cardiologia e cardiochirurgia, chirurgia, oncologia, ortopedia,
pneumologia, perinatale.
È stato elaborato un report, per i professionisti dell’Azienda, sulla base del Programma Nazionale di
Valutazione degli Esiti (PNE) con i dati su mortalità, tempi di intervento (45 indicatori) delle principali
specialità cliniche, erogate negli ospedali italiani mette a confronto le Aziende Sanitarie delle Regioni
con la media nazionale.
Inoltre, è stata elaborata una scheda di sintesi degli indicatori (confronto 2011-2012) con l’attribuzione
del codice colore per le aree cliniche messe a confronto. La presentazione del Report è avvenuta in
Collegio di Direzione 30/10/2013.
Il Programma Nazionale di Valutazione degli Esiti (PNE) presenta anche una sezione inerente indicatori
di Ospedalizzazione per Provincia (23 indicatori) delle principali specialità cliniche, erogate negli
ospedali italiani, mettendo a confronto le Aziende Sanitarie delle Regioni con la media nazionale.
Tra gli indicatori di Ospedalizzazione sono presenti patologie inerenti le seguenti discipline: cardiologia,
chirurgia, medicina, ortopedia, ginecologia, pediatria, chirurgia pediatrica, pneumologia, urologia.
È stato elaborato un ulteriore report, per i professionisti dell’Azienda, sulla base del Programma
Nazionale di Valutazione degli Esiti (PNE) con i dati dell’Azienda relativi all’anno 2012. La presentazione
del Report è avvenuta in Collegio di Direzione 17/12/2013. Entrambi i report, oltre a quelli prodotti
dall’Area Governo Clinico dell’ASSR, sono stati inseriti sulla Intranet Aziendale.
cardiologici. Tale evoluzione permetterà di realizzare una cartella del paziente che contenga tutte le
informazioni, i dati e il supporto iconografico relativo alla diagnostica e interventistica radiologica e
cardiologica con l’obiettivo di avere in un unico sistema tutte le informazioni necessarie alla gestione del
paziente.
Nel corso del 2013 è inoltre stato avviato il progetto di integrazione degli elettrocardiografi alla medesima
piattaforma (durante i primi mesi del 2014 sarà completato il collegamento degli ECG del Nuovo Ospedale
dei Bambini) e dell’ecocardiografia neonatale e pediatrica (sarà completata durante i primi mesi del
2014).
Si è completata la prima fase del progetto. E’ in corso l’aggiornamento a tutti i reparti radiologici.
3.6 Integrazione tra le
didattica e di ricerca
attività
assistenziali,
di
Comitato di Indirizzo
Come previsto dalla normativa regionale e dall’Atto Aziendale, il Comitato di Indirizzo esercita funzioni
propositive, consultive e di verifica.
Propone iniziative e misure per assicurare la coerenza fra la programmazione aziendale e la
programmazione didattica e scientifica dell’Università e verifica la corretta attuazione del Protocollo
d’Intesa e dei relativi provvedimenti aziendali.
3. Obiettivi istituzionali e strategie aziendali
Ha espresso parere sui seguenti documenti, in riferimento a quanto previsto dall’art. 4 del Regolamento
del Comitato medesimo.
Bilancio di Esercizio 2012
E’ stato illustrato ai componenti del Comitato di Indirizzo dell’Azienda Ospedaliero-Universitaria di Parma
il Bilancio di Esercizio Anno 2012.
Il Comitato ha ritenuto le risultanze inserite in tale documento coerenti con gli indirizzi regionali per il
raggiungimento dell’obiettivo di equilibrio economico-finanziario del Sistema sanitario provinciale; ha
ritenuto, inoltre, che detti risultati possono essere considerati conformi agli obiettivi aziendali relativi alla
realizzazione del Nuovo Ospedale, al mantenimento delle attività e delle strutture e all’integrazione delle
attività di assistenza, di didattica e di ricerca.
Il Comitato di Indirizzo ha espresso parere positivo sul documento presentato.
Bilancio di Missione – Anno 2012
Ha analizzato i vari capitoli in cui è suddiviso il documento, esaminando con particolare attenzione i
capitoli dedicati alla produttività, al contributo della Azienda alla copertura dei LEA, alla promozione della
eccellenza (clinica, tecnologica, organizzativa), alla integrazione tra le attività assistenziali, di didattica e
di ricerca con l’Università degli Studi di Parma, allo sviluppo della edilizia ospedaliera con il
completamento in corso del Nuovo Ospedale, al controllo della spesa sanitaria.
Il Comitato ha dato atto che il documento del Bilancio di missione 2012, presentato alla sua attenzione, è
conforme, nella struttura e articolazione, alle specifiche indicazioni regionali.
Il Comitato di Indirizzo ha ritenuto che il Bilancio di Missione 2012 costituisca una corretta, completa e
ben documentata rilevazione dell’attività svolta nel corso dell’anno dall’Azienda Ospedaliero-Universitaria,
dei rapporti di collaborazione tra Azienda ed Università degli Studi di Parma, e confermi l’ottimo
posizionamento dell’Azienda nell’ambito dell’assistenza sanitaria provinciale e regionale.
Ha espresso, pertanto, parere favorevole sul documento.
Espressione parere sul Bilancio Preventivo Economico annuale 2013
E’ stato illustrato ai componenti del Comitato di Indirizzo, per l’espressione del parere, il Bilancio
Preventivo Economico annuale 2013.
Dalla documentazione allegata alla deliberazione del Direttore Generale n. 152 del 11.6.2013 (adozione
del Bilancio preventivo economico annuale 2013) è emerso come l’Azienda Ospedaliero-Universitaria di
Parma abbia pianificato le proprie attività conformemente alle “Linee di programmazione e finanziamento
delle Aziende del Servizio Sanitario Regionale per l’anno 2013” D.G.R. n. 199 del 25/02/2014.
162
Altre attività
Analisi della situazione organizzativa, assistenziale e didattica della unità operativa Ostetricia e
Ginecologia della Azienda: al fine di garantire una sempre maggiore efficienza del sistema, il Comitato ha
invitato ad un’audizione alcuni Professionisti afferenti alla U.O. Ostetricia e Ginecologia e Responsabili
delle varie linee assistenziali.
Sono stati discussi i problemi relativi alle risorse umane, alla dotazione strumentale, al possibile
inserimento di nuove Professionalità, alla attività didattica, eccetera.
La relazione finale su quanto è emerso dalla analisi eseguita dal Comitato di Indirizzo è stata consegnata
al Direttore Generale dell’Azienda Ospedaliero-Universitaria di Parma e al Magnifico Rettore dell’Università
degli Studi di Parma.
Il processo di integrazione in attuazione dell’Atto Aziendale e degli
Accordi Attuativi Locali
L’anno 2013 si è caratterizzato per il costante impegno dell’Azienda Ospedaliero-Universitaria di Parma
nel perseguire il principio dell’integrazione a fondamento della programmazione e della gestione delle
risorse assegnate per la realizzazione degli obiettivi del SSR e per lo sviluppo delle attività assistenziali
essenziali allo svolgimento delle funzioni istituzionali di didattica e di ricerca dell’Università.
Il consolidamento del processo di integrazione ha riguardato l’armonizzazione della gestione dei
professionisti e lo sviluppo delle sinergie nel campo della formazione medico-specialistica nonché
l’adeguata operatività degli assetti organizzativi a garanzia dei processi primari (assistenza-didatticaricerca) ed il funzionamento dei Dipartimenti ad Attività Integrata.
La rilevazione del personale docente operante nell’anno 2013 presso i Dipartimenti ad Attività Integrata è
riportata nel precedente capitolo 1.2.
163
3. Obiettivi istituzionali e strategie aziendali
Il Comitato di Indirizzo ha ritenuto di condividere le seguenti linee strategiche:
• sviluppare processi di riorganizzazione e di integrazione professionale all’interno di tutte le
articolazioni organizzative, nella rete ospedaliera e tra ospedale e territorio, per rispondere in
maniera sempre più “sostenibile” ai bisogni degli utenti, promuovere attività strutturate di
miglioramento dei risultati clinici e organizzativi e garantire percorsi di riorganizzazione che siano
funzionali ad assicurare il miglior uso possibile delle risorse messe a disposizione.
Particolare attenzione è stata posta all’integrazione con l’Università degli Studi di Parma. A tal
proposito, gli impegni che l’Azienda Ospedaliero-Universitaria di Parma si è assunta sono la
promozione di un contesto favorevole allo sviluppo di un ruolo di leadership per la ricerca in
medicina, per l’innovazione assistenziale e organizzativa e la definizione di un assetto di regole e
strumenti per la garanzia di trasparenza.
• proseguire la promozione della ricerca attraverso la realizzazione del Centro Comune di Ricerca
(CCR).
A questo proposito il Comitato ha sottolineato che tale struttura dovrà rispondere a varie
esigenze, sia di ricerca clinica di base che di ricerca applicata, con particolare considerazione per
le sperimentazioni cliniche che coinvolgeranno strutture appartenenti alla Azienda.
Nel primo caso ciò avverrà con la concentrazione presso il CCR di attrezzature di indagine e di
laboratorio di avanguardia che possono raggiungere un equilibrio economico solo se utilizzate da
vari operatori e per tempi di lavoro abbastanza lunghi e che sarebbe antieconomico prevedere
presso singole unità operative. Nel caso dei trials clinici l'obiettivo è quello di uniformare i metodi
di lavoro, garantendo contemporaneamente qualità in termini di accoglienza dei partecipanti agli
studi, di gestione della privacy, di raccolta e conservazione di tutto quanto attinente alla
sperimentazione stessa.
In assenza di ulteriori fonti di finanziamento rispetto a quelle già assegnate, le priorità sono state
relative all’ammodernamento delle strutture edili e dell’acquisizione delle attrezzature e arredi e della loro
messa in funzione. Dall’esame del programma pluriennale degli investimenti, il Comitato ha potuto
constatare che l’Azienda, disponendo di fondi provenienti da varie fonti ha formulato un programma
triennale di investimenti. Gran parte delle risorse risultano destinate al completamento del Nuovo
Ospedale, ma sono state preventivamente assegnate risorse anche per la realizzazione dei programmi di
mantenimento qualitativo e di ammodernamento delle tecnologie che verranno destinate, nel triennio, a
compiti assistenziali, didattici e di ricerca.
In relazione a quanto sopra riportato, il Comitato di Indirizzo ha espresso parere positivo sul Bilancio
Preventivo Economico annuale 2013.
3. Obiettivi istituzionali e strategie aziendali
La legge n. 240 del 30 dicembre 2010 (cd. Riforma Gelmini) recante norme in materia di organizzazione
delle Università, ha disciplinato all’art. 24 comma 3 lettera a) lettera b) la figura del Ricercatori con
contratti a Tempo Determinato. Tali contratti di lavoro subordinato sono stipulati dalle Università al fine di
svolgere attività di ricerca, di didattica, di didattica integrativa e di servizio agli studenti. A tal proposito,
l’Università degli Studi di Parma, con decreto n. 849 del 03 luglio 2012 ha redatto un proprio
Regolamento per la disciplina ed il reclutamento di tale tipologia di ricercatori prevedendo la possibilità
(art. 15) di svolgere attività assistenziale ove collegata ai propri compiti di didattica e di ricerca.
Il 17 dicembre 2013, in attuazione dell’art. 24 comma 3 della L. 30 dicembre 2010 n. 240, si è pertanto
proceduto alla stipula di apposito Accordo tra l’Azienda Ospedaliero-Universitaria di Parma e l’Università
degli Studi di Parma al fine di disciplinare d’intesa l’impiego nelle attività assistenziali dei ricercatori a
tempo determinato, così da garantirne l’ordinato e funzionale svolgimento.
Per quanto concerne l’obiettivo di integrazione relativamente alla formazione medico-specialistica, punto
cardine è rappresentato dall’incentivare il pieno utilizzo della rete formativa di ciascuna Scuola di
Specializzazione e prioritariamente delle strutture di sede, come strumento di miglioramento della
didattica e della formazione professionalizzante.
L’Accordo Attuativo Locale sulla formazione medico-specialistica ha declinato tutti i principi volti a
garantire un flusso costante di innovazione del sistema in ordine allo sviluppo della formazione
professionalizzante.
L’Accordo sulla formazione medico-specialistica ha quindi accentuato la disponibilità delle strutture di
sede a direzione ospedaliera a soddisfare le esigenze formative previste dai Piani formativi delle Scuole di
Specializzazione di area sanitaria dell’Università degli Studi di Parma, ha focalizzato le sinergie dei
Consigli delle Scuole di Specializzazione, dei Dipartimenti ad Attività integrata, dei Dipartimenti
Universitari e del Collegio di Direzione, ha inoltre evidenziato la condizione di privilegiare l’offerta
formativa delle strutture di sede prima di ricorrere all’accensione di convenzioni con strutture collegate e
complementari.
La collaborazione, avviata con i Consigli delle Scuole di Specializzazione, ha condotto a un
perfezionamento dei flussi informativi necessari all’Azienda in ordine a:
composizione della rete formativa,
strutture frequentate dai medici in formazione specialistica (di sede, complementare, collegata)
ed eventuale rotazione tra le strutture con indicazione della sede prevalente in relazione alle
indicazioni operative regionali per la stipulazione dei contratti di formazione,
piani formativi e attività professionalizzanti,
individuazione degli incarichi didattici conferiti dai Consigli delle Scuole di Specializzazione ai
professionisti del SSR.
Nel contesto delle 40 Scuole di Specializzazione di Area Medica dell’Università degli Studi di Parma (16
scuole autonome - 5 scuole con Parma Capofila - 19 scuole con Parma aggregata), l’offerta formativa
delle strutture di sede afferenti all’Azienda, a fronte del numero complessivo dei medici in formazione
specialistica iscritti a Parma nell’anno accademico 2012/2013 pari a n. 574 unità, iscritti alle Scuole di
Specializzazione Autonome e con Parma Capofila, secondo la rilevazione effettuata nel precedente
capitolo 2.4.
A tale entità numerica si devono aggiungere gli ulteriori medici in formazione specialistica, pari n. 95 (non
compresi nella tabella specifica di cui al capitolo 2.4) frequentanti le scuole di specializzazione aggregate
di Area Medica dell’Università di Parma ma iscritti nelle sedi amministrative di altri Atenei in qualità di
Scuole Capofila.
Di seguito si riporta il numero e la denominazione delle Scuole di Specializzazione autonome
/capofila/aggregate:
Scuole di specializzazione dell’Università degli studi di Parma SEDE AUTONOMA N. 16 A.A.
2012/2013
DENOMINAZIONE DELLE SCUOLE DI SPECIALIZZAZIONE Anestesia, Rianimazione e terapia intensiva Chirurgia Generale Geriatria Ginecologia ed Ostetricia Igiene e Medicina Preventiva Malattie dell’apparato cardiovascolare 164
DENOMINAZIONE DELLE SCUOLE DI SPECIALIZZAZIONE Medicina del Lavoro Medicina d’emergenza‐urgenza Medicina fisica e riabilitativa Medicina Interna Nefrologia Neurologia Ortopedia e Traumatologia Pediatria Psichiatria Radiodiagnostica Aggregazioni di scuole con l’Università di Parma quale ATENEO NON CAPOFILA : N. 19
DENOMINAZIONE DELLE SCUOLE DI UNIVERSITA’ CAPOFILA AGGREGAZIONE DI SCUOLE CON SPECIALIZZAZIONE OVE PRESENTARE LA UNIVERSITA’ DI PARMA NON DOMANDA CAPOFILA ALLERGOLOGIA ED IMMUNOLOGIA ANCONA MODENA CLINICA PARMA BIOCHIMICA CLINICA PADOVA MODENA PARMA VERONA CARDIOCHIRURGIA BOLOGNA MODENA PARMA CHIRURGIA PLASTICA, RICOSTRUTTIVA GENOVA PARMA ED ESTETICA CHIRURGIA TORACICA MODENA ANCONA BOLOGNA PARMA CHIRURGIA VASCOLARE BOLOGNA ANCONA FERRARA MODENA PARMA DERMATOLOGIA E VENEREOLOGIA MODENA PARMA EMATOLOGIA MODENA PARMA ENDOCRINOLOGIA E MALATTIE DEL MODENA PARMA RICAMBIO GASTROENTEROLOGIA BOLOGNA FERRARA MODENA PARMA MALATTIE INFETTIVE BOLOGNA FERRARA MODENA PARMA MEDICINA LEGALE FERRARA PARMA MEDICINA TERMALE ROMA ‐ SAPIENZA BOLOGNA PADOVA 165
3. Obiettivi istituzionali e strategie aziendali
Aggregazioni di scuole con l’Università di Parma quale ATENEO CAPOFILA N. 5
DENOMINAZIONE DELLE SCUOLE DI UNIVERSITA’ CAPOFILA AGGREGAZIONE DI SCUOLE CON SPECIALIZZAZIONE OVE PRESENTARE LA UNIVERSITA’ DI PARMA CAPOFILA DOMANDA ANATOMIA PATOLOGICA PARMA MODENA CHIRURGIA MAXILLO‐FACCIALE PARMA BOLOGNA FERRARA MALATTIE DELL’APPARATO PARMA FERRARA RESPIRATORIO NEUROPSICHIATRIA INFANTILE PARMA BOLOGNA MODENA RADIOTERAPIA PARMA MODENA DENOMINAZIONE DELLE SCUOLE DI UNIVERSITA’ CAPOFILA AGGREGAZIONE DI SCUOLE CON SPECIALIZZAZIONE OVE PRESENTARE LA UNIVERSITA’ DI PARMA NON DOMANDA CAPOFILA PARMA PAVIA microbiologia e virologia BOLOGNA ANCONA MODENA PARMA OFTALMOLOGIA FERRARA MODENA PARMA ONCOLOGIA MODENA PARMA OTORINOLARINGOIATRIA FERRARA MODENA PARMA SCIENZA DELL’ALIMENTAZIONE BOLOGNA ANCONA BOLOGNA PARMA urologia MODENA PARMA Formazione medico specialistica A.A. 2012/2013
•
•
•
numero strutture di sede nell’Azienda: n. 38,
strutture aziendali collegate e complementari per Scuole con strutture di sede extra aziendali: n.
2 (Igiene e Medicina Preventiva e Medicina Legale),
convenzioni in essere: n. 90.
3. Obiettivi istituzionali e strategie aziendali
Anche nell’anno accademico 2012/2013 adeguato rilievo è stato attribuito al ruolo e alla valorizzazione
dei professionisti ospedalieri nell’ambito del processo di formazione degli specializzandi anche al fine di
realizzare il pieno utilizzo della rete ospedaliera.
L’apporto didattico registrato nell’anno accademico 2012/2013 ha riguardato n. 195 professionisti
ospedalieri cui sono stati conferiti incarichi didattici ripartiti secondo la seguente tipologia di incarico:
• n. 126 incarichi di solo docenza,
• n. 19 incarichi di solo tutoraggio,
• n. 50 incarichi di docenza e tutoraggio.
Si riportano in tabella le strutture aziendali coinvolte nell’attività didattica:
Descrizione strutture Numero docenti/tutor Direzione Generale 1 Ricerca e Innovazione 1 Servizio Fisica Sanitaria 1 Servizio Organizzazione e Gestione 4 Servizio di Med. Prev, Igiene Osp. e Sicurezza 1 Clinica e Terapia Medica 1 Ematologia e C.T.M.O. 2 Endocrinologia 1 Clinica e Immunologia Medica 2 Nefrologia 4 Genetica Medica 1 Semeiotica Medica 15 Malattie Infettive ed Epatologia 8 Oncologia Medica 19 Cardiologia 2 Medicina Interna ad Indirizzo Angiologico e Coagul 3 Pneumologia ed Endoscopia Toracica 2 Fisiopatologia Respiratoria 3 Neurologia 1 Clinica Geriatrica 2 Lungodegenza Critica 2 Geriatria 2 Clinica Chirurgica e Terapia Chirurgica 1 166
Numero docenti/tutor 1 5 3 2 1 3 1 1 6 1 3 1 1 2 2 3 4 1 3 2 7 31 3 6 5 1 1 1 3 6 1 1 2 1 1 1 1 1 4 1 195 Master e progetti di collaborazione con l’Università degli Studi di
Parma
All’interno dell’Azienda Ospedaliero-Universitaria si sta realizzando un Centro Comune di Ricerca (CCR),
polo dedicato alle attività di ricerca sull’uomo, dove opereranno tutti i professionisti interessati a
realizzare studi di buona qualità.
Il CCR si compone di 3 aree, strettamente integrate e complementari: l’area dei laboratori con tecnologie
d’avanguardia, l’area ambulatoriale con un ambiente idoneo alla ricerca e protetto e l’area della
formazione sulla ricerca per favorire la crescita professionale dei giovani medici e la loro capacità di
applicare ai pazienti quanto appreso in sede sperimentale.
La proficua intesa e l’importante sinergia che si è creata intorno a tale progetto innovativo e complesso
testimonia il patrimonio di competenze che opera nell’ospedale di Parma.
167
3. Obiettivi istituzionali e strategie aziendali
Descrizione strutture Chirurgia Toracica Neurochirurgia ‐ Neurotraumatologia Clinica Ortopedica Ortopedia Neurochirurgia Attività Comuni Dip. Neuroscienze Maxillo‐Facciale Otorinolaringoiatria e Otoneurochirurgia Odontostomatologia Oculistica Cardiochirurgia Urologia Chirurgia Plastica e Centro Ustionati Dermatologia Ostetricia e Ginecologia Neonatologia Pediatria e Oncoematologia Clinica Pediatrica Gastroenterologia ed Endoscopia Digestiva Chirurgia Pediatrica Pronto Soccorso e Medicina D'urgenza 1° Anestesia e Rianimazione 2° Anestesia, Rianimazione e Terapia Antalgica Scienze Radiologiche Radiologia Neuroradiologia Medicina Nucleare Radioterapia Microbiologia Diagnostica Ematochimica Anatomia e Istologia Patologica Medicina Riabilitativa Coord. Attività Special. Ambulatoriali Cardiologiche Medicina Interna,Reumatologia e Sezione Detenuti A Biochimica ad Elevata Automazione Day Hospital Dipartimentale Day Surgery Astanteria Pediatrica Radiologia Pediatrica Polo Emergenza Urgenza TOTALE Il laboratorio di ricerca all’avanguardia costituisce un contesto in cui promuovere ulteriormente
l’integrazione fra le competenze di docenti e ricercatori universitari e professionisti ospedalieri.
La realizzazione di tale progetto, utile a trasferire i risultati della ricerca alla pratica clinica, consentirà di
creare le condizioni e l’ambiente adatto per realizzare ricerca di alto livello e il pieno utilizzo delle
sofisticate strumentazioni a disposizione.
La realizzazione dell’area ambulatoriale e di quella dedicata alla formazione favorirà l’ampia
partecipazione dei professionisti ad attività di ricerca e l’accesso dei pazienti alle terapie più innovative e
personalizzate.
3. Obiettivi istituzionali e strategie aziendali
Altro ambito in cui si integrano in modo sinergico assistenza, didattica e ricerca è quello della
realizzazione di master di 1° livello che traggono origine dai bisogni espressi dall'organizzazione e
sviluppano competenze avanzate con ricadute pratiche sull’organizzazione stessa. Di seguito si riportano
alcuni dei master progettati e/o attivati nel corso nel 2013.
Case/Care Management in ospedale e sul territorio
Obiettivo del master è stato lo sviluppo delle conoscenze, delle abilità e delle competenze dei
professionisti nel coordinamento dei percorsi dell’utente e della famiglia e nell’utilizzo appropriato delle
risorse. Lo sviluppo del percorso formativo ha previsto una fase didattica che ha coinvolto non solo la
componente accademica, ma anche gli stakholders (le Aziende sanitarie locali di Parma, Reggio Emilia e
Piacenza, l’Agenzia sanitaria e sociale regionale, il Collegio Ipasvi di Parma e componenti della
Conferenza Territoriale Sociale Sanitaria). Le competenze gestionali sono state acquisite attraverso lo
svolgimento di tirocini in alcune aziende sanitarie della Regione, dove il modello del case management
rappresenta un’esperienza di eccellenza (AUSL BO, AUSL RE, AUSL PR, AUSL PC, AOU di PR, AO CR,
AUSL MN). A conclusione del percorso, attraverso una riflessione critica nata dalla coniugazione dei tre
elementi (didattica, assistenza e ricerca), sono state individuate nuove modalità di risposta ai bisogni di
salute dell’utente.
Sotto la guida di un project manager sono stati elaborati 6 project work, il cui obiettivo è
l’implementazione di progetti di miglioramento con ricadute effettive o da sperimentare nei contesti
organizzativi. Il primo project work aveva l’obiettivo di invidiare nuove modalità di risposta ai piccoli
pazienti affetti da malattie croniche o inguaribili, attraverso la valutazione dei bisogni delle famiglie. La
conclusione del progetto ha evidenziato alcuni potenziali ambiti di sviluppo dai quali partire per favorire
un’alleanza con il territorio, attraverso la traslazione del percorso pediatrico oncologico già in essere
nell’AOU di Parma, che incontra la piena soddisfazione dell’utenza, così come emerso dall’analisi dei dati.
Il secondo project work aveva l’obiettivo di analizzare il ruolo del case/care manager nell’organizzazione
ospedaliera per intensità di cura. Sono state coinvolte quattro Aziende Sanitarie della RER dove era
prevista la figura dell’ICCM (Integrated Community Case Management). I risultati evidenziano come il
percorso formativo intrapreso dall’Università con l’AOU di Parma sia una strategia vincente, al fine di
facilitare il consolidamento del cambiamento culturale, nel passaggio dalla vecchia organizzazione al
nuovo modello per intensità di cura. Il terzo project work ha riguardato un’indagine cross-sectional, con
l’obiettivo di individuare le modalità di presa in carico, la continuità assistenziale e il ruolo del case
manager nella gestione dei pazienti stomizzati. I risultati evidenziano una buona rete sia ospedaliera che
territoriale per questa tipologia di utenza, pur mostrando aree di sviluppo futuro per l’ introduzione della
figura del case/care manager. L’obiettivo del quarto project work puntava alla valutazione dell’offerta dei
servizi nel contesto locale (territoriale e ospedaliero) per i pazienti affetti da scompenso cardiaco, anche
tramite la soddisfazione dell’utente. I risultati hanno evidenziato alcuni potenziali ambiti di sviluppo dai
quali partire per favorire un’alleanza ospedale e territorio, riconoscendo come esempio efficace da
adottare un percorso integrato già in essere con l’AUSL (percorso del paziente diabetico), che prevede un
professionista dedicato. Il quinto project work aveva l’obiettivo di analizzare le modalità di
implementazione del percorso ortogeriatrico e il ruolo del case/care manager in regione. Sono stati
coinvolti otto centri (AUSL e AOU) e i risultati mostrano come la presenza del responsabile del caso sia
una strategia vincente, si avverte inoltre l’esigenza di un ICCM, proprio per gestire tutti gli aspetti
assistenziali del caso. Il sesto project work mirava all’individuazione delle competenze interculturali
possedute dall’infermiere ICCM prima nella Regione Emilia Romagna e successivamente su tutto il
territorio nazionale, rispetto ad altri professionisti. I risultati mostrano come l’atteggiamento verso altre
culture è risultato più che positivo rispetto alla frequenza con la quale sono messi in atto comportamenti
culturalmente competenti e gli ICCM riportano punteggi maggiori rispetto ad altri professionisti.
168
Il master ha avuto inizio nell’aprile del 2013, si è concluso in aprile 2014 e ha avuto una durata
complessiva di 1500 ore corrispondenti a 60 crediti formativi universitari (CFU) comprensivi di attività
didattica teorica e pratica (formazione teorica, pari a 40 CFU per 1000 ore e formazione pratica, pari a 20
CFU per 750 ore). Hanno partecipato al master 14 infermieri, di cui 9 con appartenenza lavorativa
all’Azienda Ospedaliero-Universitaria di Parma.
Il master si è concluso secondo le seguenti modalità:
Il gruppo dei partecipanti è stato suddiviso in 3 sottogruppi. Ogni sottogruppo ha sviluppato 3 tematiche
specifiche:
1. validazione in italiano di uno strumento per la valutazione degli outcome in cure palliative (il POS);
2. audit su un campione randomizzato di cartelle cliniche dell'Azienda Ospedaliero-Universitaria di Parma
per vedere come e se viene rilevato il dolore (in base ai dettami della legge 38);
3. Le cure complementari (CAM) riconosciute dal collegio IPASVI: valutare l'efficacia dei trattamenti sul
dolore, con particolare riferimento alla metodica del tocco-massaggio.
Ogni sottogruppo è stato coordinato da un tutor con competenze di ricerca avanzate.
Tutti i lavori sono stati valutati dalla commissione del master con il massimo dei voti per ogni discente
(110/110) e in tre casi sono state assegnate le lodi.
Il gradimento del master è stato misurato in itinere attraverso dei questionari costruiti ad hoc
(valutazione intermedia e a fine moduli didattici); il gradimento è risultato essere mediamente alto, sia
per ciò che riguarda il gradimento sui contenuti, sia il gradimento sulle modalità di conduzione delle
lezioni da parte dei docenti. Sono state altresì messe in evidenza alcune problematiche, come la
sovrapposizione, sebbene molto limitata, di alcuni contenuti, e in diversi casi la difficoltà di partecipare
alle lezioni e ai lavori di gruppo per motivi legati alle attività lavorative.
E’ prevista un’ulteriore indagine circa il gradimento generale del master.
Si prevede un workshop aziendale per divulgare i risultati dei lavori finali e proporne la pubblicazione in
alcune riviste scientifiche infermieristiche.
Competenze avanzate in infermieristica pediatrica
Il master si è proposto di ampliare le conoscenze, le abilità e le competenze relazionali e comunicative dei
professionisti che operano in ambito pediatrico.
In particolare, ci si è proposti di favorire:
•
l’acquisizione di strumenti mirati alla gestione clinico assistenziale del paziente pediatrico e della
famiglia;
•
lo sviluppo di competenze nella gestione di situazioni critiche e complesse;
•
interazioni positive con i pazienti/utenti e le famiglie;
169
3. Obiettivi istituzionali e strategie aziendali
Dolore e cure palliative
Obiettivi formativi di base:
•
Conoscenza della storia della terapia del dolore e delle cure palliative;
• Acquisizione di conoscenze teoriche di livello avanzato nella Fisiopatologia Clinica del dolore
cronico e delle malattie cronico-evolutive;
•
Conoscenza degli approcci diagnostici e terapeutici del dolore cronico in ogni sua fase di malattia,
e delle fasi di malattia dolorosa nelle fasi avanzate di malattia;
•
Conoscenza degli aspetti psicologici e spirituali che caratterizzano le esperienze di dolore cronico,
delle fasi di malattia dolorosa nelle fasi avanzate di malattia e di fine vita;
•
Comprensione dei problemi legali ed etici dell'assistenza in terapia del dolore e cure palliative;
•
Acquisire competenze nel supporto a utente e famiglia nel paziente con dolore cronico e nel
paziente nelle fasi terminali di malattia;
•
Sviluppo di un ragionamento etico e conseguentemente saper prendere decisioni
deontologicamente corrette rispetto a problematiche riguardanti il paziente con dolore acuto e/o
cronico e in condizioni cliniche in fase terminale;
•
Partecipazione ad attività di sviluppo e di ricerca di base e applicata.
Il master si è articolato in cinque moduli che hanno permesso di sviluppare altrettante aree di
competenza:
•
Discipline generali per la formazione in cure palliative e terapia del dolore,
•
Discipline specifiche per la formazione in cure palliative e terapia del dolore,
•
Scienze Infermieristiche e Scienze della Riabilitazione,
•
Dimensioni sociali ed etiche,
•
Discipline medico-chirurgiche.
3. Obiettivi istituzionali e strategie aziendali
•
lo sviluppo di proficue relazioni interprofessionali.
Il master ha avuto inizio in aprile 2013 e si concluderà nel mese di giugno 2014.
Hanno partecipato 20 infermieri, di cui 12 con appartenenza lavorativa all’Azienda OspedalieroUniversitaria di Parma.
Il master si è articolato in cinque moduli che hanno sviluppato altrettante aree di competenza:
• l’acquisizione di competenze clinico assistenziali;
• l’acquisizione di competenze relazionali/educative;
• l’acquisizione di competenze gestionali;
• l’acquisizione di competenze nell’area della ricerca;
• l’acquisizione di competenze nell’area etico deontologica.
L’acquisizione delle competenze si è esplicata attraverso nuclei tematici gestiti da docenti esperti, per un
totale di 200 ore e la partecipazione a laboratori per un totale di 70 ore. La capacità di applicazione dei
contenuti e delle tecniche acquisite nell’ambito della propria pratica professionale si è esplicata attraverso
uno stage di 500 ore.
Il master si concluderà con la presentazione e la discussione dei project work, elaborati da gruppi
composti da 3-4 partecipanti, che saranno oggetto di valutazione da parte della commissione del master.
I project work, coordinati da tutor con competenze di ricerca avanzate, verteranno su tematiche attinenti
l’ambito pediatrico, ritenuto dal comitato scientifico di particolare rilevanza nel contesto ospedaliero.
Avranno, inoltre, l’obiettivo di formulare progetti di miglioramento, che porteranno spunti di riflessione e
ricadute sulla pratica professionale e sull’organizzazione aziendale. In particolare, i temi trattati saranno:
“Il supporto ai famigliari nella morte del bambino prematuro”
“L’intensità di cura a partire dall’accettazione pediatrica”
“Il family center care nel contesto della neonatologia”
“La figura del genitore nell’iter operatorio pediatrico”
“Tecniche di trattamento del dolore non farmacologiche nel bambino”
“La cartella infermieristica elettronica nell’ambito pediatrico”.
Il gradimento del master è stato misurato attraverso due focus group: a metà corso il gradimento è parso
relativamente alto, con l’evidenza di alcune difficoltà, legate soprattutto alla possibilità della
partecipazione e della presenza per esigenze lavorative.
E’ prevista un’ulteriore analisi del gradimento al termine del master. Saranno inoltre, approfondite
tematiche specifiche, attraverso seminari con esperti, sui temi della “Promozione della salute della donna,
delle coppie e delle future generazioni” e “L’età adolescenziale: aspetti normativi e setting assistenziali”.
170
&RQGL]LRQLGLODYRUR
FRPSHWHQ]HGHOSHUVRQDOH
HGHIILFLHQ]D
GHOO¶RUJDQL]]D]LRQH
,O TXDUWR FDSLWROR q YROWR D LOOXVWUDUH OH VFHOWH D]LHQGDOL
SHUODYDORUL]]D]LRQHGHOOHFRPSHWHQ]HSURIHVVLRQDOLGHO
SHUVRQDOH /D YDORUL]]D]LRQH GHOOH FRPSHWHQ]H
SURIHVVLRQDOLSXzWURYDUHGLYHUVHGHFOLQD]LRQLDVHFRQGD
GHOO¶DFFH]LRQH H GHJOL VWUXPHQWL RUJDQL]]DWLYL FKH
FLDVFXQD D]LHQGD SULYLOHJLD ,O FDSLWROR VYLOXSSD
QXPHURVHWHPDWLFKHLQGLYLGXDWHGLVHJXLWR
•
/D³FDUWDGLLGHQWLWj´GHOSHUVRQDOH
•
3DUWHFLSD]LRQHGHLSURIHVVLRQLVWL
DOO¶LQGLYLGXD]LRQHGHOOHVWUDWHJLHD]LHQGDOLHDOOD
JHVWLRQHRSHUDWLYD
•
*HVWLRQHGHOULVFKLRHVLFXUH]]D
•
5LGHILQL]LRQHGHLUXROLSURIHVVLRQDOLLQUHOD]LRQH
DOORVYLOXSSRGHOOHVWUDWHJLHD]LHQGDOL
•
6LVWHPDGLYDOXWD]LRQHGHOOHFRPSHWHQ]HH
VLVWHPLSUHPLDQWL
•
)RUPD]LRQH
•
/DIRUPD]LRQHGHJOLRSHUDWRULVDQLWDUL
QHOO¶DPELWRUHOD]LRQDOHGDOODFXUDDOSUHQGHUVL
FXUD
•
6LVWHPDLQIRUPDWLYRGHOSHUVRQDOH
•
6WUXWWXUDGHOOHUHOD]LRQLFRQLOSHUVRQDOH
GLSHQGHQWHHFRQOHVXHUDSSUHVHQWDQ]H
•
/HD]LRQLLQWHPDGLVHUYL]LDOODSHUVRQDHDJOL
RSHUDWRUL
/D³FDUWDGLLGHQWLWj´GHOSHUVRQDOH
,OIDWWRUHXPDQRVWUDWHJLFRSHULOFRQVHJXLPHQWRGHJOLRELHWWLYLD]LHQGDOLqWUDLGLYHUVLIDWWRULSURGXWWLYL
TXHOOR FKH SUHVHQWD OD PDJJLRUH FRPSOHVVLWj H VL DSSDOHVD GHWHUPLQDQWH VRSUDWWXWWR LQ XQD D]LHQGD GL
VHUYL]LDOODSHUVRQDFRQXQDIRUWHFRPSRQHQWHUHOD]LRQDOHWUDJOLXWHQWLHJOLRSHUDWRULTXDOHqO¶D]LHQGD
VDQLWDULD
'L VHJXLWR YLHQH GHOLQHDWD O¶´LGHQWLWj´ GHOO¶RVSHGDOHGL 3DUPD GDOSXQWR GL YLVWD GHO FDSLWDOH XPDQR FRQ
ULIHULPHQWR DOOD FRQVLVWHQ]D QXPHULFD DOOD WLSRORJLD FRQWUDWWXDOH DOOD GLQDPLFD GHJOL LQJUHVVL H GHOOH
XVFLWHQRQFKpDOJHQHUHGLFRORURFKHSUHVWDQRODSURSULDDWWLYLWjDOO¶LQWHUQRGHOOHVWUXWWXUHRVSHGDOLHUH
,O SHUVRQDOH FKH RSHUD SUHVVR O¶$]LHQGD 2VSHGDOLHUR8QLYHUVLWDULD GL 3DUPD DOOD GDWD GHO q
FRVWLWXLWRGDXQLWj
$QDOL]]DQGRODWLSRORJLDFRQWUDWWXDOHSHUVLVWHFRPHJLjULOHYDWRQHLELODQFLGHJOLDQQLSUHFHGHQWLODQHWWD
SUHYDOHQ]D GHO UDSSRUWR GL ODYRUR VXERUGLQDWR D WHPSR LQGHWHUPLQDWR ULVSHWWR DOOH DOWUH IRUPH GL
LPSLHJRSXUDVVLVWHQGRDGXQDOLHYHGLPLQX]LRQHGHOODFRQVLVWHQ]DFRPSOHVVLYDGHOOHGRWD]LRQLRUJDQLFKH
6LFRQIHUPDLQROWUHLOFRVWDQWHGHFUHPHQWRGHOSHUVRQDOHXQLYHUVLWDULRFKHVYROJHDWWLYLWjDVVLVWHQ]LDOH
, FRQWUDWWL GL ODYRUR IOHVVLELOH OHJDWL DOO¶HVSOHWDPHQWR GL SURJHWWL D]LHQGDOL DQFKH FRQQHVVL DG DWWLYLWj GL
ULFHUFDFRVWLWXLVFRQRLOGHOWRWDOHGHOOHSURIHVVLRQDOLWjSUHVHQWLLQ$]LHQGD
7DEHOOD$QGDPHQWRGHOOHGRWD]LRQLRUJDQLFKHSHUWLSRORJLDFRQWUDWWXDOHHUXRORDQQL
$QQL
3HUVRQDOH 3HUVRQDOH 3HUVRQDOH
3HUVRQDOH
UXROR
UXROR
UXROR
UXROR
7RWDOH
VDQLWDULR SURIHVVLRQDOH WHFQLFR DPPLQLVWUDWLYR
$OWURSHUVRQDOH
LQFDULFKLOLEHURSURIHVVLRQDOL HDUDSSRUWRGLFROODERUD]LRQH
7HPSRLQGHWHUPLQDWR
7HPSRGHWHUPLQDWR
SHUTXHVWDWLSRORJLDFRQWUDWWXDOHODULOHYD]LRQHqVWDWDHIIHWWXDWDVHFRQGRLFULWHULGHOFRQWRDQQXDOH
7DEHOOD$QGDPHQWRGHOOHGRWD]LRQLRUJDQLFKHGHOSHUVRQDOHXQLYHUVLWDULRSHUUXRORDQQL
3HUVRQDOHXQLYHUVLWDULR
$QQL
3HUVRQDOH 3HUVRQDOH 3HUVRQDOH
3HUVRQDOHUXROR
UXROR
UXROR
UXROR
7RWDOH
DPPLQLVWUDWLYR
VDQLWDULR SURIHVVLRQDOH WHFQLFR
SHU TXHVWD WLSRORJLD FRQWUDWWXDOH OD ULOHYD]LRQH q VWDWD HIIHWWXDWD VHFRQGR L FULWHUL XWLOL]]DWL SHU LO SHUVRQDOH
RVSHGDOLHUR
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHG
HIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
$QDOLVLGLJHQHUHGHOSHUVRQDOH
/¶DQDOLVL GL JHQHUH SHU YDOXWDUH LQ XQ¶RWWLFD GL TXDOLWj OH SROLWLFKH HFRQRPLFKH H VRFLDOL GHJOL LQWHUYHQWL
SXEEOLFLFKHLPSDWWDQRLQPRGRGLYHUVRVXXRPLQLHGRQQHFKHKDQQRXQ¶HVSHULHQ]DGLYLWDGLIIHUHQWHFRVu
FRPH UXROL H SRWHUH VRFLDOH VWD DVVXPHQGR XQ¶LPSRUWDQ]D VHPSUH FUHVFHQWH DOO¶LQWHUQR GHOOH VWUXWWXUH
D]LHQGDOLVRSUDWWXWWRGLTXHOOHSXEEOLFKH
&RQ OH WDEHOOH H L JUDILFL FKH VHJXRQR SHUFRUUHQGR XQ VHQWLHUR JLj WUDFFLDWR QHL ELODQFL GHJOL DQQL
SUHFHGHQWLVLYRJOLRQRIRUQLUHDOFXQLHOHPHQWLXWLOLSHUXQ¶LQGDJLQHGLJHQHUHGHOSHUVRQDOHFKHVYROJHOD
SURSULDDWWLYLWjQHOOHVWUXWWXUHD]LHQGDOL
,QSULPROXRJRVLHYLGHQ]LDODPDUFDWDSUHYDOHQ]DGHOODFRPSRQHQWHIHPPLQLOHULVSHWWRDOWRWDOH
GHO SHUVRQDOH LQ VHUYL]LR D WHPSR LQGHWHUPLQDWR H GHWHUPLQDWR 0HQWUH QHOOD SRSROD]LRQH XQLYHUVLWDULD
SUHYDOHODFRPSRQHQWHPDVFKLOHFRQLO
*UDILFR'LVWULEX]LRQHGHLGLSHQGHQWLRVSHGDOLHULSHUHWjHSHUJHQHUHDQQL
хсϲϱ
ϰ
ϳ
ϵ
ϮϳϬϵ
ϱϭϭ
ϱϰϲ
ϱϱͲϲϰ
ϮϳϭϬ
&ĞŵŵŝŶĞ
ϲϮϯ
Ϯϲϲϲ
ϭϮϯϯ
ϭϮϴϯ
ϭϮϴϳ
ϰϱͲϱϰ
ϭϭϬϬ
ϭϯϲϭ
ϭϯϭϰ
ϭϮϱϮ
ϯϱͲϰϰ
фϯϱ
DĂƐĐŚŝ
ŶŶŽϮϬϭϭ
ŶŶŽϮϬϭϮ
ŶŶŽϮϬϭϯ
ϳϬϬ
ϲϰϲ
ϱϱϲ
ϭϬϴϲ
ŶŶŽϮϬϭϭ
ŶŶŽϮϬϭϮ
ŶŶŽϮϬϭϯ
ϭϬϲϭ
*UDILFR'LVWULEX]LRQHGHOSHUVRQDOHXQLYHUVLWDULRSHUHWjHSHUJHQHUHDQQL
! )HPPLQH
0DVFKL
$QQR
$QQR
$QQR
$QQR
$QQR
$QQR
*UDILFR 'LVWULEX]LRQH SHU JHQHUH GHL GLSHQGHQWL RVSHGDOLHUL H XQLYHUVLWDUL YDORUL
SHUFHQWXDOLDQQR
ŝƉĞŶĚĞŶƚŝŽƐƉĞĚĂůŝĞƌŝ
ŝƉĞŶĚĞŶƚŝƵŶŝǀĞƌƐŝƚĂƌŝ
28%
41%
59%
Maschi
Maschi
72%
Femmine
Femmine
*UDILFR'LVWULEX]LRQHSHUJHQHUHGHLGLSHQGHQWLRVSHGDOLHULHXQLYHUVLWDULYDORULDVVROXWLDO
ŝƉĞŶĚĞŶƚŝŽƐƉĞĚĂůŝĞƌŝ
ϭϬϲϭ
ϵϬ
Ϯϲϲϲ
ϭϮϳ
Maschi
Femmine
DĂƐĐŚŝ
&ĞŵŵŝŶĞ
6L ULEDGLVFH LQROWUH FKH O¶DFFHVVR DO SDUW WLPH FRVWLWXLVFH XQD SUHURJDWLYD SUHYDOHQWHPHQWH IHPPLQLOH H
VRSUDWWXWWRGHOSHUVRQDOHGHOO¶DUHDFRPSDUWR
7DEHOOD'LVWULEX]LRQHGHLGLSHQGHQWLRVSHGDOLHULDWHPSRLQGHWHUPLQDWRSHUFDWHJRULH
JHQHUHHDFFHVVRDOSDUWWLPHDQQL
DO
&DWHJRULH
'LULJHQWLPHGLFL
$OWULGLULJHQWLVDQLWDUL
$37
3HUVRQDOHLQIHUPLHULVWLFR
3HUVRQDOHGHOOD
ULDELOLWD]LRQH
3HUVRQDOHWHFQLFRGHOOD
SUHYHQ]LRQH
3HUVRQDOHWHFQLFRVDQLWDULR
$OWURSHUVRQDOHUXROR
WHFQLFR
3HUVRQDOH27$266
DXVLOLDULR
3HUVRQDOHDPPLQLVWUDWLYR
7RWDOH
DO
&DWHJRULH
'LULJHQWLPHGLFL
$OWULGLULJHQWLVDQLWDUL
$37
3HUVRQDOHLQIHUPLHULVWLFR
3HUVRQDOHGHOOD
ULDELOLWD]LRQH
3HUVRQDOHWHFQLFRGHOOD
SUHYHQ]LRQH
3HUVRQDOHWHFQLFRVDQLWDULR
$OWURSHUVRQDOHUXROR
WHFQLFR
3HUVRQDOH27$266
DXVLOLDULR
3HUVRQDOHDPPLQLVWUDWLYR
7RWDOH
0
)
0
)
0
)
SDUW SDUW
SDUW SDUW
7RWDOH 7RWDOH
WHPSR WHPSR
WLPH WLPH
WLPH WLPH
0
)
SLHQR SLHQR
ROWUH ROWUH
7RWDOH
0
)
0
)
0
)
SDUW SDUW
SDUW SDUW
7RWDOH 7RWDOH
WHPSR WHPSR
WLPH WLPH
WLPH WLPH
0
)
SLHQR SLHQR
ROWUH ROWUH
7RWDOH
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
ŝƉĞŶĚĞŶƚŝƵŶŝǀĞƌƐŝƚĂƌŝ
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
DO
&DWHJRULH
'LULJHQWLPHGLFL
$OWULGLULJHQWLVDQLWDUL
$37
3HUVRQDOHLQIHUPLHULVWLFR
3HUVRQDOHGHOOD
ULDELOLWD]LRQH
3HUVRQDOHWHFQLFRGHOOD
SUHYHQ]LRQH
3HUVRQDOHWHFQLFRVDQLWDULR
$OWURSHUVRQDOHUXROR
WHFQLFR
3HUVRQDOH27$266
DXVLOLDULR
3HUVRQDOHDPPLQLVWUDWLYR
7RWDOH
0
)
0
)
0
)
SDUW SDUW
SDUW SDUW
7RWDOH 7RWDOH
WHPSR WHPSR
WLPH WLPH
WLPH WLPH
0
)
SLHQR SLHQR
ROWUH ROWUH
7RWDOH
7DEHOOD'LVWULEX]LRQHSHUJHQHUHHDUHHFRQWUDWWXDOLGHLGLSHQGHQWLRVSHGDOLHULDO
$UHHFRQWUDWWXDOL 7RWDOH 7RWDOH
&RPSDUWR
'LULJHQ]D
7RWDOL
)
)
0
0
$QDOL]]DQGR QHOODWDEHOODFKHSUHFHGHUHODWLYDDOODGLVWULEX]LRQHGLJHQHUHWUDLOSHUVRQDOHGLULJHQWHHLO
SHUVRQDOH GHO FRPSDUWR VL ULOHYD XQ VRVWDQ]LDOH HTXLOLEULR WUD PDVFKL H IHPPLQH QHOO¶DUHD GLULJHQ]LDOH
VHSSXUHFRQXQDOLHYHSUHYDOHQ]DPDVFKLOHULVSHWWRDOODFRPSRQHQWHIHPPLQLOH7DOHGDWRYDPHVVRLQ
UHOD]LRQHWXWWDYLDDOODGLYHUVDGLVWULEX]LRQHGHLJHQHULQHOO¶DUHDFRPSDUWR1HOO¶DUHDGHOFRPSDUWRLQIDWWL
qQHWWDODSUHYDOHQ]DGLSHUVRQDOHIHPPLQLOHULVSHWWRDTXHOORPDVFKLOH
*UDILFR(YROX]LRQHFRQVLVWHQ]DSHUVRQDOHIHPPLQLOHQHOO¶DUFRWHPSRUDOH
ϮϴϬϬ
ϮϳϬϬ
ϮϲϬϬ
ϮϱϬϬ
ϮϰϬϬ
ϮϯϬϬ
ϮϮϬϬ
ϮϭϬϬ
ϮϬϬϯ ϮϬϬϰ ϮϬϬϱ ϮϬϬϲ ϮϬϬϳ ϮϬϬϴ ϮϬϬϵ ϮϬϭϬ ϮϬϭϭ ϮϬϭϮ ϮϬϭϯ
1HOO¶DUFR WHPSRUDOH FRPH VL HYLQFH QHL JUDILFL H OD FRPSRVL]LRQH GHOOD SRSROD]LRQH
ODYRUDWLYDD]LHQGDOHYHGHXQDPDUFDWDSUHYDOHQ]DGHOODFRPSRQHQWHIHPPLQLOHULVSHWWRDTXHOODPDVFKLOH
FRQXQGLYDULRIUDOHGXHFRPSRQHQWLFKHDSSDUHVRVWDQ]LDOPHQWHVWDELOHQHJOLXOWLPLDQQL
*UDILFR(YROX]LRQHUDSSRUWRWUDSHUVRQDOHIHPPLQLOHHPDVFKLOHQHOO¶DUFRWHPSRUDOH
&ĞŵŵŝŶĞ
DĂƐĐŚŝ
ϯϬϬϬ
ϮϬϬϬ
ϭϱϬϬ
ϭϬϬϬ
ϱϬϬ
Ϭ
ϮϬϬϯ ϮϬϬϰ ϮϬϬϱ ϮϬϬϲ ϮϬϬϳ ϮϬϬϴ ϮϬϬϵ ϮϬϭϬ ϮϬϭϭ ϮϬϭϮ ϮϬϭϯ
/D WDEHOOD SUHVHQWD OD GLVWULEX]LRQH QHOOH DUHH GL ULIHULPHQWR VDQLWDULD SURIHVVLRQDOH WHFQLFD H
DPPLQLVWUDWLYDGHOODSRSROD]LRQHD]LHQGDOHFRPSOHVVLYDHULVSHWWLYDPHQWHGHOODSRSROD]LRQHIHPPLQLOHH
GLTXHOODPDVFKLOH
7DEHOOD'LVWULEX]LRQHGHLGLSHQGHQWLRVSHGDOLHULSHUJHQHUHHSHUDUHHDO
$UHD
6DQLWDULD
3URIHVVLRQDOH
7RWDOH
WRWDOH
)
)
0
$PPLQLVWUDWLYD
7RWDOL
7HFQLFD
0
/H WDEHOOH FKH VHJXRQR FRQVHQWRQR XQ DSSURIRQGLPHQWR LQ PHULWR DOOD GLVWULEX]LRQH GHO SHUVRQDOH LQ
UHOD]LRQHDOO¶DWWULEX]LRQHGLLQFDULFKLQHLUXROLGLULJHQ]LDOLRGLUHVSRQVDELOLWj
2OWUHLOGHOSHUVRQDOHGLULJHQWHDSSDUWLHQHDOO¶DUHDVDQLWDULDWDEHOOD6LULOHYDVLDWUDLOSHUVRQDOH
GL DUHD VDQLWDULD FKH WUD TXHOOR GL DUHD DPPLQLVWUDWLYD XQD PLQLPD SUHYDOHQ]D GHOOD FRPSRQHQWH
IHPPLQLOH &RPH JLj RVVHUYDWR WDOH GDWR YD FRQVLGHUDWR FRQ ULIHULPHQWR DOOD GLYHUVD GLVWULEX]LRQH GHL
JHQHULQHOO¶DUHDFRPSDUWRFIUWDEHOODHJUDILFLH
7DEHOOD'LVWULEX]LRQHGHOSHUVRQDOHGHOOHDUHHGLULJHQ]LDOLDWHPSRLQGHWHUPLQDWRH
GHWHUPLQDWRSHUJHQHUHDO
$UHD
6DQLWDULD
7RWDOHWRWDOH
)
)
0
0
3URIHVVLRQDOH
7HFQLFD
$PPLQLVWUDWLYD
7RWDOL
7DEHOOD'LVWULEX]LRQHGHLUXROLGHOSHUVRQDOHGHOFRPSDUWRSHUJHQHUHHSHUUXRORDO
5XROR
6DQLWDULR
3URIHVVLRQDOH
7RWDOH WRWDOH
)
7HFQLFR
$PPLQLVWUDWLYR
7RWDOL
)
0
0
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
ϮϱϬϬ
*UDILFR3HUVRQDOHIHPPLQLOHHGLULJHQWLGRQQH±
ϮϬϬϯ
ϮϬϬϰ
ϮϬϬϱ
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
ϮϬϬϲ
ϮϬϬϳ
ϮϬϬϴ
&ĞŵŵŝŶĞ
ŝƌŝŐĞŶnjĂ
&ĞŵŵŝŶĞ
dŽƚĂ ů ŝ
ϮϬϬϵ
ϮϬϭϬ
ϮϬϭϭ
ϮϬϭϮ
ϮϬϭϯ
Ϭ͕ϬϬ
ϮϬ͕ϬϬ
ϰϬ͕ϬϬ
ϲϬ͕ϬϬ
ϴϬ͕ϬϬ
ϭϬϬ͕ϬϬ
1HOSHULRGRGLWHPSRVLDVVLVWHDGXQSURJUHVVLYRLQFUHPHQWRGHOODFRPSRQHQWHGLULJHQ]LDOH
IHPPLQLOHDIURQWHGLXQDVRVWDQ]LDOHVWDELOLWjGLTXHOODPDVFKLOH
1HOOH WDEHOOH FKH VHJXRQR VL SXz RVVHUYDUH FRPH VRQR ULSDUWLWL JOL LQFDULFKL GLULJHQ]LDOL DO SHUVRQDOH
RVSHGDOLHUR FRQ HVFOXVLRQH FLRq GHO SHUVRQDOH XQLYHUVLWDULR H JOL LQFDULFKL GL UHVSRQVDELOLWj SRVL]LRQH
RUJDQL]]DWLYDHFRRUGLQDPHQWRDIILGDWLDOSHUVRQDOHGHOO¶DUHDGHOFRPSDUWR
3HU TXDQWR ULJXDUGD JOL LQFDULFKL GLULJHQ]LDOL WDEHOOD VL FRQIHUPD FKH L OLYHOOL DSLFDOL 'LUHWWRUH GL
'LSDUWLPHQWR 'LUHWWRUH GL 826HUYL]LR 5HVSRQVDELOH 66' ULVXOWDQR DQFRUD SUHURJDWLYD PDVFKLOH LQ
WHUPLQL DVVROXWL H SHUFHQWXDOL ULOHYDQGR DO FRQWUDULR XQD SUHYDOHQ]D IHPPLQLOH QHJOL LQFDULFKL GL OLYHOOR
LQIHULRUH&DVH0DQDJHUH&DVH0DQDJHU(VSHUWR
5HODWLYDPHQWH DOOD WLWRODULWj GHJOL LQFDULFKL GL SRVL]LRQH RUJDQL]]DWLYD WDEHOOD LO QXPHUR GHOOH
GLSHQGHQWL IHPPLQH WLWRODUH GL SRVL]LRQH RUJDQL]]DWLYD ULVXOWD VXSHULRUH ULVSHWWR D TXHOOR GHL GLSHQGHQWL
PDVFKL 2VVHUYDQGR SHUz O¶LQFLGHQ]D SHUFHQWXDOH VXO WRWDOH GHOOD SRSROD]LRQH GL ULIHULPHQWR WLWRODUL GL
SRVL]LRQH RUJDQL]]DWLYD GRQQHSRSROD]LRQH IHPPLQLOH GHO FRPSDUWR SHU H WLWRODUL GL SRVL]LRQH
RUJDQL]]DWLYD XRPLQLSRSROD]LRQH PDVFKLOH GHO FRPSDUWR SHU L YDORUL VRQR SLXWWRVWR DOOLQHDWL
ULVSHWWLYDPHQWH H /D SUHYDOHQ]D IHPPLQLOH LQ YDORUH DVVROXWR HYLGHQ]LDWD GDOOD WDEHOOD
VHPEUDGHWHUPLQDWDGDOODQHWWDSUHGRPLQDQ]DGLWDOHFRPSRQHQWHTXHOODIHPPLQLOHDSSXQWRFIUWDEHOOD
WUDODSRSROD]LRQHGHOFRPSDUWR
1HOO¶DPELWR GHJOL LQFDULFKL GL FRRUGLQDPHQWR WDEHOOD OD SUHVHQ]D IHPPLQLOH VL UDIIRU]D ULVSHWWR D
TXHOODPDVFKLOHVLDLQYDORUHDVVROXWRFKHFRPHLQFLGHQ]DSHUFHQWXDOH
7DEHOOD'LVWULEX]LRQHGHOODJUDGXD]LRQHGHJOLLQFDULFKLRVSHGDOLHULGHOSHUVRQDOHDWHPSR
LQGHWHUPLQDWRSHUJHQHUHDO
7LSRORJLDLQFDULFR
)
'LUHWWRUH'LSDUWLPHQWR
'LUHWWRUH826HUYL]LR
5HVSRQVDELOHVWUXWWXUDVHPSOLFHGLSDUWLPHQWDOH
5HVSRQVDELOHVWUXWWXUDVHPSOLFH
5HVSRQVDELOHGLSURJUDPPDVWUXWWXUDVHPSOLFHGLSDUWLPHQWDOH
,QFDULFRGLDOWDVSHFLDOL]]D]LRQH
&DVH0DQDJHU(VSHUWR
&DVH0DQDJHU
7RWDOL
)
0
0 7RWDOLWRWDOL
7DEHOOD'LVWULEX]LRQHLQFDULFKLGLSRVL]LRQHRUJDQL]]DWLYDSHUUXRORHSHUJHQHUHDO
5XROR
6DQLWDULR
3URIHVVLRQDOH
7HFQLFR
$PPLQLVWUDWLYR
7RWDOL
)HPPLQH )HPPLQH 0DVFKL 0DVFKL
7RWDOH
7DEHOOD'LVWULEX]LRQHLQFDULFKLGLFRRUGLQDPHQWRSHUJHQHUHDO
7RWDOH
$QDOLVLGLJHQHUHGHOSHUVRQDOHPHGLFR
2VVHUYDQGR VSHFLILFDPHQWH OD GLULJHQ]D PHGLFD VL ULOHYD JUDILFR OD SUHYDOHQ]D GHOOD FRPSRQHQWH
IHPPLQLOHWUDOHJLRYDQLJHQHUD]LRQLRVVLDIUDFKLKDPHQRGLDQQL
*UDILFR'LVWULEX]LRQHSHUJHQHUHHSHUIDVFLDGLHWjDUHDGLULJHQ]DPHGLFD
120
100
80
Femmine
60
Maschi
40
20
0
<35
35-44
45-54
55-64
>= 65
'LSDUWLFRODUHLQWHUHVVHqODGLVWULEX]LRQHFRQULIHUPHQWRDOODGLVFLSOLQDSUHVHQWDWDQHOODWDEHOOD
6L RVVHUYD XQD PDUFDWD SUHYDOHQ]D PDVFKLOH VRSUDWWXWWR QHOOH GLVFLSOLQH FKLUXUJLFKH 0HQWUH QHOOH DOWUH
DUHH GLVFLSOLQDUL VL ULOHYD FRPSOHVVLYDPHQWH XQD VRVWDQ]LDOH SDULWj FRQ O¶HFFH]LRQH GHOO¶DUHD GHOOD VDQLWj
SXEEOLFD
7DEHOOD'LVWULEX]LRQHSHUFHQWXDOHGLULJHQWLPHGLFLRVSHGDOLHULSHUGLVFLSOLQHHSHUJHQHUHDO
',6&,3/,1($5($0(',&$('(//(63(&,$/,7$
0(',&+(
)HPPLQH
0DVFKL
&$5',2/2*,$
'(50$72/2*,$
(0$72/2*,$
*(5,$75,$
0$/$77,($33$5$725(63,5$725,2
0$/$77,(,1)(77,9(
0(',&,1$(&+,585*,$',$&&(77$=,21(('
85*(1=$
0(',&,1$),6,&$(5,$%,/,7$7,9$
0(',&,1$,17(51$
1()52/2*,$
1(21$72/2*,$
1(852/2*,$
21&2/2*,$
3(',$75,$
5$',27(5$3,$
*$6752(17(52/2*,$
*(1(7,&$0(',&$
1(85236,&+,$75,$,1)$17,/(
5(80$72/2*,$
68%727$/,
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
)HPPLQH )HPPLQH 0DVFKL 0DVFKL
',6&,3/,1($5($',&+,585*,$('(//(63(&,$/,7$
&+,585*,&+(
)HPPLQH
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
&$5',2&+,585*,$
0DVFKL
&+,585*,$*(1(5$/(
&+,585*,$0$;,//2)$&&,$/(
&+,585*,$3(',$75,&$
*,1(&2/2*,$(267(75,&,$
1(852&+,585*,$
2)7$/02/2*,$
&+,585*,$3/$67,&$(5,&2675877,9$
25723(',$(75$80$72/2*,$
2725,12/$5,1*2,$75,$
852/2*,$
68%727$/,
',6&,3/,1($5($',2'2172,$75,$
)HPPLQH
0DVFKL
2'2172,$75,$
68%727$/,
',6&,3/,1($5($'(//$0(',&,1$',$*1267,&$('(,
6(59,=,
)HPPLQH
0DVFKL
$1$720,$(',673$72/2*,&$
$1(67(6,$(5,$1,0$=,21(
0(',&,1$75$6)86,21$/(
0,&52%,2/2*,$(9,52/2*,$
1(8525$',2/2*,$
3$72/2*,$&/,1,&$/$%$1$/,6,
5$',2',$*1267,&$
68%727$/,
0(',&,1$/(*$/(
0(',&,1$18&/($5(
',6&,3/,1($5($',6$1,7$
38%%/,&$
)HPPLQH
0DVFKL
',5(=,21(0(',&$',35(6,',2263('$/,(52
68%727$/,
7RWDOH
3RVVLDPR FHUFDUH GL LSRWL]]DUH OR VYLOXSSR GHOOD SURIHVVLRQH PHGLFD DQDOL]]DQGR OD GLVWULEX]LRQH SHU
JHQHUHGHLPHGLFLLQIRUPD]LRQHVSHFLDOLVWLFD
7UD TXHVWL VL HYLGHQ]LD FRPH LO UDSSRUWR WUD PDVFKL H IHPPLQH VLD FDPELDWR 6L ULOHYD LQIDWWL XQD
SUHYDOHQ]D IHPPLQLOH QHOOH GLVFLSOLQH GL DUHD PHGLFD H XQD FHUWD SDULWjLQ DUHD FKLUXUJLFD WUDLQDWDGDOOD
JLQHFRORJLDHRVWHWULFLDHGDOO¶RWRULQRODULQJRLDWULDFRQO¶HFFH]LRQHGHOODFDUGLRFKLUXUJLD
*UDILFR0HGLFLLQIRUPD]LRQHVSHFLDOLVWLFDLVFULWWLDOOH6FXROHGL6SHFLDOL]]D]LRQHSHUJHQHUH
DQQR
226
Femmine
Masc hi
436
7DEHOOD'LVWULEX]LRQHSHUJHQHUHHSHUVFXRODGLVSHFLDOL]]D]LRQHGHOO¶8QLYHUVLWjGHJOLVWXGL
GL3DUPDDQQR
6FXRODGLVSHFLDOL]]D]LRQH
)HPPLQH
)HPPLQH
0DVFKL
0DVFKL
$OOHUJRORJLDHGLPPXQRORJLDFOLQLFD
&DUGLRORJLD
'HUPDWRORJLDHYHQHUHRORJLD
(PDWRORJLD
(QGRFULQRORJLDHPDODWWLHGHOULFDPELR
*HULDWULD
0DODWWLHGHOO
DSSDUDWRUHVSLUDWRULR
0DODWWLHGHOO
DSSDUDWRFDUGLRYDVFRODUH
*DVWURHQWHURORJLD
0HGLFLQDG
HPHUJHQ]DXUJHQ]D
0HGLFLQDILVLFDHULDELOLWD]LRQH
0HGLFLQDLQWHUQD
1HIURORJLD
1HXURORJLD
1HXURSVLFKLDWULDLQIDQWLOH
2QFRORJLD
3HGLDWULD
3VLFKLDWULD
5DGLRWHUDSLD
0DODWWLHLQIHWWLYH
6FLHQ]DGHOO
DOLPHQWD]LRQH
7RWDOL
$5($',&+,585*,$('(//(63(&,$/,7¬&+,585*,&+(
6FXRODGLVSHFLDOL]]D]LRQH
)HPPLQH
&DUGLRFKLUXUJLD
)HPPLQH
0DVFKL
0DVFKL
&KLUXUJLDPD[LOORIDFFLDOH
&KLUXUJLDSODVWLFDHULFRVWUXWWLYD
&KLUXUJLDWRUDFLFD
&KLUXUJLDYDVFRODUH
2IWDOPRORJLD
2UWRSHGLDHWUDXPDWRORJLD
2WRULQRODULQJRLDWULD
8URORJLD
&KLUXUJLDJHQHUDOH
*LQHFRORJLDHRVWHWULFLD
7RWDOL
$5($'(//$0(',&,1$',$*1267,&$('(,6(59,=,
6FXRODGLVSHFLDOL]]D]LRQH
$QDWRPLDSDWRORJLFD
$QHVWHVLDHULDQLPD]LRQH
$QHVWHVLDULDQLPD]LRQHWHUDSLD
LQWHQVLYD
%LRFKLPLFDFOLQLFD
)HPPLQH
)HPPLQH
0DVFKL
0DVFKL
5DGLRGLDJQRVWLFD
7RWDOL
0HGLFLQDOHJDOH
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
$5($0(',&$('(//(63(&,$/,7¬0(',&+(
$UHDGLVDQLWjSXEEOLFD
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
6FXRODGLVSHFLDOL]]D]LRQH
)HPPLQH
)HPPLQH
0DVFKL
0DVFKL
,JLHQHHPHGLFLQDSUHYHQWLYD
0HGLFLQDGHOODYRUR
7RWDOL
3HUFRQFOXGHUHO¶DQDOLVLGHOODSRSROD]LRQHD]LHQGDOHVLYXROHRVVHUYDUHODQD]LRQDOLWjGHJOLRSHUDWRUL
'DOODVRWWRVWDQWHWDEHOODHPHUJHFKHO¶$]LHQGDDQQRYHUDWUDLSURSULGLSHQGHQWLDQFKHSHUVRQDOHVWUDQLHUR
SURYHQLHQWHLQSUHYDOHQ]DGDSDHVLGHOO¶8QLRQH(XURSHDPDDQFKHGDSDHVLH[WUDFRPXQLWDUL
6LWUDWWDSHUODTXDVLWRWDOLWjGLODYRUDWRULGHGLFDWLDOO¶DVVLVWHQ]DLQIHUPLHULRSHUDWRULVRFLRVDQLWDUL
7DEHOOD3HUVRQDOHVWUDQLHURDO±GLVWULEX]LRQHQD]LRQDOLWjH[WUDLWDOLDQD$UHD
FRPSDUWR
1D]LRQDOLWj
$5*(17,1$
)HPPLQH
0DVFKL
32/$&&$
63$*12/$
*5(&$
0$52&&+,1$
3$5$*8$,$1$
580(1$
6(5%$
8&5$,1$
/,78$1$
7RWDOL
0RELOLWjGHOSHUVRQDOH
/DGLQDPLFDGHJOLLQJUHVVLHGHOOHXVFLWHGHOSHUVRQDOHQHJOLDQQLqULDVVXQWDQHOODWDEHOOD
LQ DGHUHQ]D DL FULWHUL SUHYLVWL SHU LO FRQWR DQQXDOH H WHQHQGR FRQWR GHO VROR SHUVRQDOH D WHPSR
LQGHWHUPLQDWR
/D JHVWLRQH GHOOH ULVRUVH XPDQH SHU O¶DQQR VL q FROORFDWD QHOO¶DPELWR GL XQ FRQWHVWR FRPSOHVVLYR
FDUDWWHUL]]DWR GD LQWHUYHQWL QRUPDWLYL RULHQWDWL VLD DOOD QHFHVVLWj GL UD]LRQDOL]]DUH OD VSHVD SXEEOLFD VLD
DOO¶HVLJHQ]D GL JDUDQWLUH XQD PDJJLRUH WUDVSDUHQ]D H XQ PDJJLRU ULJRUH QHOOD JRYHUQDQFH GHO VLVWHPD
VDQLWDULR,QSDUWLFRODUPRGRODFRSHUWXUDGHLIDEELVRJQLGLSHUVRQDOHGHOOHD]LHQGHGHO6HUYL]LR6DQLWDULR
GHOOD 5HJLRQH (PLOLD5RPDJQD q VWDWD FRQGL]LRQDWD DOO¶DSSURYD]LRQH GHO 3LDQR $QQXDOH GL DVVXQ]LRQH
VHFRQGR L SULQFLSL FRQWHQXWL QHOOD '*5 Q ³/LQHH GL SURJUDPPD]LRQH H ILQDQ]LDPHQWR GHOOH
$]LHQGH 6DQLWDULH SHU O¶DQQR ´ &RPH LQGLFDWR LQ WDOH GHOLEHUD Q O¶RELHWWLYR GL ULGX]LRQH
GHOOD VSHVD SHU LO SHUVRQDOH q LQFHQWUDWR VXOOD OLPLWD]LRQH GHO WXUQ RYHU H GHOOH DVVXQ]LRQL VX SRVWR
YDFDQWHQHOULVSHWWRGLXQDFRSHUWXUDPHGLDUHJLRQDOHGHOGHLSRVWLUHVLVLYDFDQWLRFKHVLVDUHEEHUR
UHVLGLVSRQLELOLQHOFRUVRGHOO¶DQQRDOQHWWRGHOVDOGRDVVXQWLFHVVDWLGHOO¶DQQRSUHFHGHQWH
/D SROLWLFD GL JHVWLRQH GHJOL RUJDQLFL GHOO¶$]LHQGD q TXLQGL VWDWD SUHYDOHQWHPHQWH RULHQWDWD YHUVR LO
SHUVRQDOH GHGLFDWR DOO¶DVVLVWHQ]D SL SUHFLVDPHQWH YHUVR LO SHUVRQDOH GLULJHQWH PHGLFR H VDQLWDULR H LO
SHUVRQDOH VDQLWDULR GHOO¶DUHD FRPSDUWR DWWXDQGR QHO FRQWHPSR XQD ULGX]LRQH GHO SHUVRQDOH GHO UXROR
WHFQLFRHGDPPLQLVWUDWLYRGHOO¶DUHD&RPSDUWR
3HUTXDQWRULJXDUGDO¶DUHDPHGLFDOHHQWUDWHVRQRGDULFRQGXUUHDOOHDVVXQ]LRQLHIIHWWXDWHLQUHOD]LRQHD
TXDQWRVRWWRLOOXVWUDWR
&ULWLFLWj QHOO¶DUHD RVWHWULFDJLQHFRORJLFD VWDQWH OD QHFHVVLWj GL JDUDQWLUH OH SUHVWD]LRQL HURJDWH D
IURQWH GHOOH XOWHULRUL FHVVD]LRQL GL SHUVRQDOH XQLYHUVLWDULR QRQFKp GL OXQJKH DVVHQ]H DYYHQXWH
QHOO¶DQQR ROWUH DO FRQVROLGDPHQWR GHO SHUFRUVR GHOOD 3DUWR DQDOJHVLD FKH KD GDWR SRVLWLYL
ULVFRQWULGDSDUWHGHOO¶XWHQ]D
/D UHDOL]]D]LRQH GHO SURJHWWR GL LQWHJUD]LRQH FRQ O¶$]LHQGD 8QLWj 6DQLWDULD /RFDOH GL 3DUPD
³&RQWLQXLWjDVVLVWHQ]LDOHK´FKHKDSUHYLVWRWUDO¶DOWURLOPDQWHQLPHQWRGHJOLLQFDULFKLDWHPSR
GHWHUPLQDWRGLGXH'LULJHQWL0HGLFL'LVFLSOLQD0HGLFLQDH&KLUXUJLDG¶$FFHWWD]LRQHHG¶8UJHQ]DGD
GHVWLQDUVL DOOH IXQ]LRQL GL 2VVHUYD]LRQH %UHYH ,QWHQVLYD LO FXL VYLOXSSR ULHQWUD QHO SHUFRUVR
SURJHWWXDOHILQDOL]]DWRDGRWWLPL]]DUHODWHPSLVWLFDGLULVSRVWDDJOLDFFHVVLGHO3URQWR6RFFRUVRHG
LOFXLFRVWRqVWDWRVRORLQSDUWHULPERUVDWRGDOODVWHVVD$]LHQGD8VO
1HOFRUVRGHOO¶DQQRDQFKHLQUHOD]LRQHDOO¶DXWRUL]]D]LRQHLQGHURJDGDSDUWHGHOOD5HJLRQHVL
q SURYYHGXWR DOO¶DVVXQ]LRQH GL PHGLFL SHGLDWUL SHUO¶DYYLR GHO SURJHWWR GHO 1XRYR 2VSHGDOH GHO
%DPELQR
3HU TXDQWR ULJXDUGD LO SHUVRQDOH GLULJHQWH VDQLWDULR QRQ PHGLFR VL q GRYXWR IDU IURQWH PHGLDQWH
O¶LQVHULPHQWR GL XOWHULRUH SHUVRQDOH D WHPSR GHWHUPLQDWR DOOH DVVHQ]H GL SHUVRQDOH XQLYHUVLWDULR
QHOO¶DPELWR GHO ODERUDWRULR GL 0LFURELRORJLD FKH DVVXPH FDUDWWHUH VWUDWHJLFR QRQ VROR DOO¶LQWHUQR
GHOO¶$]LHQGDPDDOLYHOORSURYLQFLDOHSHUODQDWXUDGHOOHSUHVWD]LRQLHURJDWH
&RQ ULIHULPHQWR DO SHUVRQDOH LQIHUPLHULVWLFR H GHOOH SURIHVVLRQL VDQLWDULH GHGLFDWH DOO¶DVVLVWHQ]D ROWUH DO
SHUVRQDOHSURJUDPPDWRHGDXWRUL]]DWRLQGHURJDSHUO¶DYYLRGHO1XRYR2VSHGDOHGHO%DPELQRVLqUHVR
LQGLVSHQVDELOHSURFHGHUHDGXQDGHJXDPHQWRGHOO¶RUJDQLFRDOILQHGLUHQGHUHXQDDSSURSULDWDHGHIILFLHQWH
HURJD]LRQH DJOL XWHQWL GHOOH SUHVWD]LRQL DVVLVWHQ]LDOL 9LFHYHUVD LO FRQWHQLPHQWR GHOOD VSHVD UHJLVWUDWR
QHOO¶DPELWR GHO SHUVRQDOH WHFQLFR GHOO¶DUHD FRPSDUWR ULVSHWWR DOOH LQL]LDOL SUHYLVLRQL q VWDWR SRVVLELOH
JUD]LH DL SURJHWWL GL ULRUJDQL]]D]LRQH LQWHUQD FKHKDQQR LQWHUHVVDWRLO VXGGHWWR SHUVRQDOH DWWUDYHUVRXQD
UD]LRQDOL]]D]LRQHGHOODWXUQLVWLFD
7XWWDYLD FRPSOHVVLYDPHQWH ULVSHWWR DOO¶DQQR LQ HQWUDPEH OH DUHH VL q ULOHYDWD XQD ULGX]LRQH GHO
QXPHURGHJOLRSHUDWRULVLDDWHPSRGHWHUPLQDWRFKHLQGHWHUPLQDWR
7DEHOOD0RELOLWjGHOSHUVRQDOHDWHPSRLQGHWHUPLQDWRDQQL
0RELOLWjLQXVFLWD
/LPLWHHWj
'LPLVVLRQL
3DVVDJJLRDOWUDDPPQH
3DVVDOWUDDPP/HJJH
$OWUHFDXVH
0RELOLWjLQHQWUDWD
3URYHQLHQWLDOWUHDPPQL
3URYHQLHQWLDOWUHDPPQL
OHJJH
3URFHGXUHFRQFRUVXDOL
$OWUHFDXVH
'LIIHUHQ]D
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
7DEHOOD&HVVDWLSHUFDWHJRULH
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
&DWHJRULH
7DEHOOD$VVXQWLSHUFDWHJRULH
3DVVDWL
'LPLVVLR /LPLWH $OWUH
DOWUD
QL
HWj FDXVH
DPPQH
$QQR
3URYHQLH 3URFHGXUH
$OWUH
QWLDOWUH FRQFRUVXD
FDXVH
DPPQL
OL
$QQR
'LULJHQWLPHGLFL
$OWULGLULJHQWLVDQLWDUL
$37
'LULJHQWLPHGLFL
$OWULGLULJHQWLVDQLWDUL
$37
3HUVRQDOHLQIHUPLHULVWLFR
3HUVRQDOHGHOOD
ULDELOLWD]LRQH
3HUVRQDOHWHFQLFRGHOOD
SUHYHQ]LRQH
3HUVRQDOHWHFQLFR
VDQLWDULR
$OWURSHUVRQDOHUXROR
WHFQLFR
3HUVRQDOH27$266
DXVLOLDUL
3HUVRQDOHLQIHUPLHULVWLFR
3HUVRQDOHGHOOD
ULDELOLWD]LRQH
3HUVRQDOHWHFQLFRGHOOD
SUHYHQ]LRQH
3HUVRQDOHWHFQLFR
VDQLWDULR
$OWURSHUVRQDOHUXROR
WHFQLFR
3HUVRQDOH27$266
DXVLOLDUL
3HUVRQDOHDPPLQLVWUDWLYR
3HUVRQDOHDPPLQLVWUDWLYR
&DWHJRULH
'LULJHQWLPHGLFL
$OWULGLULJHQWLVDQLWDUL
$37
$QQR
$QQR
'LULJHQWLPHGLFL
$OWULGLULJHQWLVDQLWDUL
$37
3HUVRQDOHLQIHUPLHULVWLFR
3HUVRQDOHGHOOD
ULDELOLWD]LRQH
3HUVRQDOHWHFQLFRGHOOD
SUHYHQ]LRQH
3HUVRQDOHWHFQLFR
VDQLWDULR
$OWURSHUVRQDOHUXROR
WHFQLFR
3HUVRQDOH27$266
DXVLOLDUL
3HUVRQDOHDPPLQLVWUDWLYR
3HUVRQDOHLQIHUPLHULVWLFR
3HUVRQDOHGHOOD
ULDELOLWD]LRQH
3HUVRQDOHWHFQLFRGHOOD
SUHYHQ]LRQH
3HUVRQDOHWHFQLFR
VDQLWDULR
$OWURSHUVRQDOHUXROR
WHFQLFR
3HUVRQDOH27$266
DXVLOLDUL
3HUVRQDOHDPPLQLVWUDWLYR
'LULJHQWLPHGLFL
$OWULGLULJHQWLVDQLWDUL
$37
$QQR
$QQR
'LULJHQWLPHGLFL
$OWULGLULJHQWLVDQLWDUL
$37
3HUVRQDOHLQIHUPLHULVWLFR
3HUVRQDOHGHOOD
ULDELOLWD]LRQH
3HUVRQDOHWHFQLFRGHOOD
SUHYHQ]LRQH
3HUVRQDOHWHFQLFR
VDQLWDULR
$OWURSHUVRQDOHUXROR
WHFQLFR
3HUVRQDOH27$266
DXVLOLDUL
3HUVRQDOHDPPLQLVWUDWLYR
3HUVRQDOHLQIHUPLHULVWLFR
3HUVRQDOHGHOOD
ULDELOLWD]LRQH
3HUVRQDOHWHFQLFRGHOOD
SUHYHQ]LRQH
3HUVRQDOHWHFQLFR
VDQLWDULR
$OWURSHUVRQDOHUXROR
WHFQLFR
3HUVRQDOH27$266
DXVLOLDUL
3HUVRQDOHDPPLQLVWUDWLYR
3DULRSSRUWXQLWj
1HOFRUVRGHOO¶$]LHQGDFRQLO&RPLWDWR8QLFRGL*DUDQ]LDKDSURVHJXLWRO¶DWWLYLWjGLIRUPD]LRQHGHJOL
RSHUDWRUL VDQLWDUL VXOOD SULPD DVVLVWHQ]D DOOH YLWWLPH GL YLROHQ]D GL JHQHUH H VWDONLQJ VXOOD EDVH GHO
3URJHWWR SLORWD GL IRUPD]LRQH GHJOL RSHUDWRUL VDQLWDUL GDO WLWROR ³$FFRJOLHQ]D RVSHGDOLHUD DOOH GRQQH
YLWWLPHGLYLROHQ]DGLJHQHUHHGLVWDONLQJ
$OODILQHGHOODIDVHIRUPDWLYDqVWDWDYDOXWDWDODFDSDFLWjGHJOLRSHUDWRULGLUHOD]LRQDUVLFRQODYLWWLPDGL
LGHQWLILFDUH OH VLWXD]LRQL D ULVFKLR QRQFKp OH FRPSHWHQ]H DFTXLVLWH QHOOD FDSDFLWj GL DVFROWR H GL JHVWLRQH
GHOFROORTXLRGLVRVWHJQR
3HUHVSORUDUHOHFRQRVFHQ]HGHOIHQRPHQRHLOOLYHOORGLVHQVLELOLWjGHJOLRSHUDWRULVXOWHPDGHOODYLROHQ]D
qVWDWRXWLOL]]DWRORVWUXPHQWRGHO)RFXV*URXSFRQGRWWRLQGXHGLVWLQWLPRPHQWL
• )DVHSUHLQWHUYHQWRIRUPDWLYR
• )DVHSRVWLQWHUYHQWRIRUPDWLYR
1HO SUHLQWHUYHQWR VRQR HPHUVH LQFDSDFLWj D ULFRQRVFHUH L VRJJHWWL D ULVFKLR PDQFDWD FRQRVFHQ]D
GHOO¶HVLVWHQ]D GL XQD UHWH RUJDQL]]DWLYD GL VXSSRUWR DOOH YLWWLPH VHQVR GL LPSRWHQ]D QHOOD JHVWLRQH GHO
FROORTXLR UDEELD QHL FRQIURQWL GHOOD YLWWLPD FROSHYROH GL QRQ ULEHOODUVL DG XQD VLWXD]LRQH GL GLSHQGHQ]D
DIIHWWLYD
1HOSRVWLQWHUYHQWRVRQRHPHUVLLFDPELDPHQWLGHLSDUWHFLSDQWLLQWHUPLQLGLPDJJLRUHDWWHQ]LRQHDLVHJQL
SUHPRQLWRUL GHOOD YLROHQ]D FRQVDSHYROH]]D FKH LO ORUR LQWHUYHQWR QRQ q HVDXVWLYR PD q LO SXQWR GL
SDUWHQ]D SHU O¶DFFHVVR GHOOD YLWWLPD LQ XQD UHWH LQWHJUDWD GL VRVWHJQR DXPHQWR GHOOD VHOI HIILFDF\ QHOOD
FRQGX]LRQHGHOFROORTXLRHSUHVDLQFDULFRLOSDVVDJJLRGDOODUDEELDDOODFRQVDSHYROH]]DGHOODFRPSOHVVLWj
GHOODUHOD]LRQHDIIHWWLYD
(¶ VWDWD ULYLVWD OD SURFHGXUD GL $FFRJOLHQ]D RVSHGDOLHUD GHOOH GRQQH YLWWLPH GL YLROHQ]D H VRQR VWDWL
LQGLYLGXDWLGXHSURIHVVLRQLVWLGHOO¶DUHDGHO3URQWR6RFFRUVRHGHOOD*LQHFRORJLDFKHLQTXDOLWjGLHVSHUWLH
UHIHUHQWLVHJXLUDQQRO¶DSSOLFD]LRQHGHOODSURFHGXUDGHOODVXDGLIIXVLRQHHGHOODULOHYD]LRQHGHJOLLQGLFDWRUL
SUHYLVWL
$O WHUPLQH GHO SURJHWWR LQ GDWD RWWREUH qVWDWR UHDOL]]DWR XQ HYHQWR DSHUWR DO SXEEOLFR GRYHq
VWDWR LOOXVWUDWR LO SHUFRUVR IRUPDWLYR H L ULVXOWDWL RWWHQXWL OD SURFHGXUD RVSHGDOLHUD H OH DWWLYLWj GL
PRQLWRUDJJLR
/DPHGLFLQDGHOOHGLIIHUHQ]HXQSHUFRUVRIUDLJHQHULHOHFXOWXUH
/¶PDU]RLQFROODERUD]LRQHFRQLO&8*GHOO¶$86GL3DUPDqVWDWRUHDOL]]DWRXQFRQJUHVVRGDOWLWROR
³/DPHGLFLQDGHOOHGLIIHUHQ]HXQSHUFRUVRIUDLJHQHULHOHFXOWXUH´8QHYHQWRDSHUWRDRSHUDWRULVDQLWDUL
HDOODFLWWDGLQDQ]DSHUVHQVLELOL]]DUHHSURPXRYHUHXQSHUFRUVRFXOWXUDOHQHLSHUFRUVLGLFXUD
3HU LOWULHQQLR LO &RPLWDWR 8QLFR GL *DUDQ]LD KD SUHGLVSRVWR LO3LDQR GHOOHD]LRQLSRVLWLYH
DSSURYDWRLOJLXJQRFRQGHOLEHUDGHO'LUHWWRUH*HQHUDOHQ,WHPLLQVHULWLQHOSLDQRVRQR
y
SURVHFX]LRQHQHOO¶D]LRQHGLFRQWUDVWRDOOHPROHVWLHVHVVXDOLQHLOXRJKLGLODYRURQHOULVSHWWRGHO
FRGLFHGLFRQGRWWDDGRWWDWRGDOO¶$]LHQGD
y
SUHYHQ]LRQH H FRQWUDVWR GHL IHQRPHQL GL PREELQJ H WXWHOD GHOOD VDOXWH SVLFR VRFLDOH GHOOD
SHUVRQDVXOOXRJRGLODYRUR
y
SUHYHQ]LRQHGHJOLDWWLGLYLROHQ]DDGDQQRGHJOLRSHUDWRULVDQLWDUL
y
IDYRULUHODFRQFLOLD]LRQHWUDYLWDODYRUDWLYDHYLWDH[WUDODYRUDWLYD
y YDORUL]]D]LRQHGHOOHFDUDWWHULVWLFKHGLJHQHUH
y SURPXRYHUHODFXOWXUDGLJHQHUH
3URWRFROORGLLQWHVDSHUODSUHYHQ]LRQHHLOFRQWUDVWRGHOODYLROHQ]DGLJHQHUH
,OQRYHPEUHqVWDWRDYYLDWDGDOOD3UHIHWWXUDGL3DUPDODUHYLVLRQHGHOSURWRFROORGLLQWHVDSHUOD
SUHYHQ]LRQHHLOFRQWUDVWRGHOODYLROHQ]DGLJHQHUH
/¶$]LHQGDLQVLHPHDOO¶$]LHQGD$86/SURYYHGHUjDUHYLVLRQDUHO¶DUW±FRPSLWLGHOOH$]LHQGHVDQLWDULH
WHQHQGR FRQWR GHOOH OLQHH GL LQGLUL]]R SHU O¶DFFRJOLHQ]D GHOOH GRQQH YLWWLPH GL YLROHQ]D FKH OD 5HJLRQH
(PLOLD5RPDJQDKDGHOLEHUDWRLOQRYHPEUHGHOLEHUDQ
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
$FFRJOLHQ]DRVSHGDOLHUDDOOHGRQQHYLWWLPHGLYLROHQ]DGLJHQHUHHGLVWDONLQJ
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
3DUWHFLSD]LRQHGHLSURIHVVLRQLVWLDOO¶LQGLYLGXD]LRQH
GHOOHVWUDWHJLHD]LHQGDOLHDOODJHVWLRQHRSHUDWLYD
2UJDQL]]D]LRQHHIXQ]LRQDPHQWRD]LHQGDOHLOUXRORGHO&ROOHJLRGL
'LUH]LRQH
,O&ROOHJLRGL'LUH]LRQHUDSSUHVHQWDXQPRPHQWRGHFLVLRQDOHIRQGDPHQWDOHSHUODGLUH]LRQHD]LHQGDOHVLD
QHOOD IDVH GL YHULILFD GHL ULVXOWDWL ULVSHWWR DOOD JHVWLRQH FRPSOHVVLYD D]LHQGDOH VLD QHOOD IDVH GL
SLDQLILFD]LRQHGHJOLRELHWWLYL
1HO FRUVR GHOO¶DQQR LO &ROOHJLR GL 'LUH]LRQH VL q ULXQLWR FRQ UHJRODULWj H FDGHQ]D PHGLDPHQWH
PHQVLOH
,O&ROOHJLRGL'LUH]LRQHFRVWLWXLVFHLOOXRJRGLFRQIURQWRHGLFRRUGLQDPHQWRGHOOHVWUDWHJLHFRPSOHVVLYHGHO
JRYHUQRFOLQLFRHKDLOFRPSLWRGLFROODERUDUHDOODHODERUD]LRQHGHLSURJUDPPLHGHLGRFXPHQWLD]LHQGDOLGL
ULIHULPHQWR OLQHH GL LQGLUL]]R DO EXGJHW SLDQR GL DWWLYLWj DQQXDOH SHU OD JHVWLRQH GHO ULVFKLR FOLQLFR SHU
O¶DFFUHGLWDPHQWRHFFHWHUD
$WDOHSURSRVLWRLO&ROOHJLRGL'LUH]LRQHKDHVSUHVVRSDUHUHIDYRUHYROHVXOGRFXPHQWR/LQHHGL,QGLUL]]RDO
EXGJHWHVXOSHUFRUVRGLQHJR]LD]LRQHGLEXGJHWSHUO¶DQQR
+D LQROWUH DIIURQWDWR LO WHPD GHJOL ,QGLFDWRUL FOLQLFL H GHJOL ,QGLFDWRUL GL RVSHGDOL]]D]LRQH LQVHULWL QHO
3URJUDPPD1D]LRQDOH(VLWLGHO0LQLVWHURGHOOD6DOXWH,QSDUWLFRODUHVRQRVWDWLSUHVHQWDWLHGLVFXVVLLGDWL
UHODWLYLDJOLLQGLFDWRULGHO31(GHOO¶$]LHQGD28GL3DUPDQHOFRQIURQWRFRQOHDOWUH$]LHQGH5HJLRQDOL
H1D]LRQDOL
/H PLVXUH GL 31( VRQR VWUXPHQWL GL YDOXWD]LRQH D VXSSRUWR GL SURJUDPPL GL DXGLWLQJ FOLQLFR HG
RUJDQL]]DWLYRILQDOL]]DWLDOPLJOLRUDPHQWRGHOO¶HIILFDFLDHGHOO¶HTXLWjGHO6HUYL]LR6DQLWDULR1D]LRQDOH
/D66'*RYHUQR&OLQLFRJHVWLRQHGHOULVFKLRHFRRUGLQDPHQWRTXDOLWjHDFFUHGLWDPHQWRKDSUHVHQWDWRDO
&ROOHJLRGL'LUH]LRQHLO3LDQR3URJUDPPD$FFUHGLWDPHQWRGHOO¶$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGL3DUPD
SHU JOL DQQL 6XGGHWWR 3LDQR SUHYHGH O¶HIIHWWXD]LRQH GL YLVLWH LVSHWWLYH LQWHUQH H GL YLVLWH SHU
O¶$FFUHGLWDPHQWR,VWLWX]LRQDOHVWDELOLWHFRQO¶$JHQ]LD6DQLWDULDH6RFLDOHGHOOD5HJLRQH(PLOLD5RPDJQD
6RQRVWDWLLQROWUHFRQGLYLVL
y
LO PDQXDOH RUJDQL]]DWLYR GHO 'LSDUWLPHQWR $VVLVWHQ]LDOH ,QWHJUDWR FKH GHVFULYH LO PRGHOOR
RUJDQL]]DWLYR GHO 'LSDUWLPHQWR DG $WWLYLWj ,QWHJUDWD GHOO¶$]LHQGD 2VSHGDOLHUR 8QLYHUVLWDULD GL
3DUPDVHFRQGRLO6LVWHPDGL*HVWLRQHSHUOD4XDOLWjGHOOD5HJLRQH(PLOLD5RPDJQD
y
LO3LDQR3URJUDPPD*HVWLRQHGHO5LVFKLR±6LVWHPDGLVHJQDOD]LRQHD]LHQGDOHSHUODVLFXUH]]DHOD
JHVWLRQHGHOULVFKLRFRQO¶RELHWWLYRGLSRUUHSDUWLFRODUHDWWHQ]LRQHDOODVLFXUH]]DHDOORVYLOXSSRGL
XQD FXOWXUD SURIHVVLRQDOH SRVLWLYD RULHQWDWD DOO¶DSSUHQGLPHQWR GHOO¶HUURUH DOOD SUHYHQ]LRQH H
DOO¶DGR]LRQHGLEXRQHSUDWLFKHWHFQLFRSURIHVVLRQDOLQHLYDULDPELWLSUHVWD]LRQDOL
y
LO 3URJUDPPD IRUPD]LRQH DFFUHGLWDPHQWR DO ILQH GL VXSSRUWDUH L 'LUHWWRUL GL 'LSDUWLPHQWR FKH
GRYHYDQRSUHVHQWDUHGRPDQGDGLDFFUHGLWDPHQWRQHOODSUHGLVSRVL]LRQHGHLGRFXPHQWL
,O UXROR DWWULEXLWR DO &G' GDOO¶$WWR D]LHQGDOH q IRUWHPHQWH SURSRVLWLYR QHL FRQIURQWL GHOOD 'LUH]LRQH
JHQHUDOHFRQSDUWLFRODUHULJXDUGRDJOLDVSHWWLGLLQWHJUD]LRQHWUDO¶DWWLYLWjGLFXUDHDVVLVWHQ]DHO¶DWWLYLWj
GLGDWWLFD GL ULFHUFD H GL LQQRYD]LRQH QRQFKp SHU TXDQWR FRQFHUQH WHPL WUDVYHUVDOL FRPH LO SLDQR
IRUPDWLYRD]LHQGDOHDGRWWDWRGDO'LUHWWRUH*HQHUDOH
,Q WHPD GL IRUPD]LRQH q VWDWR YDOLGDWR GDO &ROOHJLR GL 'LUH]LRQH LO 3LDQR )RUPDWLYR $]LHQGDOH GRFXPHQWRSURJUDPPDWLFRFKHLOOXVWUDOHDWWLYLWjGLIRUPD]LRQHSUHYLVWHGDOO¶$]LHQGDFKHFRPSUHQGRQRJOL
RELHWWLYLDOODEDVHGHOOHVFHOWHIRUPDWLYHSURSRVWHO¶LPSHJQRHFRQRPLFRSUHYLVWRLGHVWLQDWDULGHOOHD]LRQL
IRUPDWLYHLVLVWHPLGLYHULILFDHGLYDOXWD]LRQHGLTXDOLWjHGLHIILFDFLDGHJOLLQWHUYHQWLSURJUDPPDWL
6RQR VWDWH VRWWRSRVWH DO SDUHUH GHO &ROOHJLR OH /LQHH GL ,QGLUL]]R DOOD )RUPD]LRQH QRQFKp
O¶DQDOLVLGHOIDEELVRJQRIRUPDWLYRHGRVVLHUIRUPDWLYR
(¶ VWDWR SUHVHQWDWR DO &G' LO 3URJHWWR ³)RUPD]LRQH LQWUDRVSHGDOLHUD QHOO¶(PHUJHQF\ &DUGLRYDVFXODU &DUH
(&&&RUVL%/6'H$&/6SHULOSHUVRQDOHGHOO¶$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGL3DUPD´
6LWUDWWDGHOODUHDOL]]D]LRQHGLXQSHUFRUVRIRUPDWLYRQHOFDPSRGHOO¶HPHUJHQ]DXUJHQ]DFDUGLRYDVFRODUH
ULYROWRDOSHUVRQDOHVDQLWDULRGHOO¶$28GL3DUPD7DOHSURJHWWRKDIRUQLWRXQDIRUPD]LRQHGLTXDOLWjQHOOD
JHVWLRQHGHOO¶HPHUJHQ]DXUJHQ]D
,OSURJHWWRKDSUHYLVWR
y
y
y
)RUPD]LRQHLQWHDPIRUPD]LRQHGHOO¶LQWHUDqTXLSHGLWXWWHOH8QLWj2SHUDWLYHPHGLFLLQIHUPLHUL
266ILVLRWHUDSLVWLWHFQLFL
/RFDOL]]D]LRQHGHLFRUVLQHOOHVLQJROHUHDOWjODYRUDWLYH
7HFQLFKHGLVLPXOD]LRQH
8WLOL]]RLSULQFLSLGHOFULVLVUHVRXUFHPDQDJHPHQW&50
3HU O¶DQQR q VWDWR UHDOL]]DWR XQ FRUVR GL IRUPD]LRQH D GLVWDQ]D %/6' )$' FKH SHUPHWWHUj QHO
FRQFRVWLFRQWHQXWLODIRUPD]LRQHFRQWLQXDGLHOHYDWDTXDOLWjGLWXWWRLOSHUVRQDOHVDQLWDULR
/¶$]LHQGD 2VSHGDOLHUR8QLYHUVLWDULD GL 3DUPD KD LQQRYDWR H DWWLYDWR VWUXPHQWL H SHUFRUVL SHU UHQGHUH
VHPSUHSLHIIHWWLYDODSDUWHFLSD]LRQHGHLSURIHVVLRQLVWLHGHJOLRSHUDWRULFKH TXRWLGLDQDPHQWHSUHVWDQR
OD ORUR IRQGDPHQWDOH RSHUD SHU JDUDQWLUH OD PLJOLRU DVVLVWHQ]D H FXUD DL FLWWDGLQL FKH VL ULYROJRQR DOOH
VWUXWWXUHGHOO¶RVSHGDOH
,QWDOHTXDGURLO&ROOHJLRGL'LUH]LRQHUDSSUHVHQWDXQPRPHQWRGHFLVLRQDOHIRQGDPHQWDOHSHUODGLUH]LRQH
D]LHQGDOH VLD QHOOD IDVH GL SLDQLILFD]LRQH GHJOLRELHWWLYL VLD QHOOD IDVH GL YHULILFD GHL ULVXOWDWL ULVSHWWR DOOD
JHVWLRQHFRPSOHVVLYDD]LHQGDOH
1HOOD GHILQL]LRQH GHO PRGHOOR GL SDUWHFLSD]LRQH YLHQH ULFRQRVFLXWR XQ UXROR GL SULPR SLDQR DO &ROOHJLR GL
'LUH]LRQH &G' RUJDQR FROOHJLDOH GHOO¶$]LHQGD FRQ FRPSLWL GL SURSRVWD LQ PDWHULD GL RUJDQL]]D]LRQH H
VYLOXSSRGHLVHUYL]LHGHOOHDWWLYLWjGLULFHUFDHLQQRYD]LRQHHSHUODYDORUL]]D]LRQHGHOOHULVRUVHXPDQHH
SURIHVVLRQDOLGHJOLRSHUDWRUL
$WDOHSURSRVLWRLO&G'qVWDWRFRLQYROWRLQPHULWRDOODUHYLVLRQHRUJDQL]]DWLYDGHOO¶DUHDFRPSDUWR
/H UHFHQWL QRUPDWLYH LQ PDWHULD GL UD]LRQDOL]]D]LRQH GHOOD VSHVD KDQQR LPSRVWR XQD UHYLVLRQH
RUJDQL]]DWLYDGHLVHUYL]LDVVLVWHQ]LDOLHGHOOHULVRUVHXPDQH
(
VWDWRQHFHVVDULRLOFRLQYROJLPHQWRGLWXWWLLSURIHVVLRQLVWLLQXQRVIRU]RFRPXQHDOILQHGLFRQVHQWLUHLO
PDQWHQLPHQWR GL HOHYDWL OLYHOOL DVVLVWHQ]LDOL DQGDQGR D ULYHGHUH OH SUHVHQ]H GHO SHUVRQDOH H
O
RUJDQL]]D]LRQH GHL VHUYL]L QHO ULVSHWWR GHOOH VLQJROH SURIHVVLRQDOLWj H QHOOD ULFHUFD GHOOD PLJOLRUH
DGDWWDELOLWjDOFRQWHVWRVSHFLILFR
(
VWDWD QHFHVVDULD OD SLHQD FROODERUD]LRQH GL WXWWL L &RRUGLQDWRUL QRQFKp O
LQWHJUD]LRQH WUD FRPSRQHQWH
PHGLFDHGHOFRPSDUWR
/
RELHWWLYR q VWDWR TXHOOR GL ULGHILQLUH OH QHFHVVLWj DVVLVWHQ]LDOL LQ XQ
RWWLFD GL EXRQ XWLOL]]R H
UD]LRQDOL]]D]LRQH GHOOH ULVRUVH GLVSRQLELOL SUHFHGXWD GD XQ
DWWHQWD DQDOLVL GHJOL RUJDQLFL GHO SHUVRQDOH
DVVHJQDWRDGRJQLVLQJRODXQLWjRSHUDWLYDVHUYL]LR
1HO FRUVR GHO LO &G' KD SDUWHFLSDWR DOOD SURJHWWD]LRQH GL XQD QXRYD RUJDQL]]D]LRQH RVSHGDOLHUD
FKH ULVSRQGH D QXRYL H LPSRUWDQWL IDEELVRJQL RUJDQL]]DWLYL LQ FRHUHQ]D FRQ L PXWDPHQWL H OH GLQDPLFKH
DPELHQWDOLULFKLHGHQGRXQDOLQHDDVVLVWHQ]LDOHFKHQRQVLVWUXWWXULSLLQIXQ]LRQHGHLUHSDUWLVSHFLDOLVWLFL
EHQVuLQUHOD]LRQHDOOHFDUDWWHULVWLFKHGHLQXRYLUHSDUWLQRQSLFRRUGLQDWRULGLVSHFLDOLWjPDFRRUGLQDWRUL
GLUHSDUWLPRGXODWLSHULQWHQVLWjGLFXUDRFKHDJJUHJDQRSLVSHFLDOLWj
,QROWUHDOILQHGLPLJOLRUDUHOHFRQGL]LRQLRUJDQL]]DWLYHDOO¶LQWHUQRGLFLDVFXQ'LSDUWLPHQWRHGLIDFLOLWDUHOH
DWWLYLWj DVVLVWHQ]LDOL GHOOH VLQJROH XQLWj RSHUDWLYH DIIHUHQWL DO 'LSDUWLPHQWR VWHVVR LQ DWWHVD GHOOD
IRUPDOL]]D]LRQH GHO QXRYR DVVHWWR GLSDUWLPHQWDOH H DO ILQH GL DGHJXDUVL LQ PRGR FRHUHQWH FRQ OD IXWXUD
ULRUJDQL]]D]LRQH LO &ROOHJLR GL 'LUH]LRQH KD HVSUHVVR SDUHUH IDYRUHYROH LQ PHULWR DOOD SURURJD GHL
5HVSRQVDELOL$VVLVWHQ]LDOLGL'LSDUWLPHQWR
,QROWUH DO ILQH GL JDUDQWLUH OD SLHQD RSHUDWLYLWj GHO %RDUG SHU OD 5LFHUFD H O¶,QQRYD]LRQH H JDUDQWLUH OD
FRQWLQXLWjGHLFRPSLWLDGHVVRDWWULEXLWRLO&ROOHJLRGL'LUH]LRQHKDHVSUHVVRSDUHUHIDYRUHYROHLQPHULWR
DOODSURURJDGHO%RDUGVWHVVR
3HU TXDQWR ULJXDUGD O¶DWWLYLWj GL ULFHUFD H LQQRYD]LRQHLO &ROOHJLR GL 'LUH]LRQH UDSSUHVHQWDOD VHGHSHUOD
GLVFXVVLRQHHODYDOXWD]LRQHSUHOLPLQDUHGHOODULOHYDQ]DHGHOO
LPSDWWRQHOODSUDWLFDFOLQLFDGHOOHSURSRVWH
SURJHWWXDOL
$ WDOH VFRSR GXUDQWH O¶DQQR VRQR VWDWL GLVFXVVL H YDOXWDWL L SURJHWWL GL ULFHUFDILQDQ]LDWL GDOOD 5(5
QHOO
DPELWRGHO3URJUDPPD5LFHUFD5HJLRQH8QLYHUVLWjLQHUHQWL
$UHD³5LFHUFD,QQRYDWLYD´±*LRYDQLULFHUFDWRUL
, GHVWLQDWDUL GHL ILQDQ]LDPHQWL SUHYLVWL GDO %DQGR VRQR L JLRYDQL ULFHUFDWRUL DIIHUHQWL DOOH D]LHQGH
RVSHGDOLHUR±XQLYHUVLWDULHDOO¶,5&&6,VWLWXWR2UWRSHGLFR5L]]ROLGL%RORJQDQRQFKpDOO¶,5&&6,VWLWXWRGHOOH
6FLHQ]H 1HXURORJLFKH GL %RORJQD JLj 2VSHGDOH %HOODULD H DOO¶2VSHGDOH GL %DJJLRYDUD 02 ,O &G' KD
SUHVRDWWRGHOOHSURSRVWHULWHQHQGROHWXWWHDGHJXDWHHFRQIRUPLDO%DQGR
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
y
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
$UHD³5LFHUFDSHULO*RYHUQRFOLQLFR´
1HOO¶DQQR OD 5HJLRQH KD PHVVR D GLVSRVL]LRQHULVRUVH GHVWLQDWH DO ILQDQ]LDPHQWR GL DWWLYLWj GL
ULFHUFDRULJLQDWHDOO¶LQWHUQRGHOOHD]LHQGHRVSHGDOLHUR±XQLYHUVLWDULHDOO¶,5&&6,VWLWXWR2UWRSHGLFR5L]]ROLGL
%RORJQD QRQFKp DOO¶,5&&6 ,VWLWXWR GHOOH 6FLHQ]H 1HXURORJLFKH GL %RORJQD JLj 2VSHGDOH %HOODULD H
DOO¶2VSHGDOHGL%DJJLRYDUD
4XHVW
DUHDq ULVHUYDWD D SURJHWWL GL YDOXWD]LRQH GHOO¶LPSDWWR FOLQLFR H RUJDQL]]DWLYR GL LQWHUYHQWL VDQLWDUL
HR WHFQRORJLH GL FXL QRQ VLDQR DQFRUD GLVSRQLELOL WXWWH OH LQIRUPD]LRQL QHFHVVDULH DOOD GHILQL]LRQH GHO
SURILOREHQHILFLRULVFKLRGHLFRVWLHGHOODWUDVIHULELOLWjDOVLVWHPDVDQLWDULR
,QSDUWLFRODUHVRQRVWDWLDPPHVVLVWXGLULJXDUGDQWL
VWXGLFOLQLFLFRQWUROODWLGLFRQIURQWRWUDIDUPDFLHRVWUDWHJLHWHUDSHXWLFKHQRQIDUPDFRORJLFKHLQDUHHDG
HOHYDWDLQFHUWH]]D
YHULILFDGHOJUDGRGLGLIIXVLRQHDGR]LRQHGLWHFQRORJLHHLQWHUYHQWLHLPSOLFD]LRQLFKHHVVLSRVVRQRDYHUH
VXOO¶RUJDQL]]D]LRQHLQWHUQDGHOO¶$]LHQGD
YDOXWD]LRQH GHOOD WUDVIHULELOLWj DO 6HUYL]LR VDQLWDULR GHOOD DSSURSULDWH]]D G¶XVR H GHOOD VLFXUH]]D GL
VSHFLILFLLQWHUYHQWLVDQLWDULIDUPDFRORJLFLHQRQIDUPDFRORJLFL
YDOXWD]LRQH GL LPSDWWR GL LQWHUYHQWL ILQDOL]]DWL DO PLJOLRUDPHQWR GHOOD TXDOLWj H GHOOD DSSURSULDWH]]D
GHOO¶DVVLVWHQ]DGHOOHUHWLDVVLVWHQ]LDOL
DQDOLVL GHO UDSSRUWR WUD PRGHOOL H YDULDELOL RUJDQL]]DWLYH H ORUR LPSDWWR LQ WHUPLQL GL SHUIRUPDQFH H
TXDOLWjGHOO
DVVLVWHQ]D
,O &ROOHJLR GL 'LUH]LRQH KD LQGLYLGXDWRWUD OH SURSRVWH SHUYHQXWHL SURJHWWL ULVSRQGHQWL DL UHTXLVLWL
SUHYLVWLGDO%DQGRHULWHQXWLPDJJLRUPHQWHFRHUHQWLFRQOHVWUDWHJLHD]LHQGDOL
,OJLXGL]LRqVWDWRHVSUHVVRFRQLOVXSSRUWRGHOSDUHUHIRUPXODWRGDO%RDUGSHUOD5LFHUFDH,QQRYD]LRQH
(¶VWDWRLQROWUHDSSURYDWRLO3LDQR$]LHQGDOHGHOODDWWLYLWjGLULFHUFD$QQL
6RQRVWDWLLQILQHYDOLGDWLGDO&ROOHJLRGL'LUH]LRQH
y
,OIRUPDWSHUODVWLSXODGHOOD&RQYHQ]LRQHSHUVSHULPHQWD]LRQHFOLQLFDVWXGLRRVVHUYD]LRQDOH
y
/DSURFHGXUDVWDQGDUGGLULIHULPHQWRD]LHQGDOH623$00B$$XWRUL]]D]LRQHDOO
DYYLRGHOORVWXGLR
y
/DSURFHGXUDVWDQGDUGGLULIHULPHQWRUHJLRQDOH623$000RQLWRUDJJLRGHOODTXDOLWjGHJOLVWXGL
3DUHUHVXLSURILOL
3HUTXDQWRDWWLHQHODGHILQL]LRQHGHLFULWHULHGHOOHSURFHGXUHSHULOFRQIHULPHQWRGLLQFDULFKLGLGLUH]LRQHGL
6WUXWWXUD &RPSOHVVD DOOD 'LULJHQ]D 0HGLFR6DQLWDULD QHOOH $]LHQGH H QHJOL (QWL GHO 6HUYL]LR 6DQLWDULR
5HJLRQDOH LO &ROOHJLR GL 'LUH]LRQH KD LO FRPSLWR GL LQGLYLGXDUH OH LQGLFD]LRQL SHU OD GHILQL]LRQH GHO
IDEELVRJQR$WDOHSURSRVLWRLO&ROOHJLRGL'LUH]LRQHqVWDWRFRLQYROWRSHUO¶HVSUHVVLRQHGHOSDUHUHVX
- IDEELVRJQRUHODWLYRDOODGLUH]LRQHGHOOD6WUXWWXUD&RPSOHVVDGL5DGLRWHUDSLD
- IDEELVRJQR FDUDWWHUL]]DQWH LO 6HUYL]LR )DUPDFLD H *RYHUQR &OLQLFR GHO )DUPDFR DL ILQL GHOO¶LQFDULFR GL
GLUH]LRQHGDFRQIHULUH
- IDEELVRJQR FDUDWWHUL]]DQWH OD 6WUXWWXUD &RPSOHVVD GL 0HGLFLQD 5LDELOLWDWLYD DL ILQL GHOO¶DVVHJQD]LRQH
GHOO¶LQFDULFRGLGLUH]LRQHGDFRQIHULUH
- IDEELVRJQR FDUDWWHUL]]DQWH OD 6WUXWWXUD &RPSOHVVD GL 3HGLDWULD *HQHUDOH H G¶8UJHQ]D DL ILQL GHOOD
DVVHJQD]LRQHGHOO¶LQFDULFRGLGLUH]LRQHGDFRQIHULUH
- IDEELVRJQR FDUDWWHUL]]DQWH LO 6HUYL]LR GL )LVLFD 6DQLWDULD DL ILQL GHOO¶DVVHJQD]LRQH GHOO¶LQFDULFR GL
GLUH]LRQH´
- $WWLYLWjOLEHURSURIHVVLRQDOH
3HUTXDQWRDWWLHQHO¶DWWLYLWjOLEHURSURIHVVLRQDOHLQWUDPXUDULDLO&ROOHJLRGL'LUH]LRQHKDHVSUHVVRSDUHUH
IDYRUHYROH LQ PHULWR DOOD FRVWLWX]LRQH GL XQ 2VVHUYDWRULR $]LHQGDOH SHUPDQHQWH GHOOD OLEHUD SURIHVVLRQH
FRQLOFRPSLWRGLHIIHWWXDUH
y
PRQLWRUDJJLR H YDOXWD]LRQH GHOOH GHFLVLRQL DVVXQWH QHOO¶LQGLYLGXD]LRQH GHJOL VSD]L SHU O¶HVHUFL]LR
GHOO¶DWWLYLWjOLEHURSURIHVVLRQDOHLQWUDPXUDULD
y
PRQLWRUDJJLRHYDOXWD]LRQHGHLYROXPLGLDWWLYLWjGHOODOLEHUDSURIHVVLRQH
y
PRQLWRUDJJLR H YDOXWD]LRQH GHO UDSSRUWR WUD DWWLYLWj OLEHUR SURIHVVLRQDOH LQWUDPXUDULD H DWWLYLWj
LVWLWX]LRQDOH
6RQRVWDWHDSSURIRQGLWHLQVHGHGL&ROOHJLRGL'LUH]LRQH
- DOFXQHFULWLFLWjOHJDWHDOOHLQIH]LRQLRVSHGDOLHUH
*HVWLRQHGHOULVFKLRHVLFXUH]]D
9DOXWD]LRQHGHOULVFKLRJHVWLRQHGHOOHHPHUJHQ]HHSLDQLIRUPDWLYL
3HU O¶DQQR L SULQFLSDOL RELHWWLYL LQ PDWHULD GL VDOXWH H VLFXUH]]D GHL OXRJKL GL ODYRUR FKH KDQQR
RULHQWDWRO¶DWWLYLWjGHO6HUYL]LR3UHYHQ]LRQHH6LFXUH]]DVRQRVWDWL
)RUPD]LRQH GHO SHUVRQDOH VXOOH WHPDWLFKH GHOOD VLFXUH]]D SDUWH JHQHUDOH DL VHQVL
GHOO¶DFFRUGRVWDWRUHJLRQLGHO
,QIRUPD]LRQHVXOOHSURFHGXUHGLHYDFXD]LRQHLQFDVRGLHPHUJHQ]DHSLDQLILFD]LRQHDLVHQVL
GHO'0
9DOXWD]LRQLGHOULVFKLRDLVHQVLGHOO¶DUWGHO'/JV
5LVXOWDWLUDJJLXQWL
D /D UHFHQWH QRUPDWLYD KD LQWURGRWWR LO FULWHULR GHOOR VYROJLPHQWR GHOOD IRUPD]LRQH REEOLJDWRULD GHO
SHUVRQDOHVXLWHPLGHOODVLFXUH]]DGLVWLQWDLQSDUWH5LVFKL*HQHUDOLRUHHSDUWH5LVFKL6SHFLILFL
RUHSHUULVFKLREDVVRLQWHQGHQGRSHUWDOHOHDWWLYLWjGLDPELWRWHFQLFRDPPLQLVWUDWLYRHRUH
SHU ULVFKLR HOHYDWR RYH VRQR ULFRPSUHVH OH DWWLYLWj GL DPELWR VDQLWDULR 3HU OD SDUWH GHL 5LVFKL
*HQHUDOL D IURQWH GL ROWUH GLSHQGHQWL GD IRUPDUH q VWDWR DYYLDWR XQ SURJHWWR IRUPDWLYR
VYROWR SDUWH LQ DXOD SDUWH FRQ PHWRGR HOHDUQLQJ XWLOL]]DQGR DOOR VFRSR XQD SLDWWDIRUPD
DSSRVLWDPHQWH SURJHWWDWD H SURSRVWD D TXHOOH ILJXUH SURIHVVLRQDOL PHGLFL PHQR GLVSRQLELOL D
VHJXLUH SHU UDJLRQL GL LPSHJQL SURIHVVLRQDOL LQFRQWUL IRUPDWLYL GL WLSR IURQWDOH /¶RELHWWLYR GL
UDJJLXQJHUHFRQLOPHWRGR)$'DYYLDWRQHOPHVHGL$SULOHDOPHQRLOGHOOHSRVWD]LRQLPHVVHD
GLVSRVL]LRQH HQWUR OD ILQH GHOO¶DQQR q VWDWR DPSLDPHQWH VXSHUDWR $QFKH OD SHUFHQWXDOH GHL
GLSHQGHQWL FKH KD VYROWR LO FRUVR LQ DXOD KD VXSHUDWR DPSLDPHQWH LO GHO WRWDOH FDOFRODWR VXO
QXPHURFRPSOHVVLYRGHLGLSHQGHQWL
E $WWUDYHUVRO
DQDOLVLGHJOLVFHQDULLQFLGHQWDOLSRVVLELOLHORVWXGLRGHOOHFDUDWWHULVWLFKHLPSLDQWLVWLFKHH
WHFQRORJLFKH ROWUH FKH GHOOD GLVWULEX]LRQH GHJOL VSD]L H GHJOL DPELHQWL GL ODYRUR H GL WUDQVLWR q
SRVVLELOH VYLOXSSDUH LO OD\RXW SL LQGLFDWR SHU JDUDQWLUH OD PLJOLRUH JHVWLRQH LQ VLFXUH]]D GHOOH
HPHUJHQ]H FKH SRVVRQR YHULILFDUVL HYHQWR VLVPLFR LQFHQGLR SDU]LDOH R JHQHUDOL]]DWR GDQQL
G
DFTXDHFFHWHUD6XOODEDVHGLFLzLQDSSOLFD]LRQHGHL3LDQLGL(PHUJHQ]DYLJHQWLqVWDWRSRUWDWR
DYDQWLXQSURJHWWRGLJOREDOHFRLQYROJLPHQWRHVHQVLELOL]]D]LRQHGHOOHSURIHVVLRQDOLWjGLDUHDPHGLFD
H DVVLVWHQ]LDOH GHL VLQJROL 'LSDUWLPHQWL DG $WWLYLWj ,QWHJUDWD '$, VXL WHPL GHOOD VLFXUH]]D OH
TXDOL QHOO
DSSRUWDUH LO SURSULR FRQWULEXWR DO YHULILFDUVL GL XQ HPHUJHQ]D LQFHQGLR VLVPD GDQQL
G
DFTXDHFFHWHUDKDQQRO¶REEOLJRGLULVSHWWDUHOHSURFHGXUHVYLOXSSDWHHGDFTXLVLUHOHLQIRUPD]LRQL
QHFHVVDULH SHU FRQWULEXLUH DWWLYDPHQWH DG XQ ORUR VXSHUDPHQWR 7XWWL JOL HGLILFL DWWLYL LQ DPELWR
RVSHGDOLHURVRQRGRWDWLGL3LDQR(PHUJHQ]D,QWHUQR
F 9HQJRQR YDOXWDWL WXWWL L ULVFKL GHULYDQWL GDOOH DWWLYLWj ODYRUDWLYH VYROWH DOO
LQWHUQR GHOO
HGLILFLR H
YHQJRQRDQQHVVHWXWWHOHSURSRVWHGLPLJOLRUDPHQWRILQDOL]]DWHDOODPLWLJD]LRQHGHOO
HVSRVL]LRQHGHL
ODYRUDWRUL 6L LQVHULVFRQR LQ TXHVWR FRQWHVWR DQFKH OH YDOXWD]LRQL GHOOH FRUUHWWH SRVWXUH DVVXQWH H
GHOO¶LGRQHLWj GHOOH SRVWD]LRQL UHVH GLVSRQLELOL SHURSHUDWRUL D 9'7 FODVVLILFDWLVXOOD EDVH GHL FULWHUL
ULSRUWDWLQHO7LW9,,GHO'/JVVRSUDULFKLDPDWR
,QWHUYHQWLUHDOL]]DWLQHOFRUVRGHO
y 3URVHJXLPHQWRGHOO¶DWWLYLWjIRUPDWLYDFRQHVWHQVLRQHGHOPHWRGRHOHDUQLQJDQFKHDOODSDUWHGHOOD
VRPPLQLVWUD]LRQHUHODWLYDDLULVFKLVSHFLILFLDOPHQRSHULGLSHQGHQWLODFXLDWWLYLWjqDQQRYHUDELOH
WUDTXHOOHFRQVLGHUDWHDEDVVRULVFKLR
y $JJLRUQDPHQWRGHL3LDQLGL(PHUJHQ]D,QWHUQLQHLFDVLGLLQWHUYHQWLGLULTXDOLILFD]LRQHRGLQXRYD
GHVWLQD]LRQHG¶XVRDVVHJQDWDDJOLDPELHQWLGDDQDOL]]DUH
y $JJLRUQDPHQWRGHL'RFXPHQWLGL9DOXWD]LRQHGHO5LVFKLRQHLFDVLGLLQWHUYHQWLGLULTXDOLILFD]LRQHR
GLQXRYDGHVWLQD]LRQHG¶XVRDVVHJQDWDDJOLDPELHQWLGDDQDOL]]DUH
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
- OLQHHGLLQGLUL]]RDOOH$]LHQGHSHUODJHVWLRQHGHOULVFKLRLQIHWWLYRLQIH]LRQLFRUUHODWHDOO¶DVVLVWHQ]DHXVR
UHVSRQVDELOHGLDQWLELRWLFL
- LQGLFD]LRQLLQPDWHULDGLDQWLFRUUX]LRQH
- 4XHVWLRQDULRGLYDOXWD]LRQHVHUYL]LRPHGLD]LRQHOLQJXLVWLFRFXOWXUDOHWHOHIRQLFD
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
*HVWLRQHGHJOLLQIRUWXQL
/D GHILQL]LRQH GHO IHQRPHQR LQIRUWXQLVWLFR D FDULFR GHO SHUVRQDOH RSHUDQWH LQ XQD VWUXWWXUD RVSHGDOLHUD
LPSOLFD OD QHFHVVLWj GL LQGLYLGXDUH LQ YLD SUHOLPLQDUH JOL DVSHWWL IRQGDPHQWDOL FKH FDUDWWHUL]]DQR OD
VLFXUH]]DVXOOXRJRGLODYRUR
7DOL DVSHWWL SRVVRQR ULJXDUGDUH VLD OD VWUXWWXUD VSD]L DWWUH]]DWXUH WHFQRORJLH GRWD]LRQH GL PH]]L GL
SURWH]LRQH LQGLYLGXDOH VLD OH SURFHGXUH RUJDQL]]D]LRQH GHO ODYRUR SUHVHQ]D R DVVHQ]D GL SURWRFROOL R
OLQHHJXLGDLGHQWLILFD]LRQHGHLUXROLFRPXQLFD]LRQHIUDJOLRSHUDWRULHFFHWHUD
5LVXOWD LQROWUH LPSRUWDQWHLGHQWLILFDUH OH DUHH GRYH OD IUHTXHQ]D GHO IHQRPHQR LQIRUWXQLVWLFR VL ULYHOD SL
HOHYDWDOHSURFHGXUHRSHUDWLYHDULVFKLROHTXDOLILFKHHOHPDQVLRQLGHOSHUVRQDOHPDJJLRUPHQWHFROSLWR
WXWWR TXHVWR DO ILQH GL GHILQLUH OH GLPHQVLRQL GHOSUREOHPD H JHVWLUH DGHJXDWDPHQWH LO ULVFKLR ULGXFHQGR
O¶HVSRVL]LRQHHIRUPDQGRJOLRSHUDWRULVDQLWDUL
,Q TXHVWR FRQWHVWR FRPH QHJOL DQQL SUHFHGHQWL q SURVHJXLWD O¶DWWLYLWj GL DJJLRUQDPHQWR GHO GDWD EDVH
DSSRVLWDPHQWHFUHDWRSHUODULOHYD]LRQHGHJOLHYHQWLLQIRUWXQLVWLFLFRQILQDOLWjGLVWDWLVWLFDGHVFULWWLYDFKH
FRQVHQWH GL GLVSRUUH GL XQD VHULH GL LQIRUPD]LRQL XWLOL DOOD FRPSUHQVLRQH GHO IHQRPHQR H DQFKH
DOO¶DGR]LRQHGLD]LRQLFRUUHWWLYH
3HU TXDQWR ULJXDUGD JOL LQIRUWXQL RFFRUVL DO SHUVRQDOH GLSHQGHQWH UHODWLYL DOO¶DQQR VL ULOHYD XQ
QXPHURGLHYHQWLFRPSOHVVLYRSDULDQHYHQWLSHUXQWRWDOHGLJLRUQDWHODYRUDWLYHSHUVHGLQ
FRQXQ¶DVVHQ]DPHGLDGLJLRUQL
/¶LQFLGHQ]DGHOIHQRPHQRULVSHWWRDOQXPHURFRPSOHVVLYRGLRSHUDWRULFRQUDSSRUWRGLODYRURVXERUGLQDWR
QqSDULDOQXPHURGLLQIRUWXQLGHQXQFLDWLDOO¶,1$,/1ƒWRWDOHGLSHQGHQWL
5LVSHWWRDOWRWDOHGHJOLLQIRUWXQLGHQXQFLDWLO¶LQFLGHQ]DGLTXHOOLDPDWULFHELRORJLFDqSDULDOFLUFD
/¶DQDOLVLUHODWLYDDOODQDWXUDGHLLQIRUWXQLHYLGHQ]LDFKH
o Q LQIRUWXQL VRQR GD ULFRQGXUUH D ³HYHQWL GL ULVFKLR ELRORJLFR´ GL FXL QRQ KDQQR SURGRWWR
DVVHQ]DGDOODYRURHQVRQRGRYXWLDULFDGXWHGLLQIRUWXQLSUHFHGHQWL
o Q LQIRUWXQL VRQR ULFRQGXFLELOL D ³ULFDGXWH GL LQIRUWXQL´ SHU XQ WRWDOH GL JLRUQDWH ODYRUDWLYH
SHUVHSDULDJLRUQL
/HJLRUQDWHSHUVHSHUULFDGXWHGLHYHQWLDFFDGXWLQHOULVXOWDQRPHQWUHOHJLRUQDWHSHUVHSHU
HYHQWLDFFDGXWLQHJOLDQQLSUHFHGHQWLGDODPPRQWDQRD
$QDOL]]DQGRLGDWLLQXQ¶RWWLFDGLJHQHUHVLSXzRVVHUYDUHODVHJXHQWHGLVWULEX]LRQH
o PDVFKLLQIRUWXQDWLLQIRUWXQL
o IHPPLQHLQIRUWXQDWHLQIRUWXQL
,OGDWRYDOHWWRLQVWUHWWDFRUUHOD]LRQHDOODPDJJLRUDQ]DQXPHULFDGHOODSRSROD]LRQHIHPPLQLOHULVSHWWRDO
WRWDOHFRPHUDSSUHVHQWDWRQHOODSDUWHGHOFDSLWRORGHGLFDWDDOOD³FDUWDGLLGHQWLWj´GHOSHUVRQDOH
,QEDVHDOVHVVRHDOO¶HWjDQDJUDILFDJOLLQIRUWXQLVLGLVWULEXLVFRQRFRPHVHJXH
7DEHOOD'LVWULEX]LRQHLQIRUWXQLLQEDVHDJHQHUHHHWjDQDJUDILFD
(Wj
7RWDOH
0DVFKL
)HPPLQH
$QDOL]]DQGR QHO GHWWDJOLR OH PRGDOLWj GL DFFDGLPHQWR GL LQIRUWXQLR SL ULOHYDQWL VL SXz RVVHUYDUH TXDQWR
VHJXH
7DEHOOD1XPHURGLLQIRUWXQLHJLRUQDWHGLDVVHQ]DSHUIRUPDGLLQIRUWXQLRDQQR
)RUPD
$IIDWLFDPHQWRPXVFRODUH
$JJUHGLWR
&DGXWR
&ROSLWRGD
&RQWDWWRFRQ
,PSUHFLVDWR
,QLWLQHUH
0RYLPHQWRLQFRRUGLQDWR
1XPHURGL
LQIRUWXQL
*LRUQDWHGL
DVVHQ]D
)RUPD
1XPHURGL
LQIRUWXQL
,QFLGHQWHDOODJXLGD
3HUFXWDQHR
3LHGHLQIDOOR
6FKLDFFLDWRGD
6FLYRODQGR
6LVFKLDFFLDYD
6LWDJOLDYD
6SRVWDQGR6ROOHYDQGR
8UWRFRQWUR
7RWDOH
*LRUQDWHGL
DVVHQ]D
/¶HYHQWRLQIRUWXQLVWLFRDSSDUHOHJDWRVRVWDQ]LDOPHQWHD
y
6SRVWDQGR6ROOHYDQGRD]LRQLGLVSRVWDPHQWRVROOHYDPHQWRSD]LHQWLHPDWHULDOLEHQLGLFRQVXPR
DUUHGL5LVFKLRGDPRYLPHQWD]LRQH
y
,Q,WLQHUHVSRVWDPHQWLGDHSHULOODYRUR
y
&DGXWRLQSLDQRFDGXWHDFFLGHQWDOLGXUDQWHLOWUDQVLWRRLOWUDVSRUWRGLRJJHWWLRSHUVRQH
y
8UWRFRQWURFRQWDWWRYLROHQWRFRQWURDWWUH]]DWXUHRPRELOLSRVL]LRQDWLQRQFRUUHWWDPHQWHRLQOXRJKL
QRQLGRQHL
y
6FLYRODQGRVXSDYLPHQWLVFDOHFRPSUHQVLYRGLPDUFLDSLHGLUDPSHGLDFFHVVRLQLWLQHUH
y
3LHGHLQIDOORPDOSRVL]LRQDPHQWRGRYXWRDVFDUVDVWDELOLWjGHOODSRVWXUD
y
&ROSLWRGDWUDWWDVLJHQHUDOPHQWHGLDJJUHVVLRQLGDSDUWHGLSD]LHQWLHFRQWXVLRQLFRQFRQWURRJJHWWL
DWWUH]]DWXUH
y
6LVFKLDFFLDYDRSHUDWRUHVFKLDFFLDWRGDRJJHWWLOHWWLFDUUHOOLDWWUH]]DWXUHGLODYRURLQJHQHUDOH
y
6LqSXQWRFRQ«FRQWDWWRDFFLGHQWDOHFRQWDJOLHQWLHYHQWRDULVFKLRELRORJLFR
'DL GDWL VRSUD LQGLFDWL VL HYLGHQ]LD FKH OH FLUFRVWDQ]H FKH KDQQR GHWHUPLQDWR LO PDJJLRU QXPHUR GL
JLRUQDWHSHUVHQHOVRQRSUHYDOHQWHPHQWHGRYXWHDIHQRPHQLOHJDWLDOODPRYLPHQWD]LRQH5LVSHWWRDL
GDWL GHOOR VFRUVR DQQR DQFKH VH q ULOHYDELOH XQ FDOR GHO IHQRPHQR VL GHYH FRQVWDWDUH FKH OH OHVLRQL GD
VIRU]RVSRVWDQGRVROOHYDQGRULPDQJRQRLYDORULSLFULWLFL
,QSDUWLFRODUHODSDUWHGHOFRUSRPDJJLRUPHQWHFROSLWDULVXOWDHVVHUHODVHJXHQWH
7DEHOOD3DUWHGHOFRUSRPDJJLRUPHQWHFROSLWDGDOO¶HYHQWRLQIRUWXQLVWLFR
6HGH
*LRUQL
(YHQWL
$UWR,QIHULRUH
$UWR6XSHULRUH
%DFLQR$GGRPH
&DSRIDFFLDWHVWD
&ROOR
&XWH
2FFKL
3OXULPD
7RUDFH7URQFR&RORQQD
7RWDOH
$ FRQIHUPD GHOO¶DQGDPHQWR ULOHYDWR QHJOL DQQL SUHFHGHQWL JOL RSHUDWRUL PDJJLRUPHQWH LQWHUHVVDWL GD
HYHQWLLQIRUWXQLVWLFLDSSDUWHQJRQRDOOHFDWHJRULHSLQXPHURVHDOO¶LQWHUQRGHOO¶$]LHQGDFKHFRUULVSRQGRQR
DQFKH DOOD FODVVH GL ODYRUDWRUL SL HVSRVWD DO ULVFKLR LQIRUWXQLVWLFR VL WUDWWD LQIDWWL SULQFLSDOPHQWH GL
SHUVRQDOHDGGHWWRDOO¶DVVLVWHQ]DDOODOXFHGHOOHVSHFLILFKHPDQVLRQLVYROWH
7DEHOOD*LRUQDWHGLDVVHQ]DSHULQIRUWXQLRHQXPHURLQIRUWXQLSHUSURILORSURIHVVLRQDOH
4XDOLILFD
&$7$$86,/,$5,263(&,$/,=
&$7%237(&1$86,/,$5,263(&,$/,==$72
&$7%23(57(&1$''$//
$&&2*/,(1=$
&$7%23(57(&11(&52)2521(&526&232
&$7%23(5$77(&1$''(772$66,67(1=$
&$7%23(5$77(&1$5&+,9,67$
&$7%23(5$77(&1&(1752(/(77521,&2
1,QIRUWXQL
*LRUQL
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
4XDOLILFD
&$7%23(5$77(&135(3$5$725(',/$%
&$7%&2$'$0092$''6(593267&2//(*
&$7%68323(5$725(62&,26$1,7$5,2
&$7&$66,67$00,1,675
&$7&38(5,&8/75,&((63(57$
&$7&,1)(50,(5(*(1(5,&2(63(572
&$7&$667(&1,&2$''$//
$&&2*/,(1=$
&$7&$667(&1,&2',&8&,1$
&$7&$667(&1,&2',)$50$&,$
&$7&$667(&1,&21(&52)2521(&526&232
&$7'&2//36),6,27(5FFQO
&$7'&2//352)6$1267(75FFQO
&$7'&2//352)6$1,1)(50FFQO
&$7'&2/352)6$176/$%%,20FFQO
&$7'&2//352)676$15$',2/FFQO
&$7'6&2//$%352)6$1,7(63&$326$/$
',5,*(17(%,2/2*20,&52%,2/2*,$(9,52/2*,$
',5(7725(',5,*0('&$5',2/2*,$
',5,*(17(0(',&2',5(=,21(0(',&$',35(6,',2263
',5,*0(',&2$1(67(6,$(5,$1,0$=,21(
',5,*0(',&2&+,585*,$0$;,//2)$&&,$/(
',5,*0(',&2*,1(&2/2*,$(267(75,&,$
',5,*0(',&225723(',$(75$80$72/2*,$
',5,*0('&+,53/$67,&$(5,&2675
',5,*0('0('(&+,5$&&(85*(1=$
',5,*(17(0(',&2&$5',2/2*,$
',5,*(17(0(',&2&+,585*,$*(1(5$/(
',5,*(17(0(',&2*(1(7,&$0(',&$
',5,*(17(0(',&2*(5,$75,$
',5,*(17(0(',&20(',&,1$,17(51$
',5,*(17(0(',&21(852&+,585*,$
',5,*(17(0(',&25$',2',$*1267,&$
',5,*(17(0(',&2852/2*,$
7RWDOH
*LRUQL
1,QIRUWXQL
3HU TXDQWR DWWLHQH JOL DPELWL ODYRUDWLYL QHL TXDOL JOL HYHQWL VL VRQR YHULILFDWL FRQ PDJJLRUH DWWHQ]LRQH D
TXHOOLFKHUHJLVWUDQRXQSLHOHYDWRQXPHURGLHYHQWLDVVRFLDWRDGXQHOHYDWRFRUULVSRQGHQWHQXPHURGL
JLRUQDWH ODYRUDWLYH SHUVH VL SXz HVDPLQDUH QHOOD WDEHOOD FKH VHJXH FRPH JOL HYHQWL LQIRUWXQLVWLFL VL
GLVWULEXLVFRQRDOO¶LQWHUQRGHL'LSDUWLPHQWLGHOO¶$]LHQGD
7DEHOOD'LVWULEX]LRQHHYHQWLLQIRUWXQLVWLFLQHL'LSDUWLPHQWL
'LSDUWLPHQWR
1(YHQWL
*LRUQL
&$5',21()5232/021$5(
&+,585*,&2
81,7$¶23(5$7,9((6(7725,,167$))$//$',5(=,21(
$=,(1'$/((6(59,=,*(1(5$/,
(0(5*(1=$('85*(1=$
*(5,$75,&2(5,$%,/,7$7,92
0$7(512,1)$17,/(
0(',&232/,63(&,$/,67,&2
1(8526&,(1=(
21&2(0$72/2*,&2,17(51,67,&2
3$72/2*,$(0(',&,1$',/$%25$725,2
5$',2/2*,$',$*13(5,00$*
7(&1,&2('(//(7(&12/2*,(
7(67$&2//2
7RWDOH
'DTXDQWRVRSUDGHOLQHDWRVLSXzFRQFOXGHUHFKHRFFRUUHPDQWHQHUHDOWDO¶DWWHQ]LRQHVXOOHSURFHGXUHGL
PRYLPHQWD]LRQH $OOR VFRSR GXUDQWH O¶DQQR LO 6HUYL]LR GL 3UHYHQ]LRQH H 3URWH]LRQH $]LHQGDOH LQ
FROODERUD]LRQH FRQ LO 'LSDUWLPHQWR *HULDWULFR 5LDELOLWDWLYR KD VYLOXSSDWR XQ SHUFRUVR IRUPDWLYR SUHVVR
O¶82GL&OLQLFDH7HUDSLD0HGLFDRYHODYDOXWD]LRQHGHO5LVFKLRGDPRYLPHQWD]LRQHHYLGHQ]LDYDFULWLFLWj
7DOHSHUFRUVRqVWDWRDWWXDWRFRQWHVWXDOPHQWHDOODVRVWLWX]LRQHGHLOHWWLSUHVHQWLFRQOHWWLHUJRQRPLFLSHU
FXL JOL RSHUDWRUL KDQQR ULFHYXWR XQ DGGHVWUDPHQWR VXO FDPSR ULVSHWWR DOOH SL FRPXQL PDQRYUH GL
PRYLPHQWD]LRQH SD]LHQWL SUHVHQWL QHOO¶DWWLYLWj GL UHSDUWR LQROWUH H SHU QDWXUDOH FRQVHJXHQ]D VL q
RWWHQXWDXQDULGX]LRQHGLSRVWLOHWWRFKHKDFRQVHQWLWRGLVXSHUDUHOHGLIILFROWjHJOLLPSHGLPHQWLDOOH
PDQRYUH GRYXWH DOO¶HVLJXLWj GHOOR VSD]LR GLVSRQLELOH 'XUDQWH WXWWD OD IDVH GHO SURJHWWR L )LVLRWHUDSLVWL
KDQQR FRVWDQWHPHQWH IUHTXHQWDWR LO UHSDUWR PHWWHQGRVL D GLVSRVL]LRQH GHJOL RSHUDWRUL DOOR VFRSR GL
LQGLYLGXDUHLFRUUHWWLYLSLLGRQHLDOOHDELWXDOLPRGDOLWjGLPRYLPHQWD]LRQHDGRWWDWHHTXHVWRQRQVRORSHU
HYLWDUH VRYUDFFDULFR DL ODYRUDWRUL PD DQFKH SHU DJHYRODUH OD PRYLPHQWD]LRQH GHL SD]LHQWL H ULGXUUH DO
PDVVLPROHVLQGURPLGDDOOHWWDPHQWR
)LQLWR O¶DGGHVWUDPHQWR FRQ XQD ULXQLRQH GL UHSDUWR VL VRQR UDFFROWH OH LPSUHVVLRQL GHL ODYRUDWRUL HG
HYHQWXDOL VXJJHULPHQWL ULVSHWWR DO SHUFRUVR IDWWR H VL VRQR UHJLVWUDWH HVSUHVVLRQL GL DSSUH]]DPHQWR H GL
VRGGLVID]LRQHSHULOODYRURVYROWRQRQGLPHQRqVWDWRULIHULWRFKHDQFKHLOFOLPDODYRUDWLYRULVXOWDPHQR
VWUHVVDQWHHSLJUDWLILFDQWH6LqSRLIRUQLWDDJOLRSHUDWRULXQDEURFKXUHGDGLVWULEXLUHLQUHSDUWRVLDDJOL
VWHVVLRSHUDWRULFKHDLIDPLOLDULGHLGHJHQWLLQFXLVLLQVLVWHVXOO¶LPSRUWDQ]DHVXOOHPRGDOLWjGLDSSOLFD]LRQH
GHLPHWRGLSHUXQDFRUUHWWDPRYLPHQWD]LRQH)RUWLGLTXHVWDHVSHULHQ]DVLqLQWHQ]LRQDWLDSURVHJXLUHVX
TXHVWR FDPPLQR DQFKH QHOO¶DOWUD UHDOWj DG DOWD FULWLFLWj SHU PRYLPHQWD]LRQH LQGLYLGXDWD QHOOD GHJHQ]D
GHOO¶820HGLFLQDG¶8UJHQ]D
6L ULWLHQHRSSRUWXQR XQ FHQQR UHODWLYDPHQWH DO IHQRPHQR GHOOH DJJUHVVLRQL QHL FRQIURQWLGHJOLRSHUDWRUL
FKHVLULVFRQWUDVHPSUHSLIUHTXHQWHPHQWHDQFKHQHOO¶$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGL3DUPD$WDOH
SURSRVLWR O¶$]LHQGD KD ULVSRVWR DOOH VROOHFLWD]LRQL GHOOD 5HJLRQH (PLOLD5RPDJQD FKH GDO SRUWD
DYDQWL XQ SURJUDPPD SHU OD SUHYHQ]LRQH GHOOH DJJUHVVLRQL VXJOL RSHUDWRUL LQ DPELWR VDQLWDULR
UDFFRJOLHQGR LQIRUPD]LRQL H VXO IHQRPHQR H VXOOD FRUUHWWD GLIIXVLRQH H DWWXD]LRQH GHOOH OLQHH JXLGD
LPSDUWLWHGLUHWWRDOO¶DGR]LRQHGLWXWWLJOLVWUXPHQWLSRVVLELOLILQDOL]]DWLDOODPLWLJD]LRQHGHOIHQRPHQR
,OJUXSSRGLODYRURKDSUHVRLQHVDPHJOLDFFDGLPHQWLRFFRUVLSHUIRFDOL]]DUHJOLLQWHUYHQWLVWUXWWXUDOLSL
XUJHQWLGDDWWXDUHVLqSURJUDPPDWRXQVHPLQDULRIRUPDWLYRGLDSSURIRQGLPHQWRHVHQVLELOL]]D]LRQHVXO
IHQRPHQR FKH VL VYROJHUj QHO FRUVR GHOO¶DQQR ULYROWR D WXWWL JOL RSHUDWRUL FXL IDUj VHJXLWR XQD
IRUPD]LRQHSLVSHFLILFDLQGLUL]]DWDDGXQQXPHUROLPLWDWRGLRSHUDWRULFKHULVXOWDQRHVVHUHSLHVSRVWLD
WDOHULVFKLR8OWHULRULLQIRUPD]LRQLVXTXHVWDDWWLYLWjVRQRSUHVHQWDQWHQHOFDSLWROR
'DL GDWL LQIRUWXQLVWLFL HYHQWL SHU XQ WRWDOH GL JLRUQL GL DVVHQ]D YHGL WDEHOOD VL RVVHUYD FKH
O¶$]LHQGDVHJXHO¶DQGDPHQWRJHQHUDOHVLDDFDUDWWHUHUHJLRQDOHFKHQD]LRQDOHFKHYHGHIUDJOLRSHUDWRUL
SLHVSRVWLTXHOOLDSSDUWHQHQWLDOOHDUHHGHOO¶(PHUJHQ]D8UJHQ]DHGHOOD*HULDWULDDQFKHVHQRQPDQFDQR
HSLVRGLVLQJROLUHJLVWUDWLLQDOWULUHSDUWL$FDXVDUHWDOLHYHQWLVRQRSHUORSLLSD]LHQWLHPHQRLIDPLOLDUL
QRQVLUHJLVWUDQRLQYHFHLQIRUWXQLJHQHUDWLIUDRSHUDWRUHHRSHUDWRUH
6L GRYUj IDUH LQ PRGR FKH JOL RSHUDWRUL SRVVDQR GHQXQFLDUH TXHVWL HSLVRGL DQFKH TXDQGR VRQR QHDU
PLVVLQJSHUSRWHUQHPHJOLRLQWHUSUHWDUHOHGLQDPLFKHHDSSRUWDUHOHRSSRUWXQHFRUUH]LRQL
,QFRQFOXVLRQHVLULEDGLVFHO¶LPSRUWDQ]DGHOWHPSHVWLYRPRQLWRUDJJLRGHJOLLQIRUWXQLHGHOOHORURPRGDOLWj
GLDFFDGLPHQWRSHUXQDFRUUHWWDVWHVXUDGHOOHGHQXQFHGLLQIRUWXQLRQRQFKpSHUULOHYDUHSURQWDPHQWHOH
FULWLFLWjLQPRGRGDDWWXDUHLQHFHVVDULPHFFDQLVPLGLSUHYHQ]LRQH
,Q WDOH RWWLFD OD SDUWHFLSD]LRQH GHO 5HVSRQVDELOH GHO 6HUYL]LR GL 3UHYHQ]LRQH H 3UHYHQ]LRQH $]LHQGDOH LQ
RFFDVLRQHGLFLDVFXQ%XGJHW'LSDUWLPHQWDOHKDDXPHQWDWRLOOLYHOORGLDWWHQ]LRQHGDSDUWHGHOOHILJXUHGHL
'LULJHQWL H GHL 3UHSRVWL SHU OD VLFXUH]]D SDULPHQWL OD VRPPLQLVWUD]LRQH DL GLSHQGHQWL GHO SURJHWWR
IRUPDWLYR VXL 5LVFKL ODYRUDWLYL LQ RWWHPSHUDQ]D DJOL REEOLJKL VDQFLWL GDO VRSUDULFKLDPDWR $FFRUGR 6WDWR
5HJLRQLKDLQGXEELDPHQWHSURGRWWRXQDSLHOHYDWDVHQVLELOLWjDOOHWHPDWLFKHGHOODVLFXUH]]D
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
5LGHILQL]LRQHGHLUXROLSURIHVVLRQDOLLQUHOD]LRQHDOOR
VYLOXSSRGHOOHVWUDWHJLHD]LHQGDOL
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
/D&RQVXOHQ]D,QIHUPLHULVWLFD
,OSRVVHVVRGLDELOLWjHGLFRQRVFHQ]HGLVWLQWLYHGHLSURIHVVLRQLVWLULVXOWDHVVHUHXQDULVRUVDLPSRUWDQWHSHU
OR VYLOXSSR GHL SURFHVVL DVVLVWHQ]LDOL QHOO¶RWWLFD GL IRUQLUH OD PLJOLRU ULVSRVWD DO ELVRJQR GL FXUD
GHOO¶DVVLVWLWR /D FRQVXOHQ]D LQIHUPLHULVWLFD IDYRULVFH LO FRQIURQWR H O¶LQWHJUD]LRQH IUD GXH SURIHVVLRQLVWL
SURPXRYHQGR QHO FRQWHPSR OD GLIIXVLRQH GHOOH PLJOLRUL SUDWLFKH DVVLVWHQ]LDOL 1HO FRUVR GHO VRQR
VWDWLLPSOHPHQWDWLLSHUFRUVLDVVLVWHQ]LDOLFKHVLDYYDOJRQRGHOODFRQVXOHQ]DLQIHUPLHULVWLFDUDJJLXQJHQGR
SRVLWLYLULVXOWDWLLQWHUPLQLGLFRPSHWHQ]HGHLSURIHVVLRQLVWLHGLYDORUL]]D]LRQHGHJOLLQIHUPLHULHVSHUWL/D
FRQVXOHQ]D LQIHUPLHULVWLFD KD DYXWR FRPH XOWHULRUH RELHWWLYR TXHOOR GL PLJOLRUDUH L SHUFRUVL DVVLVWHQ]LDOL
QHOGHOLFDWRSDVVDJJLRRVSHGDOHWHUULWRULRIDYRUHQGRODFRQWLQXLWjDVVLVWHQ]LDOHLQSDUWLFRODUHGHLSD]LHQWL
IUDJLOL DIIHWWL GD SDWRORJLH FURQLFKH 3DUWH GHOO¶DWWLYLWj GHJOL LQIHUPLHUL FRQVXOHQWL VL q TXLQGL ULYROWD
DOO¶XWHQWH SURYHQLHQWH GDO WHUULWRULR R VL q LQVHULWD QHO SURJHWWR GL GLPLVVLRQH GHO SD]LHQWH ULFRYHUDWR
&DUDWWHULVWLFD FRPXQH D WXWWH OH HVSHULHQ]H GL FRQVXOHQ]D LQIHUPLHULVWLFD FKH DIIURQWDQR LO WHPD GHOOD
FRQWLQXLWj GHOOH FXUH q LO IRUWH DFFHQWR H O¶LPSHJQR FKH LO FRQVXOHQWH LQIHUPLHUH GHGLFD DJOL DVSHWWL
HGXFDWLYL H LQIRUPDWLYL LQGLUL]]DWL DO SD]LHQWH H DL FDUH JLYHU HOHPHQWR FKH FDUDWWHUL]]D H LQIOXHQ]D
SRVLWLYDPHQWHODTXDOLWjGHOOHFXUHLQIHUPLHULVWLFKH
'LYHUVLVRQRVWDWLJOLDPELWLGLLQWHUYHQWR
y FRQVXOHQ]DLQIHUPLHULVWLFD3,&&7HDPODFRQVXOHQ]DLQIHUPLHULVWLFDVLUHDOL]]DFRQODSURFHGXUDGL
LQVHU]LRQHGHO3,&&3HULSKHUDOO\,QVHUWHG&HQWUDO&DWKHWHUVHFRQLQWHUYHQWLOHJDWLDOODJHVWLRQH
GHO FDWHWHUH FRPSUHVD OD SUHYHQ]LRQH H OD JHVWLRQH GHOOH FRPSOLFDQ]H &LUFD XQ WHU]R GHOOH
DSSOLFD]LRQL VRQR VWDWH HIIHWWXDWH LQ DPELHQWH RQFRORJLFR R GL OXQJRGHJHQ]D H KD ULJXDUGDWR
SD]LHQWLDIIHWWLGDSDWRORJLHFURQLFKHIDYRUHQGRODGLPLVVLELOLWjGHOSD]LHQWHFKHSXzSURVHJXLUHOD
WHUDSLDLQIXVLYDDOSURSULRGRPLFLOLRRLQDPELHQWHGLUHVLGHQ]DDVVLVWLWD3DUWLFRODUHDWWHQ]LRQHq
VWDWDULYROWDDOSD]LHQWHDIIHWWRGDILEURVLFLVWLFDDGXOWRHLQHWjSHGLDWULFDLQOLQHDFRQO¶RELHWWLYR
GHILQLWR GDOOH GXH D]LHQGH VDQLWDULH SURYLQFLDOL GL IRUPXODUH XQ SHUFRUVR LQWHUD]LHQGDOH FKH
SHUPHWWD OD GHRVSHGDOL]]D]LRQH DWWUDYHUVR OD JHVWLRQH GL WUDWWDPHQWL DQWLELRWLFL LQLHWWLYL D
GRPLFLOLR,QSUHYLVLRQHGHOODGLPLVVLRQHGHOSD]LHQWHSRUWDWRUHGL3,&&HGHOO¶XWLOL]]RGHOFDWHWHUH
LQ DPELHQWH GRPLFLOLDUH O¶LQIHUPLHUH HVSHUWR HGXFD LO SD]LHQWH R LO FDUH JLYHU H LQWHUDJLVFH FRQ L
SURIHVVLRQLVWLFKHVHJXLUDQQRLOSD]LHQWHDOGRPLFLOLR
y FRQVXOHQ]D LQIHUPLHULVWLFD LQ ZRXQG FDUH O¶LQIHUPLHUH HVSHUWR HIIHWWXD OD FRQVXOHQ]D SHU OD
YDOXWD]LRQH H LO WUDWWDPHQWR GHOOH IHULWH GLIILFLOL H IRUQLVFH LQGLFD]LRQL SHU LO FRUUHWWR XWLOL]]R GHOOH
PHGLFD]LRQLVSHFLDOLHDYDQ]DWH,OFRQVXOHQWHLQIHUPLHUHSDUWHFLSDDOODGHILQL]LRQHGHOSHUFRUVRGL
GLPLVVLRQH LQGLYLGXDQGR WUD OH GLYHUVH RSSRUWXQLWj GL FXUD RVSHGDOLHUH H WHUULWRULDOL TXHOOD SL
LGRQHD D JDUDQWLUH OD FRQWLQXLWj GHOOH FXUH /D UHWH FRVWLWXLWD FRQ JOL LQIHUPLHUL GHOOH FXUH
GRPLFLOLDUL H FRQ L PHGLFLGL PHGLFLQD JHQHUDOH VLqFRQVROLGDWD QHOWHPSR IDFLOLWDQGR OD JHVWLRQH
GRPLFLOLDUH GL SD]LHQWL FRPSOHVVL OLPLWDQGR LO ULFRUVR DOO¶RVSHGDOL]]D]LRQH 8WLOH D WDO ILQH OD
SRVVLELOLWj GL DFFHVVR DOO¶$PEXODWRULR 9XOQRORJLFRGRYH YLHQH JDUDQWLWD OD FRQVXOHQ]D GHO WHDP GL
HVSHUWL
y FRQVXOHQ]DLQIHUPLHULVWLFDSHUODJHVWLRQHHODFXUDGHOSD]LHQWHSRUWDWRUHGLVWRPLDODFRQVXOHQ]D
GHOO¶LQIHUPLHUHVSHFLDOLVWDVXSSRUWDLFROOHJKLGHOOH8QLWj2SHUDWLYHQHOODGHILQL]LRQHGHJOLRELHWWLYL
DVVLVWHQ]LDOL LQWURGXFHQGR SULQFLSL GL EHVW SUDFWLFH SHU OD PLJOLRU FXUD GHO SD]LHQWH VWRPL]]DWR
1HOODIDVHGLGLPLVVLRQHLOSHUFRUVRHGXFDWLYRULYROWRDOSD]LHQWHHDOFDUHJLYHUYLHQHVYLOXSSDWR
DIIURQWDQGR L WHPL LQHUHQWL OD JHVWLRQH GHOOD VWRPLD H GHOOH SRVVLELOL FRPSOLFDQ]H O¶XWLOL]]R GHL
SUHVLGLO¶HGXFD]LRQHDOLPHQWDUH,OSHUFRUVRSURVHJXHQHOO¶DWWLYLWjGLFRQVXOHQ]DDPEXODWRULDOHFXL
DFFHGH LO SD]LHQWH GRSR OD GLPLVVLRQH H OD FRQGLYLVLRQH GHO SLDQR DVVLVWHQ]LDOH FRQ JOL LQIHUPLHUL
GHOWHUULWRULRFKHSURJUHVVLYDPHQWHDVVXPRQRODJHVWLRQHGHOO¶DVVLVWHQ]DDOSD]LHQWH
y FRQVXOHQ]D LQIHUPLHULVWLFD SHU LO SD]LHQWH GLDEHWLFR O¶DWWLYLWj GL FRQVXOHQ]D LQIHUPLHULVWLFD VL q
FRQVROLGDWDQHOFRUVRGHOFRQO¶DSHUWXUDGHO&HQWURSHUOD&XUDGHO'LDEHWHFIULOSDUDJUDIR
GHGLFDWRQHOFDSLWROR/DQXRYDVWUXWWXUDKDLQFLVRSRVLWLYDPHQWHVXOODPRGDOLWjGLJHVWLRQHGHO
SD]LHQWHGLDEHWLFRUDIIRU]DQGRO¶DWWLYLWjGLFRQVXOHQ]DGHJOLLQIHUPLHULHVSHUWLYHUVRLFROOHJKLGHOOH
8QLWj 2SHUDWLYH DO ILQH GL XQLIRUPDUH OH FXUH GHO SD]LHQWH GLDEHWLFR VHFRQGR SULQFLSL GL EXRQD
SUDWLFD /D FRQVXOHQ]D q VWDWD LQROWUH LQGLUL]]DWD DOOD UHDOL]]D]LRQH GHO SHUFRUVR HGXFDWLYR GHO
SD]LHQWH H GHO FDUH JLYHU FRQ O¶RELHWWLYR GL UHQGHUH DXWRQRPR LO SD]LHQWH QHOOD JHVWLRQH GHL
WUDWWDPHQWL H GHOOH SUHVFUL]LRQL DIIURQWDQGR WHPL GL FDUDWWHUH WHFQLFRSUDWLFR VXOOD
VRPPLQLVWUD]LRQH GHOOD WHUDSLD H DVSHWWL OHJDWL DOOR VWLOH GL YLWD /¶DWWLYLWj HGXFDWLYD SURVHJXH
y
GRSRODGLPLVVLRQHGHOSD]LHQWHSUHYDOHQWHPHQWHLQGLUL]]DWDDOODFRQRVFHQ]DGHOODPDODWWLDHDOOH
SUHYHQ]LRQH GHOOH VXH FRPSOLFDQ]H /¶LQIHUPLHUH HVSHUWR VL UHOD]LRQD FRQ OD UHWH WHUULWRULDOH SHU
JDUDQWLUH OD SURVHFX]LRQH GHO SHUFRUVR H LQGLYLGXDWD OD VWUXWWXUD FKH SUHQGHUj LQ FDULFR LO
SD]LHQWH DVVLFXUD OD SURJUDPPD]LRQH GHOOD SULPD YLVLWD /H FXUH LQIHUPLHULVWLFKH GHGLFDWH DO
SD]LHQWH GLDEHWLFR VL DYYDOJRQR LQROWUH GHOOD FRQVXOHQ]D GHOO¶LQIHUPLHUH HVSHUWR QHOOD FXUD GHO
SLHGHGLDEHWLFRDOILQHGHOWUDVIHULPHQWRQHOODSUDWLFDGHOOHPLJOLRULFRQRVFHQ]HVFLHQWLILFKHLQWHPD
GLSUHYHQ]LRQHHFXUD
FRQVXOHQ]D LQIHUPLHULVWLFD SHU O¶DVVLVWHQ]D DO SD]LHQWH LQ QXWUL]LRQH DUWLILFLDOH OD FRQVXOHQ]D
LQIHUPLHULVWLFD VL UHDOL]]D LQ DPELWR RVSHGDOLHUR GRPLFLOLDUH DPEXODWRULDOH H DWWUDYHUVR FRQWDWWL
WHOHIRQLFL /D PROWHSOLFLWj GHJOL DSSURFFL KD OR VFRSR GL JDUDQWLUH XQD ULVSRVWD WHPSHVWLYD H
FRPSHWHQWH DJOL LQIHUPLHUL FKH QHFHVVLWDQR GHOO¶LQWHUYHQWR GHO FROOHJD HVSHUWR SHU JDUDQWLUH XQD
ULVSRVWDDVVLVWHQ]LDOHLGRQHDDLELVRJQLGHOSD]LHQWH,O&HQWURGL1XWUL]LRQH$UWLILFLDOHIRUQLVFHXQ
VXSSRUWR VSHFLDOLVWLFR DL SURIHVVLRQLVWL GHOOH 8QLWj 2SHUDWLYH FKH DVVLVWRQR SD]LHQWL VRWWRSRVWL D
QXWUL]LRQHDUWLILFLDOHSHUYLDHQWUDOHRSDUHQWHUDOHDSSURIRQGHQGRDUJRPHQWLOHJDWLDOODJHVWLRQH
GHOOD QXWUL]LRQH DOOD SUHYHQ]LRQH GHOOH FRPSOLFDQ]H H IDYRUHQGR OD GLIIXVLRQH H O¶DGR]LRQH GL
SURFHGXUHEDVDWHVXOOHHYLGHQ]HVFLHQWLILFKH
*OLLQWHUYHQWLVRQRLQGLUL]]DWLSUHYDOHQWHPHQWHDJOLLQIHUPLHULPDVLULYROJRQRDQFKHDOO¶XWHQWHHDL
FDUH JLYHU SHU IDYRULUH OR VYLOXSSR GHOO¶DXWRQRPLD QHOOD JHVWLRQH GHOOD QXWUL]LRQH DUWLILFLDOH ,O
FRQVXOHQWHLQIHUPLHUHLQWHUYLHQHQHOSHUFRUVRGLGLPLVVLRQHGHOSD]LHQWHSHUJDUDQWLUHODFRQWLQXLWj
DVVLVWHQ]LDOH RVSHGDOH±WHUULWRULR H VL LQWHJUD FRQ LO VHUYL]LR WHUULWRULDOH FKH SUHQGH LQ FDULFR LO
SD]LHQWH DO GRPLFLOLR , SULQFLSDOL GDWL GHOO¶DWWLYLWj VYROWD GDO &HQWUR GL 1XWUL]LRQH $UWLILFLDOH QHO
FRUVRGHOLQGLFDQRLOJUDGLPHQWRHO¶XWLOLWjGHOVHUYL]LRRIIHUWR
ŽŶƐƵůĞŶnjĞ ĞĨĨĞƚƚĂƚĞ ƉĞƌ ĐŽŶƚƌŽůůŝ ƉŽƐŝnjŝŽŶĂŵĞŶƚŽ
W' ;WĞƌĐƵƚĂŶĞŽƵƐ ĞŶĚŽƐĐŽƉŝĐ ŐĂƐƚƌŽƐƚŽŵLJͿ
ĐŽŵƉůŝĐĂŶnjĞ ƐƚŽŵĂůŝ͕ ĐŽŵƉůŝĐĂŶnjĞ ŵĞĐĐĂŶŝĐŚĞ ĚĞůůĂ
ƐŽŶĚĂƉĞƌĂůŝŵĞŶƚĂnjŝŽŶĞ͕ĞĐĐ͘
ƚƚŝǀĂnjŝŽŶĞ Ěŝ ƉĞƌĐŽƌƐŝ ĚŽŵŝĐŝůŝĂƌŝ ƉĞƌ ůĂ ƉƌĞƐĂ ŝŶ
ĐĂƌŝĐŽĚŝƉĂnjŝĞŶƚŝŝŶŶƵƚƌŝnjŝŽŶĞĞŶƚƌĂůĞ
ƚƚŝǀĂnjŝŽŶĞ Ěŝ ƉĞƌĐŽƌƐŝ ĚŽŵŝĐŝůŝĂƌŝ ƉĞƌ ůĂ ƉƌĞƐĂ ŝŶ
ĐĂƌŝĐŽĚŝƉĂnjŝĞŶƚŝŝŶŶƵƚƌŝnjŝŽŶĞƉĂƌĞŶƚĞƌĂůĞ
Ϯϭϱϵ
ϭϳϱ
ϲϭ
/¶,QIHUPLHUHQHOSHUFRUVRGLGRQD]LRQHHWUDSLDQWRGLRUJDQL
/D JHVWLRQH GHO SURFHVVR GL GRQD]LRQH H WUDSLDQWR GL UHQH H UHQHSDQFUHDV KD ULFKLHVWR XQD IRUWH
LQWHJUD]LRQH GHOOH 8QLWj 2SHUDWLYH GL 1HIURORJLD 7UDSLDQWL H &OLQLFD &KLUXUJLD H 7UDSLDQWL G¶2UJDQR
IDYRUHQGR QHO FRQWHPSR OR VYLOXSSR H O¶DFTXLVL]LRQH GL FRPSHWHQ]H GLVWLQWLYH GHL SURIHVVLRQLVWL *OL
LQIHUPLHUL DQFKH DWWUDYHUVR SHUFRUVL DFFDGHPLFL KDQQR DFTXLVLWR FRQRVFHQ]H FRPSHWHQ]H HG DELOLWj
WHFQLFR±UHOD]LRQDOLXWLOLSHUSLDQLILFDUHJHVWLUHHYDOXWDUHLOSURFHVVRDVVLVWHQ]LDOHOHJDWRDOODGRQD]LRQHH
DOWUDSLDQWRGLRUJDQL/¶DWWULEX]LRQHDOO¶LQIHUPLHUHGLIXQ]LRQLVSHFLILFKHQHOODJHVWLRQHGHOOD/LVWD7UDSLDQWL
HQHOODJHVWLRQHGHOSHUFRUVRGLGRQD]LRQHGDYLYHQWHHGDFDGDYHUHKDSHUPHVVRODYDORUL]]D]LRQHGHOOH
FRPSHWHQ]H GLVWLQWLYH DSSUHVH DWWUDYHUVR OD IRUPD]LRQH H FRQWULEXLWR DO PLJOLRUDPHQWR GHL SHUFRUVL
DVVLVWHQ]LDOL GL LQVHULPHQWR LQ OLVWD G¶DWWHVD SHU WUDSLDQWR H GHL SURFHVVL RSHUDWLYL OHJDWL DOOD UHWH
WUDSLDQWRORJLFDUHJLRQDOHHQD]LRQDOH/¶LQIHUPLHUHHVSHUWRqVWDWRLQVHULWRQHOO¶qTXLSHPXOWLSURIHVVLRQDOH
3DUWHFLSDQGR DWWLYDPHQWH DOOH SURFHGXUH GL LQGLYLGXD]LRQH VHOH]LRQH H PDQWHQLPHQWR GHL GRQDWRUL H
DOO¶HODERUD]LRQH GHL SHUFRUVL DVVLVWHQ]LDOL SUH H SRVWWUDSLDQWR SURPXRYH LQ FROODERUD]LRQH FRQ
QHIURORJR FKLUXUJR JHQHWLVWD H SVLFRORJR O¶HGXFD]LRQH WHUDSHXWLFD GHOOD SHUVRQD DVVLVWLWD H GHOOD VXD
IDPLJOLDPLJOLRUDQGRODSUHVDLQFDULFRJOREDOHGHOO¶DVVLVWLWR3DUWLFRODUPHQWHLQWHQVDO¶DWWLYLWjGHGLFDWDDOOD
GRQD]LRQHHDOWUDSLDQWRGDGRQDWRUHYLYHQWHQHOFRUVRGHOVRQRVWDWHYDOXWDWHFRSSLHVRQR
VWDWLLWUDSLDQWLUHDOL]]DWL
/D5DGLRSURWH]LRQHQHLSD]LHQWLLQHWjSHGLDWULFD
, SD]LHQWL SHGLDWULFL VRQR PDJJLRUPHQWH VRJJHWWL DL ULVFKL GHULYDQWL GDOO¶HVSRVL]LRQH DOOH UDGLD]LRQL
LRQL]]DQWL ULVSHWWR DJOL DGXOWL 3HU L SD]LHQWL HVSRVWL SHU VFRSL PHGLFL GLYHQWD GXQTXH SDUWLFRODUPHQWH
QHFHVVDULD XQ¶RWWLPL]]D]LRQH GHJOL HVDPL LQ WHUPLQL GL UDGLRSURWH]LRQH LQ SDUWLFRODUH OD 7RPRJUDILD
&RPSXWHUL]]DWD 7& q OD PHWRGLFD LQ FXL OH GRVL GL UDGLD]LRQL ULFHYXWH GDL SD]LHQWL ULVXOWDQR PDJJLRUL
ULVSHWWR D TXHOOH GHJOL HVDPL UDGLRORJLFL FRQYHQ]LRQDOL /D VWUHWWD FROODERUD]LRQH H OD VLQHUJLD WUD L
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
FRPSRQHQWL GHO WHDP PXOWLSURIHVVLRQDOH GHOOD 5DGLRORJLD 3HGLDWULFD )LVLFL 5DGLRORJL 3HGLDWULFL 7HFQLFL
6DQLWDUL GL 5DGLRORJLD 0HGLFD KD SRUWDWR DOOD UHDOL]]D]LRQH GL XQR VWXGLR SHU OD YHULILFD GHL SDUDPHWUL
WHFQLFLG¶HVHFX]LRQHGHJOLHVDPLHODSRVVLELOLWjGLLPSOHPHQWDUHPRGDOLWjGLDFTXLVL]LRQHHULFRVWUX]LRQH
FKHSXUULGXFHQGRODGRVHDOLYHOOLWDQWREDVVLTXDQWRUDJLRQHYROPHQWHSRVVLELOHFRQVHQWLVVHGLRWWHQHUH
ODPLJOLRUHGRFXPHQWD]LRQHLFRQRJUDILFDSHUOHSUHVWD]LRQLHURJDWH6RQRVWDWLGHILQLWLSURWRFROOLGLVWXGLR
LQ FXL L YDORUL GL &7',YRO 9ROXPH &RPSXGHW 7RPRJUDSK\ 'RVH ,QGH[ '/3 'RVH /HQJWK 3URGXFW H
'RVH HIILFDFH RYYHUR LQGLFDWRUL QXPHULFL GHOOD GRVH DO EDPELQR KDQQR ULVSHWWLYDPHQWH VXELWR ULGX]LRQL
ILQR DO ULVSHWWR DO JUXSSR GL FRQIURQWR SUHRWWLPL]]D]LRQH , YDORUL RWWHQXWL ULVXOWDQR
HVVHUH FRQIURQWDELOL FRQ L YDORUL HXURSHL LQ SDUWLFRODUH FRQ TXHOOL WHGHVFKL H PHGLDQWH LO SURFHVVR GL
RWWLPL]]D]LRQHqVWDWRSRVVLELOHRWWHQHUHXQ¶LPSRUWDQWHULGX]LRQHGHOODGRVHHURJDWDDSD]LHQWLSHGLDWULFL
VRWWRSRVWLDGHVDPL&7ERG\HVLqHYLGHQ]LDWDO¶LPSRUWDQ]DGHOO¶XWLOL]]RGLVLVWHPLGLULGX]LRQHGHOODGRVH
,O7HFQLFRGL/DERUDWRULRQHOOD5HWHSHUODFXUDGHOO¶(PRILOLDHGHOOH0DODWWLH
(PRUUDJLFKH&RQJHQLWH0(&
/D IXQ]LRQH GL &HQWUR GL 5LIHULPHQWR 5HJLRQDOH SHU OD &XUD GHOO¶(PRILOLD H GHOOH 0(& DWWULEXLWD GDOOD
5HJLRQHDOO¶$]LHQGDGDOKDULFKLHVWRO¶XWLOL]]RGLWHFQLFKHGLODERUDWRULRDOWDPHQWHVSHFLDOLVWLFKHXWLOL
SHU OD GHWHUPLQD]LRQH GHL IDWWRUL GHOOD FRDJXOD]LRQH H OD WLWROD]LRQH GHJOL LQLELWRUL 7DOL SUHVWD]LRQL
ULFKLHGRQR DL 7HFQLFL GL /DERUDWRULR 76/% XQ SHUFRUVR GL IRUPD]LRQH H DGGHVWUDPHQWR SDUWLFRODUPHQWH
FRPSOHVVR SHU SHUPHWWHUH O¶DFTXLVL]LRQH GHOOH DELOLWj H GHOO¶HVSHULHQ]D QHFHVVDULH SHU O¶HVHFX]LRQH GHOOH
SURFHGXUD GLDJQRVWLFKH XWLOL SHU OD GLDJQRVL H LO WUDWWDPHQWR GHOOH 0(& /D GLDJQRVWLFD XWLOL]]DWD LQIDWWL
KD FDUDWWHULVWLFKH GL SDU]LDOH DXWRPD]LRQH H ULFKLHGH XQD DOWLVVLPD VSHFLDOL]]D]LRQH SHU LO VXR IRUWH
LPSDWWR PDQXDOH /¶DWWLYLWj GL ODERUDWRULR SHU LO GRVDJJLR GHL IDWWRUL GHOOD FRDJXOD]LRQH H GL ULFHUFD
GHOO¶LQLELWRUH q LQROWUH IRQGDPHQWDOH SHU XQD FRUUHWWD GLDJQRVL H SHU XQ DGHJXDWR PRQLWRUDJJLR GHOOD
WHUDSLD VRVWLWXWLYD VRSUDWWXWWR LQ FRUVR GL HPRUUDJLH JUDYL H GL LQWHUYHQWL FKLUXUJLFL 1HO FRUVR GHO VRQR VWDWL DWWLYDWL QXPHURVL SHUFRUVL GL DGGHVWUDPHQWR SHU L 76/% VLQR D UDGGRSSLDUH LO QXPHUR GHL
SURIHVVLRQLVWL FRQ FRPSHWHQ]H GLVWLQWLYH 7DOH D]LRQH KD FRQVHQWLWR GL PLJOLRUDUH LO SHUFRUVR GL FXUD GHL
SD]LHQWL /¶LQFUHPHQWR GHOO¶DWWLYLWj GL PRQLWRUDJJLR DJLVFH LQIDWWL VXOOD GXUDWD GHOO¶RVSHGDOL]]D]LRQH H
RWWLPL]]DLOFRQVXPRGHLIDUPDFL
6LVWHPDGLYDOXWD]LRQHGHOOHFRPSHWHQ]HHVLVWHPL
SUHPLDQWL
6LVWHPDG¶LQFHQWLYD]LRQHGHOSHUVRQDOHGLULJHQWH
/D UHWULEX]LRQH GL ULVXOWDWR SHU LO SHUVRQDOH GLULJHQWH q EDVDWD VX SULQFLSL GHILQLWL GDOOD FRQWUDWWD]LRQH
FROOHWWLYD QD]LRQDOH H LQ DPELWR D]LHQGDOH q VWUHWWDPHQWH FRUUHODWD DOOD UHDOL]]D]LRQH GHJOL RELHWWLYL
VSHFLILFL GHL 'LSDUWLPHQWL H GHOOH 6WUXWWXUH 2UJDQL]]DWLYH $]LHQGDOL SUHILVVDWL H FRQFRUGDWL FRQ L'LUHWWRUL
GHL'LSDUWLPHQWLLQVHGHGLQHJR]LD]LRQHGLEXGJHWSHUO¶DQQR
3HUO¶DQQRqVWDWRFRQIHUPDWRO¶LPSLDQWRJHQHUDOHGHOODUHWULEX]LRQHGLULVXOWDWRFRVuFRPHGHOLQHDWR
QHLSUHFHGHQWLDFFRUGLD]LHQGDOLGDOO¶DQQRULEDGHQGRLVHJXHQWLFULWHULJHQHUDOL
D GHILQL]LRQHGLXQVLVWHPDSUHPLDQWHFROOHJDWRDOUDJJLXQJLPHQWRGHJOLRELHWWLYLGLqTXLSHDVVHJQDWL
DOOH DUWLFROD]LRQL D]LHQGDOL GLSDUWLPHQWL H DOOH VWUXWWXUH RUJDQL]]DWLYH VWUXWWXUH FRPSOHVVH H
VWUXWWXUH VHPSOLFL WHQXWR FRQWR GHOOH ULVRUVH DVVHJQDWH VHFRQGR L ULVXOWDWL SUHILVVDWL LQ RFFDVLRQH
GHOODQHJR]LD]LRQHGLEXGJHW
E SURFHVVR D FDVFDWD QHOO¶DWWULEX]LRQH GHJOL RELHWWLYL LQ UHOD]LRQH DOOH UHVSRQVDELOLWj JHVWLRQDOL
LQGLYLGXDWHQHOO¶DPELWRGHOO¶RUJDQL]]D]LRQHD]LHQGDOH
F DWWULEX]LRQHGLRELHWWLYLGLqTXLSHFRQQHVVLDOODUHWULEX]LRQHGLULVXOWDWR
G LQIRUPD]LRQH H FRPXQLFD]LRQH GHJOL RELHWWLYL GL qTXLSH LQ DPELWR GLSDUWLPHQWDOH H QHOOH VLQJROH
VWUXWWXUH RUJDQL]]DWLYH DO ILQH GL DFTXLVLUH XQD FDSLOODUH SDUWHFLSD]LRQH GL WXWWL L GLULJHQWL DOOD
UHDOL]]D]LRQHGHJOLRELHWWLYLDVVHJQDWLFRQOHHYLGHQ]HQHFHVVDULH
H FKLDUH]]DHWUDVSDUHQ]DFRQULIHULPHQWRDOULVXOWDWRDWWHVRDJOLLQGLFDWRULDOOHPRGDOLWjHVWUXPHQWL
SHUODYHULILFD
YDOXWD]LRQH GHL GLUHWWRUL GL GLSDUWLPHQWR H GHL GLUHWWRUL GHOOH VWUXWWXUH RUJDQL]]DWLYH VXOOH PRGDOLWj
DGRWWDWH QHOSURFHVVR GL UDVVHJQD]LRQH GHJOL RELHWWLYL VXO ULVSHWWR GHLWHPSLGHILQLWL GDOOD 'LUH]LRQH
$]LHQGDOHVXOO¶LQYLRGHOOHHYLGHQ]HQHFHVVDULH
*OL RELHWWLYL GL EXGJHW FKH DVVXPRQR ULOLHYR DL ILQL GHOO¶LQFHQWLYD]LRQH VRQR GHILQLWL FRQ ULIHULPHQWR
DOOHVSHFLILFKHDUHHGLDWWLYLWjVRWWRHOHQFDWHHULSRUWDWHQHOOHVFKHGHGLEXGJHW
3URGX]LRQH
*RYHUQR(FRQRPLFR
,QYHVWLPHQWL
&RVWLWXLVFRQR DOWUHVu RELHWWLYL LQGLYLGXDOL GHL 'LUHWWRUL GL 'LSDUWLPHQWR OH PRGDOLWj DGRWWDWH QHO
SURFHVVRGLDVVHJQD]LRQHGHJOLRELHWWLYLLOULVSHWWRGHLWHPSLGHILQLWLGDOOD'LUH]LRQH$]LHQGDOHO¶LQYLR
GHOOH HYLGHQ]H QHFHVVDULH OD YHULILFD GHOO¶DQGDPHQWR H FRQVHJXLPHQWR GHJOL RELHWWLYL QHJR]LDWL LQ
VHGH GL EXGJHW H RJJHWWR GL LQFHQWLYD]LRQH FKH VL HVSOLFD PHGLDQWH O¶HIIHWWXD]LRQH GL LQFRQWUL
GLUH]LRQDOL FRQ LO &RQWUROOR GL *HVWLRQH FRQ SDUWLFRODUH ULIHULPHQWR DG RELHWWLYL ULWHQXWL FULWLFL H
PHGLDQWH O¶HYHQWXDOH LQROWUR GL UHOD]LRQL HVSOLFDWLYH ULFKLHVWH GDOOD 'LUH]LRQH $]LHQGDOH LQ FDVR GL
PDQFDWRFRQVHJXLPHQWR
$QFKHSHUL'LUHWWRULGLVWUXWWXUDFRPSOHVVDHVHPSOLFHFRVWLWXLVFRQRRELHWWLYLLQGLYLGXDOLOHPRGDOLWj
DGRWWDWH QHO SURFHVVR GL DVVHJQD]LRQH GHJOL RELHWWLYL LO ULVSHWWR GHL WHPSL GHILQLWL GDOOD 'LUH]LRQH
$]LHQGDOHO¶LQYLRGHOOHHYLGHQ]HQHFHVVDULH
&RQ ULIHULPHQWR DO 6HUYL]LR GL JXDUGLD O¶RELHWWLYR GL PDQWHQLPHQWR GHOOD FRQWLQXLWj DVVLVWHQ]LDOH
UDSSUHVHQWD RELHWWLYR VWUDWHJLFR LQGLYLGXDOH GL WXWWL L GLULJHQWL PHGLFL LO FXL FRQVHJXLPHQWR Gj WLWROR
DOO¶HURJD]LRQHGLTXRWHGLLQFHQWLYR
,O SURFHVVR GL DWWULEX]LRQH GHJOL RELHWWLYL VL UHDOL]]D DQQXDOPHQWH DWWUDYHUVR OD ³FDVFDWD´ GHOOH
UHVSRQVDELOLWj SDUWHQGR GDOOD FRQFHUWD]LRQH GHJOL RELHWWLYL GL qTXLSH WUD OD 'LUH]LRQH 6WUDWHJLFD
$]LHQGDOH H L 'LUHWWRUL GL 'LSDUWLPHQWR 6XFFHVVLYDPHQWH L 'LUHWWRUL GL 'LSDUWLPHQWR H D VFHQGHUH L
'LUHWWRUL GL 6WUXWWXUD FRPSOHVVD H GL VWUXWWXUD VHPSOLFH DWWUDYHUVR DSSRVLWL LQFRQWUL LQWHUQL
DWWULEXLVFRQRJOLRELHWWLYLDWXWWLLGLULJHQWLGLDIIHUHQ]D
/DSURPR]LRQHGHOFRQWULEXWRGLWXWWLLGLULJHQWLVLUHDOL]]DDWWUDYHUVRVSHFLILFKHULXQLRQLGHOOHTXDOLq
UHGDWWRYHUEDOHGDIDUSHUYHQLUHDOOD'LUH]LRQH$]LHQGDOHILQDOL]]DWRDOODUHGD]LRQHGHOOHHYLGHQ]HH
GDFXLDFTXLVLUHODIRUPDOHDFFHWWD]LRQHGHJOLRELHWWLYL
/D IDVH YDOXWDWLYD DYYLHQH D FRQVXQWLYR H FRQ FDGHQ]D DQQXDOH GD SDUWH GHOOD 'LUH]LRQH VWUDWHJLFD
D]LHQGDOH SHU WXWWL L GLULJHQWL FLUFD LO FRQVHJXLPHQWR GHJOL RELHWWLYL GL qTXLSH DVVHJQDWL DOOH
DUWLFROD]LRQLVWUXWWXUHGLULIHULPHQWRSHUL'LUHWWRULGL'LSDUWLPHQWRHGLVWUXWWXUDUHODWLYDPHQWHDJOL
RELHWWLYLLQGLYLGXDOLFRPHSLVRSUDGHFOLQDWL
,QVHFRQGDLVWDQ]DLO1XFOHRGL9DOXWD]LRQHYHULILFDODFRHUHQ]DHODFRUUHWWH]]DPHWRGRORJLFDGHOOD
YDOXWD]LRQHGLSULPDLVWDQ]DDOILQHGLDYYDORUDUQHO¶HVLWRGHILQLWLYR
,Q FDVR GL SDU]LDOH R PDQFDWR UDJJLXQJLPHQWR GHJOL RELHWWLYL GL qTXLSH GHILQLWL LQ VHGH GL EXGJHW H
FRUUHODWL DOOD UHWULEX]LRQH LQFHQWLYDQWH O¶DEEDWWLPHQWR GHOOD UHWULEX]LRQH GL ULVXOWDWR WHQXWR GHO
SUHYHQWLYR³ULVSHWWRGHOFLQJROR´ULVXOWD
− WRWDOHVHODSHUFHQWXDOHGLFRQVHJXLPHQWRqLQIHULRUHRSDULDO
− SDU]LDOHHSDULDOVHODSHUFHQWXDOHGLFRQVHJXLPHQWRqWUDH
− SDU]LDOH H SURSRU]LRQDOH DOOD SHUFHQWXDOH GL PDQFDWR UDJJLXQJLPHQWR VH LO FRQVHJXLPHQWR q WUD
H
− QXOORVHODSHUFHQWXDOHGLFRQVHJXLPHQWRqWUDH
/D FRUUHVSRQVLRQH GHOOH TXRWH LQGLYLGXDOL GL UHWULEX]LRQH DYYLHQH D FRQVXQWLYR GHL ULVXOWDWL WRWDOL R
SDU]LDOLUDJJLXQWL
/HTXRWHLQGLYLGXDOLVSHWWDQWLDFLDVFXQGLULJHQWHVRQRGLIIHUHQ]LDWHLQEDVHDLVHJXHQWLFULWHUL
D WLSRORJLH GHJOL LQFDULFKL GLULJHQ]LDOL SUHYLVWL QHOO¶DVVHWWR RUJDQL]]DWLYR D]LHQGDOH LQ FRQQHVVLRQH FRQ
XQFRHIILFLHQWHGHILQLWRSHURJQLWLSRORJLDGLLQFDULFR
E JUDGR GL UDJJLXQJLPHQWR GHJOL RELHWWLYL FRPSOHVVLYL GL qTXLSH YHULILFDWR D VHJXLWR GHO SURFHVVR
YDOXWDWLYR
3HU L 'LUHWWRUL GL 6WUXWWXUD &RPSOHVVD H 6HPSOLFH LO PDQFDWR UDJJLXQJLPHQWR GHOO¶RELHWWLYR LQGLYLGXDOH
LQHUHQWH OD UHDOL]]D]LRQH GHO SURFHVVR ³D FDVFDWD´ GL DVVHJQD]LRQH H FRPXQLFD]LRQH GHJOL RELHWWLYL QHOOH
VLQJROH VWUXWWXUH FRPSRUWD XQ DEEDWWLPHQWR LQGLYLGXDOH GHOOD UHWULEX]LRQH GL ULVXOWDWR LQ PLVXUD SDUL DO
GHOODTXRWDLQGLYLGXDOHVSHWWDQWH
/H TXRWH GHULYDQWL GDO PDQFDWR UDJJLXQJLPHQWR GHJOL RELHWWLYL GL qTXLSH VRQR ULDVVHJQDWH DO IRQGR GL
SHUWLQHQ]DSHUO¶DQQRVXFFHVVLYR
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
I
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
/H TXRWH LQGLYLGXDOL FKH VL OLEHUDQR LQ FRUVR G¶DQQR SHU HIIHWWR GHOOH DVVHQ]H SURGRWWHVL YHQJRQR
ULGLVWULEXLWHDOO¶pTXLSHGHOODVWHVVDVWUXWWXUDLQWHUPLQLSURSRU]LRQDOLDOODPDJJLRURPLQRUSUHVHQ]DJLRUQL
GLHIIHWWLYRVHUYL]LRDVVLFXUDWDGDFLDVFXQGLULJHQWH
3HU TXDQWR ULJXDUGD O¶LQGLYLGXD]LRQH GHOOH WLSRORJLH GL DVVHQ]D GDO VHUYL]LR YHQJRQR FRQIHUPDWH TXHOOH
XWLOL]]DWHHGHILQLWHQHOO¶DPELWRGHLSUHFHGHQWLDFFRUGLD]LHQGDOLIDWWDVDOYDO¶DVVHQ]DSHUPDODWWLDGRYXWD
DULFRYHURRVSHGDOLHURFKHDLILQLGHOODUHWULEX]LRQHGLULVXOWDWRYLHQHFRQVLGHUDWDFRPHSUHVHQ]D
, FULWHUL JHQHUDOL VRSUD GHFOLQDWL YHQJRQR HVWHVL DL 3URIHVVRUL H 5LFHUFDWRUL XQLYHUVLWDUL FKH VYROJRQR
DWWLYLWjDVVLVWHQ]LDOHSUHVVRO¶$]LHQGDLQDSSOLFD]LRQHGHJOLDUWWHGHO'/JV
6LVWHPDG¶LQFHQWLYD]LRQHGHOSHUVRQDOHGHOO¶DUHDFRPSDUWR
/DVHVVLRQHDQQXDOHGLFRQWUDWWD]LRQHLQWHJUDWLYDUHODWLYDPHQWHDOO¶LVWLWXWRGHOODSURGXWWLYLWjSHUO¶HVHUFL]LR
QHO IRUPDOL]]DUH LO VLVWHPD GL LQFHQWLYD]LRQH H FRQWHVWXDOPHQWH TXDQWLILFDUH OH ULVRUVH PHVVH D
GLVSRVL]LRQH SHU LO VLVWHPD SHU LO PHGHVLPR DQQR FRQIHUPD OD YDOLGLWj GHOO¶LPSLDQWR FRPSOHVVLYR JLj
GHOLQHDWR QHL SUHFHGHQWL DFFRUGL D]LHQGDOL VXOOD SURGXWWLYLWj FRUUHODQGR OD GLVWULEX]LRQH GHOOH ULVRUVH DOOD
UHDOL]]D]LRQHGHJOLRELHWWLYLJHQHUDOLGHOO¶D]LHQGDHILQDOL]]DQGROHDOULFRQRVFLPHQWRGHOO¶LPSHJQRLQGLYLGXDOH
LQ WHUPLQL GL SUHVHQ]D LQ VHUYL]LR SHU LO PDQWHQLPHQWR GHL OLYHOOL SUHVWD]LRQDOL TXDOLTXDQWLWDWLYL GL
FLDVFXQDXQLWjRSHUDWLYD
,O SHUFRUVR YDOXWDWLYR FRQQHVVR DJOL RELHWWLYL D]LHQGDOL SUHILVVDWL LQ VHGH GL QHJR]LD]LRQH GL EXGJHW SHU
O¶DQQRqFRVuVWUXWWXUDWR
y
GD SDUWH GHOOD 'LUH]LRQH 6WUDWHJLFD $]LHQGDOH SHU WXWWL JOL RSHUDWRUL GHO &RPSDUWR FLUFD LO
FRQVHJXLPHQWRGHJOLRELHWWLYLGLpTXLSHDVVHJQDWLDOOHDUWLFROD]LRQLGLULIHULPHQWR
y
GD SDUWH GHO 1XFOHR GL 9DOXWD]LRQH LQ VHFRQGD LVWDQ]D FKH YHULILFD OD FRHUHQ]D H OD FRUUHWWH]]D
PHWRGRORJLFDGHOODYDOXWD]LRQHGLSULPDLVWDQ]DDOILQHGLDYYDORUDUQHO¶HVLWRGHILQLWLYR
,OFRPSOHVVLYRSUHPLRGLSURGX]LRQHFRUUHODWRDOUDJJLXQJLPHQWRGHJOLRELHWWLYLq
y
SDU]LDOHHSURSRU]LRQDOHDOODSHUFHQWXDOHGLUDJJLXQJLPHQWRVHFRQVHJXLWLILQRDOO¶
y
WRWDOHVHFRQVHJXLWLWUDH
1HOO¶DQQR ROWUH DOOD UHPXQHUD]LRQH GHO SUHPLR GL SURGX]LRQH FRPH VRSUD GHOLQHDWR VRQR VWDWH
GHVWLQDWHULVRUVHSHULOILQDQ]LDPHQWRGLXOWHULRULPLVXUHSUHPLDQWLFRUUHODWHDGDWWLYLWjSURJHWWXDOLFRPHGL
VHJXLWRGHWWDJOLDWH
3URJHWWRPLVXUHGLYDORUL]]D]LRQHRSHUDWRUL&HQWURVHUYL]L
&RQ O¶LQWHVD VRWWRVFULWWD LQ GDWD UHFHSLWD FRQ GHOLEHUD]LRQH Q GHO LQ
FRQQHVVLRQH DOO¶DYYLR GHO SURFHVVR GL ULRUJDQL]]D]LRQH GHO &HQWUR 6HUYL]L H LQ FRQVLGHUD]LRQH GHO
FDPELDPHQWR GL DSSURFFLR DOO¶DWWLYLWj GL VSRUWHOOR DOOD ULFKLHVWD GL VYROJLPHQWR FRQ IOHVVLELOLWj GHOOH
FRPSHWHQ]HGLFLDVFXQRSHUDWRUHLQIXQ]LRQHGHOOHHVLJHQ]HGHOVHUYL]LRDOO¶XWHQ]DVRQRVWDWHLQGLYLGXDWH
PLVXUH SUHPLDQWL SHU JOL RSHUDWRUL FROODERUDWRUL WHFQLFL DVVLVWHQWL WHFQLFL DVVLVWHQWL DPPLQLVWUDWLYL H
RSHUDWRULWHFQLFLDIIHUHQWLDO&HQWUR6HUYL]LGLUHWWHDOUDJJLXQJLPHQWRGHLVHJXHQWLRELHWWLYL
y
DVVLFXUDUHIOHVVLELOLWjGHOOHIXQ]LRQLGLVSRUWHOOR
y
JDUDQWLUH OD IRUPD]LRQH SHU OR VYROJLPHQWR GL DWWLYLWj GL VXSSRUWR DOOD OLEHUD SURIHVVLRQH H SL LQ
JHQHUDOHSHUORVYROJLPHQWRGLWXWWHOHDWWLYLWjFRQQHVVHDOOHSUHVWD]LRQL
/¶DFFHVVRDOSUHPLRULJXDUGDWXWWLJOLRSHUDWRULFKHDEELDQRDYXWRXQUDSSRUWRGLODYRURFRQO¶$]LHQGDQHO
SHULRGR LQGLFDWR HG DVVHJQDWL DO &HQWUR 6HUYL]L OH TXRWH LQFHQWLYDQWL FRUUHODWH DO SUHPLR YHQJRQR
UDSSRUWDWHDOODSUHVHQ]DLQVHUYL]LRQHOSHULRGRLQGLFDWRHVDUDQQRHURJDWHLQEDVHDOUDJJLXQJLPHQWRGHO
ULVXOWDWR DWWHVR DVVLFXUDUH OD SUHVHQ]D LQ VHUYL]LR D JDUDQ]LD GHOOD LQWHUVFDPELDELOLWj GHOOH IXQ]LRQL GL
VSRUWHOOR RPRJHQHLWjGLWXUQLVWLFD HG HTXLGLVWULEX]LRQH WUD JOLRSHUDWRUL GHOOHIDVFH SUHYLVWH± SRPHULJJL
VDEDWR
3URJHWWR3UHPLRSUHVHQ]DDQQR
&RQ O¶LQWHVD VRWWRVFULWWD LQ GDWD UHFHSLWD FRQ GHOLEHUD]LRQH Q GHO OH SDUWL
KDQQRFRQYHQXWRGLLQGLYLGXDUHPLVXUHSUHPLDQWLFRUUHODWHDOODUHDOL]]D]LRQHGLXQSURJHWWRGLSURGXWWLYLWj
ILQDOL]]DWRDYDORUL]]DUHLOSHUVRQDOHDVVLVWHQ]LDOHLQFRQQHVVLRQHDOODSUHVHQ]DDVVLFXUDWDLQVHUYL]LR
, SURIHVVLRQLVWL FRLQYROWL VRQR LQIHUPLHUL RVWHWULFKH LQIHUPLHUL SHGLDWULFL H JHQHULFL WHFQLFL GL UDGLRORJLD H
ODERUDWRULR 27$266 DXVLOLDUL H RSHUDWRUL VTXDGUD WUDVSRUWR HVDPL VLD D WHPSR LQGHWHUPLQDWR FKH D
WHPSR GHWHUPLQDWR FRPDQGL LQ HQWUDWD H DVVHJQD]LRQL WHPSRUDQHH LQ HQWUDWD FKH SUHVWDQR DWWLYLWj VX
WXUQL + H + H FKH DEELDQR HIIHWWXDWR XQ PLQLPR GL JLRUQL GL SUHVHQ]D QHO SHULRGR GL GXUDWD GHO
SURJHWWRFLRqGDODO
1HOO¶DPELWR GHL SURIHVVLRQLVWL FRLQYROWL KDQQR DFFHVVR DO SUHPLR WXWWL JOL RSHUDWRUL FKH DEELDQR DYXWR XQ
UDSSRUWRGLODYRURFRQO¶$]LHQGDQHOFRUVRGHOO¶DQQRVXSHULRUHRXJXDOHDJLRUQL
/H TXRWH LQFHQWLYDQWL VRQR VWDELOLWH LQ PLVXUD GLIIHUHQ]LDWD LQ UHOD]LRQH DOOD FDWHJRULD GL DSSDUWHQHQ]D H
VRQRHURJDWHDFRQVXQWLYRSUHYLDYHULILFDGHOO¶HIIHWWLYDFRQVHJXLPHQWRGHOULVXOWDWRDWWHVRVRSUDLQGLFDWR
DFFHUWDWRPHGLDQWHO¶LQGLFDWRUHLQGLYLGXDWRGLQXPHURGLJLRUQLGLSUHVHQ]DGHILQLWRQHOO¶DFFRUGR
3URJHWWRLQWHJUD]LRQHGLVDJLRSURQWDGLVSRQLELOLWjSHULOSHUVRQDOHDIIHUHQWHDLFRPSDUWLRSHUDWRUL
&RQ LO YHUEDOH GL DFFRUGR VRWWRVFULWWR LO UHFHSLWR FRQ GHOLEHUD]LRQH Q GHO FRQVLGHUDWRFKH
y
O¶DWWLYLWjVYROWDGXUDQWHODUHSHULELOLWjSHUFKpKDFDUDWWHULVWLFKHGLXUJHQ]DHGHPHUJHQ]DQHFHVVLWDGL
XQDIRUPD]LRQHHGDGGHVWUDPHQWRVROLWDPHQWHOXQJRDQFKHPHVL
y
ODFDOHQGDUL]]D]LRQHGHOOHUHSHULELOLWjVHJXHXQDQGDPHQWRDQQXDOHFKHYHGHXQLQFUHPHQWRGXUDQWHL
PHVL HVWLYL D FDXVD GHOOD IUXL]LRQH GHO GLULWWR GHOOH IHULH HG XQ GHFUHPHQWR QHL PHVL LQYHUQDOL GRYH q
SUHYLVWDODPDVVLPDSUHVHQ]DGLSHUVRQDOH
y
OH QHFHVVLWj DVVLVWHQ]LDOL GL DOFXQL FRPSDUWL RSHUDWRUL SUHYHGRQR XQ QXPHUR GL SHUVRQDOH FKH QRQ
FRQVHQWH GL VYROJHUH LQ PRGR DXWRQRPR LO QXPHUR GL UHSHULELOLWj FRQWUDWWXDOPHQWH GHILQLWH DQFKH D
SLHQRRUJDQLFRQRQFRQVHQWHQGRFRPXQTXHXQDLQWHJUD]LRQHWUDSLFRPSDUWLVLDSHUOHFRPSHWHQ]H
SURIHVVLRQDOLVLDSHUOHFROORFD]LRQLORJLVWLFKHHLYLQFROLRUJDQL]]DWLYL
/H SDUWL KDQQR FRQYHQXWR GL LQGLYLGXDUH PLVXUH SUHPLDQWL YROWH D OLPLWDUH LO YHULILFDUVL GL VLWXD]LRQL GL
FULWLFLWj SUHYHGHQGR OD UHPXQHUD]LRQH GHL SURIHVVLRQLVWL LQIHUPLHUL GHL FRPSDUWL RSHUDWRUL FKH KDQQR
HIIHWWXDWRXQQXPHURGLSURQWHGLVSRQLELOLWjVXSHULRULDQHOO¶DQQR
)RUPD]LRQH
,GDWLGLDWWLYLWj
/¶DWWLYLWj IRUPDWLYD (&0 HURJDWD GDOO¶$]LHQGD 2VSHGDOLHUR8QLYHUVLWDULD GL 3DUPD QHOO¶DQQR q VWDWD
FDUDWWHUL]]DWD GDOO¶DXPHQWR GHOOD VLQHUJLD IUD L VHUYL]L WUDVYHUVDOL H OH DUWLFROD]LRQL D]LHQGDOL DWWUDYHUVR
SUDWLFKHFROODERUDWLYHSURPRVVHGDO6HWWRUH)RUPD]LRQHH$JJLRUQDPHQWRD]LHQGDOHLQFRQWULLQIRUPDWLYL
DWWLYLWjGLFRQVXOHQ]DPHWRGRORJLFDFRQVROLGDPHQWRGHOODUHWHGHLUHIHUHQWLQRQFKpGDOFRQVROLGDPHQWR
GHL SHUFRUVL D]LHQGDOL SHU O¶DFFUHGLWDPHQWR (&0 GHOOH LQL]LDWLYH IRUPDWLYH ,Q WDO VHQVR XQR GHJOL
VWUXPHQWL PHVVL D SXQWR q VWDWR LO 'RVVLHU 'LSDUWLPHQWDOH GHOOD IRUPD]LRQH 7DOH VWUXPHQWR JLj
VSHULPHQWDWRDOLYHOORGLSDUWLPHQWDOHQHOHSURJUHVVLYDPHQWHLQIRUPDWL]]DWRSHUWXWWHOHDUWLFROD]LRQL
GLSDUWLPHQWDOL GHOO¶$]LHQGD QHO FRUVR GHO KD SHUPHVVR GL VYROJHUH XQD SULPD YHULILFD FLUFD OD
FRHUHQ]D IUD OD SURJUDPPD]LRQH GHOOD IRUPD]LRQH H OH OLQHH GL LQGLUL]]R WULHQQDOL GHOOD IRUPD]LRQH H
UHODWLYDPHQWH DOO¶LQWHJUD]LRQH GHJOL RELHWWLYL IRUPDWLYL GHL VLQJROL FRQ JOL RELHWWLYL GL VYLOXSSR GHOOH XQLWj
RSHUDWLYHHTXLSHLQDUPRQLDFRQOHSULRULWjGHOO¶$]LHQGD
'DWHTXHVWHSUHPHVVHODOHWWXUDGHLGDWLDWWLYLWjGHOO¶DQQRHVSULPHO¶RULHQWDPHQWRGHOO¶DWWLYLWjGHOOD
IRUPD]LRQH(&0YHUVRXQ¶RWWLFDGHOODTXDOLWj7DOHSURVSHWWLYDqVXIIUDJDWDGDOOHJJHURGHFUHPHQWRGHOOH
RUH GL IRUPD]LRQH HURJDWH FRPSOHVVLYDPHQWH GDOO¶$]LHQGD ULVSHWWR O¶DQQR SUHFHGHQWH
FRPSHQVDWR GDOOD GDOO¶DXPHQWR GHO QXPHUR GL LQL]LDWLYH GL IRUPD]LRQH VXO FDPSR VHPSUH
ULVSHWWRDO
&RPSOHVVLYDPHQWHGXUDQWHO¶DQQRO¶$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGL3DUPDKDHURJDWR
PRPHQWL IRUPDWLYL FRPSOHVVLYDPHQWH LO LQ PHQR ULVSHWWR DOO¶DQQR SUHFHGHQWH GL FXL Q HYHQWL UHVLGHQ]LDOL IRUPD]LRQH UHVLGHQ]LDOH LQWHUDWWLYD FRUVL WHFQLFRSUDWLFL RUJDQL]]DWLYR JHVWLRQDOL
FRQYHJQLVHPLQDULHQLQL]LDWLYHGLIRUPD]LRQHVXOFDPSR
,O QXPHUR GL HYHQWL UHVLGHQ]LDOL q GLPLQXLWR VHQVLELOPHQWH GHO ULVSHWWR DOO¶DQQR SUHFHGHQWH
7XWWDYLD WDOH GHFUHPHQWR FRLQFLGH FRQ XQ IRUWH LQFUHPHQWR GHOOH LQL]LDWLYH GL IRUPD]LRQH VXO FDPSR
6LHYLGHQ]LDLQROWUHFKHO¶$]LHQGDKDVYROWROHIXQ]LRQLGLVROR3URYLGHU(&0SHUOHLVWLWX]LRQL
HVWHUQHFRQYHQ]LRQDWHTXDOLO¶2UGLQHGHL0HGLFLH&KLUXUJKLGHOODSURYLQFLDGL3DUPDHO¶,3$69,GL3DUPD
HSHUOH$VVRFLD]LRQLQRSURILWSHUXQWRWDOHGLLQL]LDWLYH
,OQXPHURFRPSOHVVLYRGHOOHRUHGLIRUPD]LRQHHURJDWHQHOO¶DQQRVLDWWHVWDLQWRUQRDOOHGL
FXLQGLDJJLRUQDPHQWRLQWHUQRHQRUHGLDJJLRUQDPHQWRHVWHUQRFRPHVSHFLILFDWRQHOOD
WDEHOODVRWWRULSRUWDWD
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
7DEHOOD2UHGLIRUPD]LRQHHURJDWDQHOO¶DQQRULSDUWLWHIUDIRUPD]LRQHDOO¶LQWHUQRHG
DOO¶HVWHUR
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
KƌĞĚŝĨŽƌŵĂnjŝŽŶĞ
ŶŶŽϮϬϭϮ
ŶŶŽϮϬϭϯ
&KZD/KE/EdZE
ϳϱ͘ϲϭϬ
ϳϯ͘ϴϮϴ
&KZD/KE^dZE
Ϯϯ͘ϮϬϴ
Ϯϭ͘ϵϳϵ
dKd>
ϵϴ͘ϴϭϴ
ϵϱ͘ϴϬϳ
5LVSHWWRDOO¶DQQRSUHFHGHQWHVLUHJLVWUDXQGHFUHPHQWRFRPSOHVVLYRGHOOHRUHGLIRUPD]LRQHSDUL
DOOR 7DOH GHFUHPHQWR FRLQFLGH FRQ XQD GLPLQX]LRQH VLD GHOOH RUH UHODWLYH DL FRUVL RUJDQL]]DWL
DOO¶LQWHUQR GHOO¶$]LHQGD VLD GHOOH RUH GL DJJLRUQDPHQWR DOO¶HVWHUQR FKH VRQR OLHYHPHQWH
GLPLQXLWH
,OUDSSRUWRIUDOHRUHGLDJJLRUQDPHQWRHVWHUQRHGLQWHUQRQHJOLDQQLHqPHJOLRUDSSUHVHQWDWR
QHOJUDILFR
*UDILFR5DSSRUWRIUDO¶DQQRHO¶DQQRFLUFDOHRUHGLIRUPD]LRQHHURJDWH
Anno 2012
ŶŶŽϮϬϭϯ
Anno 2012
&KZD/KE/EdZE
Anno 2013
&KZD/KE^dZE
1RQRVWDQWHLOQXPHURGLRUHFRPSOHVVLYHGLIRUPD]LRQHVLDQRGLPLQXLWHQHOFRUVRGHOVLVRWWROLQHD
FKHqULPDVWRSUHVVRFKpLQYDULDWRLOUDSSRUWRIUDO¶DJJLRUQDPHQWRHVWHUQRHGLQWHUQRUDSSUHVHQWDWRDQFKH
QHO JUDILFR FKH LQ WHUPLQL GL PRQWH RUH VL q PDQWHQXWR D FRQ XQD OHJJHULVVLPD IOHVVLRQH
GHOO¶DJJLRUQDPHQWRHVWHUQR
*UDILFR5DSSRUWRIUDRUHGLIRUPD]LRQHDOO¶HVWHUQRHGDOO¶HVWHUQRQHOO¶DQQR
23%
FORMAZIONE INTERNA
FORMAZIONE ESTERNA
77%
,O QXPHUR FRPSOHVVLYR GHL SURIHVVLRQLVWL SUHVHQWL LQ $]LHQGD IRUPDWRVL DWWUDYHUVR O¶DJJLRUQDPHQWR
LQWHUQRVLDWWHVWDFRPSOHVVLYDPHQWHLQWRUQRDGLLQFUHPHQWRULVSHWWRDOO¶DQQRGL
EƵŵĞƌŽĚŝŽƉĞƌĂƚŽƌŝĨŽƌŵĂƚŝ
&KZD/KE
ĚŝƌĞƚƚĂŵĞŶƚĞ
/EdZE
&KZD/KE^dZE
ĞƌŽŐĂƚĂ
ŶŶŽϮϬϭϮ
ŶŶŽϮϬϭϯ
й
ϮϳϬϵ
Ϯϵϵϲ
ϳϵ͕ϰϵй
ϴϮϯ
ϳϳϯ
ϮϬ͕ϱϭй
;ĐŽƌƐŝĂƵƚŽƌŝnjnjĂƚŝĂůů͛ĞƐƚĞƌŶŽͿ
dKd>
ϯϱϯϮ
ϯϳϲϵ
ϭϬϬй
$OLOQXPHURFRPSOHVVLYRGLSURIHVVLRQLVWLFRQREEOLJR(&0HUDQRRVVLDLO
ULVSHWWRDOWRWDOH
,O QXPHUR GL SURIHVVLRQLVWL VDQLWDUL FRQ REEOLJR (&0 FKH KDQQR IUHTXHQWDWR FRUVL (&0 LQWHUQL HURJDWL
GLUHWWDPHQWH GDOO¶$]LHQGD VRQR VWDWL Q /¶LQFUHPHQWR GHOOD SDUWHFLSD]LRQH DG LQL]LDWLYH LQWHUQH
ULVSHWWR DOO¶DQQR SUHFHGHQWH KD FRLQFLVR FRQ LO GHFUHPHQWR GHL SDUWHFLSDQWL DG LQL]LDWLYH
HVWHUQHDOO¶D]LHQGDFKHFRPSOHVVLYDPHQWHVRQRVWDWL
&RPSOHVVLYDPHQWH L FUHGLWL (&0 HURJDWL GLUHWWDPHQWH GDOO¶$]LHQGD VRQR VWDWL SHU SDUWHFLSD]LRQH
DGLQL]LDWLYHLQWHUQHQFUHGLWLSHUDWWLYLWjGLGRFHQ]DHWXWRUDWR
1HOOD WDEHOOD VRWWR ULSRUWDWD YLHQH GHVFULWWD OD ULSDUWL]LRQH GHL FUHGLWL (&0 FRQVHJXLWL DWWUDYHUVR OD
SDUWHFLSD]LRQHDLQL]LDWLYHRUJDQL]]DWHGLUHWWDPHQWHGDOO¶D]LHQGDSHUOHYDULHSURIHVVLRQLVDQLWDULH
7DEHOOD&UHGLWL(&0HURJDWLSHUODSDUWHFLSD]LRQHDGLQL]LDWLYHIRUPDWLYHLQWHUQHVXGGLYLVL
SHUSURIHVVLRQHVDQLWDULDQHOO¶DQQR
WƌŽĨŝůŽƉƌŽĨĞƐƐŝŽŶĂůĞ
Ŷ͘ĐƌĞĚŝƚŝD
^^/^dEd^E/dZ/K
ϭϰ
Ϭ͕ϬϮй
^^/^dEd^K/>
Ϭ
Ϭ͕ϬϬй
/K>K'K
ϭϮϯϭ
Ϯ͕Ϭϱй
,/D/K
ϴ
Ϭ͕Ϭϭй
/d/^d
ϵϱ
Ϭ͕ϭϲй
hdKZWZK&^^/KE>
ϯϴ
Ϭ͕Ϭϲй
&ZD/^d
ϮϰϮ
Ϭ͕ϰϬй
&/^/K
ϭϴϭ
Ϭ͕ϯϬй
&/^/KdZW/^d
Ϯϵϵϴ
ϰ͕ϵϵй
/E&ZD/Z
ϯϭϴϯϮ
ϱϮ͕ϵϳй
/E&ZD/ZW/dZ/K
ϭϬϵ
Ϭ͕ϭϴй
>K'KW/^d
ϱϳ
Ϭ͕Ϭϵй
D/K
ϭϰϲϬϲ
Ϯϰ͕ϯϬй
KKEdK/dZ
ϯϱϴ
Ϭ͕ϲϬй
KZdKdd/^d
ϱϮϭ
Ϭ͕ϴϳй
K^ddZ/ͬK
ϭϲϭϵ
Ϯ͕ϲϵй
WZ^KE>dE/K
ϯ
Ϭ͕ϬϬй
W^/K>K'K͕D/KW^/K>K'K
Ϯϯϱ
Ϭ͕ϯϵй
dE/KWZsE͘E>>ΖD/Ed
Ϭ
Ϭ͕ϬϬй
>hK',/>s͘
dE/Kh/KDdZ/^d
ϰϰ
Ϭ͕Ϭϳй
dE/K/EhZK&/^/KWdK>K'/
Ϯϭϰ
Ϭ͕ϯϲй
dE/K&/^/KWdK>K'/
ϲϳ
Ϭ͕ϭϭй
Z/K/ZK>dKZ/
dE/K^E/dZ/K/Z/K>K'/
ϭϵϮϮ
ϯ͕ϮϬй
D/
dE/K^E/dZ/K>KZdKZ/K
ϯϳϬϯ
ϲ͕ϭϲй
/KD/K
dŽƚĂůĞ
ϲϬϬϵϱ
ϭϬϬ͕ϬϬй
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
FXL FRQ REEOLJR (&0 H VHQ]D REEOLJR (&0 SHU XQ QXPHUR PHGLR GL RUH SUR FDSLWH ,O
QXPHURGLSURIHVVLRQLVWLFKHKDQQRDYXWRDFFHVVRDOODIRUPD]LRQHDOO¶HVWHUQRVRQRVWDWL
/DWDEHOODFKHULSRUWDLQQXPHURGLRSHUDWRULIRUPDWLDWWUDYHUVRDJJLRUQDPHQWRLQWHUQRHGHVWHUQRULIOHWWH
O¶DQGDPHQWRGHOODVSHVDGHOODIRUPD]LRQHULDVVXQWDQHOO¶XOWLPRVFKHPDULSRUWDWRQHOSUHVHQWHSDUDJUDIR
7DEHOOD1XPHURFRPSOHVVLYRGLGLSHQGHQWLFKHKDQQRDYXWRDFFHVVRDOODIRUPD]LRQH
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
,SURIHVVLRQLVWLGHOO¶$]LHQGDKDQQRPDWXUDWRFUHGLWL(&0QRQVRORDWWUDYHUVRODSDUWHFLSD]LRQHDGLQL]LDWLYH
IRUPDWLYH 6RQR VWDWL ULFRQRVFLXWL FUHGLWL (&0 DQFKH SHU OH VHJXHQWL DWWLYLWj GRFHQ]D WXWRUDWR
FRRUGLQDWRUHGLIRUPD]LRQHVXOFDPSR
,SURIHVVLRQLVWLGHOO¶$]LHQGDFKHKDQQRVYROWRDWWLYLWjGLWXWRULQLQL]LDWLYH(&0VRQRVWDWLSHUXQWRWDOH
GL FUHGLWL (&0 HURJDWL PHQWUH SURIHVVLRQLVWL KDQQR PDWXUDWR FUHGLWL (&0 FRPH &RRUGLQDWRUH GL
)6& SHU XQ WRWDOH GL FUHGLWL (&0 , GLSHQGHQWL GHOO¶$]LHQGD FKH KDQQR VYROWR DWWLYLWj GL GRFHQ]D
VRQRVWDWLULVSHWWRDOO¶DQQRSUHFHGHQWHHFRPSOHVVLYDPHQWHKDQQRFRQVHJXLWRFUHGLWL
(&0 ,UHODWRULSURYHQLHQWLGDDOWUHVWUXWWXUHHQWLSXEEOLFLHSULYDWLVRQRVWDWLFRPSOHVVLYDPHQWH
HLFUHGLWLDVVHJQDWLVRQRVWDWL
, SURIHVVLRQLVWL SURYHQLHQWL GD DOWUL HQWL R GD VWUXWWXUH SULYDWH VRQR VWDWL SHU XQ WRWDOH GL FUHGLWL(&0HURJDWLSHUO¶HVWHUQRHKDQQRIUHTXHQWDWRFLUFDFRPSOHVVLYDPHQWHLQL]LDWLYH
/D VSHVD FRPSOHVVLYD SHU OD IRUPD]LRQH (&0 q VWDWD GL (XUR ULSDUWLWD QHO VHJXHQWH PRGR
(XURSHUILQDQ]LDUHFRUVLRUJDQL]]DWLDOO¶LQWHUQRGHOO¶$]LHQGDHSHULOILQDQ]LDPHQWR
GHOODIRUPD]LRQHDOGLIXRULGDOO¶D]LHQGD
7DEHOOD&RVWLVRVWHQXWLSHUODIRUPD]LRQHUHODWLYDPHQWHDOO¶DQQR
ŽƐƚŝĚĞůůĂĨŽƌŵĂnjŝŽŶĞ
ŶŶŽϮϬϭϯ
й
&KZD/KE/EdZE
ϯϮϵ͘ϱϴϴ͕ϬϬ
ϴϬ͕ϴй
&KZD/KE^dZE
ϳϴ͘Ϯϵϵ͕ϬϬ
ϭϵ͕ϮϬй
dKd>
ϰϬϳ͘ϴϴϳ͕ϬϬ
ϭϬϬй
,OSURFHVVRGLDFFUHGLWDPHQWRGHOODIXQ]LRQHIRUPDWLYDHGHOODIXQ]LRQH
GL3URYLGHU
1HO O¶$]LHQGD KD RWWHQXWR GD SDUWHGHOOD 5HJLRQH (PLOLD5RPDJQD O¶DFFUHGLWDPHQWR SURYYLVRULR SHU
ODGXSOLFHIXQ]LRQHGL*RYHUQRGHOOD)RUPD]LRQHHGL3URYLGHU(&01HOFRUVRGHOVRQRSURVHJXLWHOH
DWWLYLWjSHULOSURFHVVRGLDFFUHGLWDPHQWRLQSUHSDUD]LRQHGHOODYLVLWDGHLYDOXWDWRULUHJLRQDOLSHULOULODVFLR
GHOO¶DFFUHGLWDPHQWRGHILQLWLYR
,Q SDUWLFRODUH VL q SURJUDPPDWD OD UHYLVLRQH GHO 0DQXDOH GL $FFUHGLWDPHQWR H GL WXWWH OH HYLGHQ]H GD
DOOHJDUH VHFRQGR OD FKHFNOLVW XQLILFDWD GHL UHTXLVLWL GHOLEHUDWL GDOOD 5HJLRQH (PLOLD5RPDJQD H FRQGLYLVL
FRQOHDOWUH$]LHQGHVDQLWDULHGHOOD5HJLRQH
7UD OH HYLGHQ]H VRQR VWDWH FRVWUXLWH SURFHGXUH LVWUX]LRQL RSHUDWLYH H UHJRODPHQWL ,O GRFXPHQWR GL
ULIHULPHQWRSHUODUHYLVLRQHHODFRVWUX]LRQHGHOODGRFXPHQWD]LRQHqVWDWRODFKHFNOLVWXQLILFDWD
, SURJHWWL GL PLJOLRUDPHQWR SHU LO KDQQR ULJXDUGDWR VRSUDWWXWWR O¶DPELWR GHOOD &RPXQLFD]LRQH OD
&DUWDGHL6HUYL]LGHOOD)RUPD]LRQHHXQ¶LQGDJLQHGLFXVWRPHUFDUHHORVYLOXSSRGHO6LVWHPD,QIRUPDWLYR
FRQSDUWLFRODUHULIHULPHQWRDO'RVVLHUGLSDUWLPHQWDOH
2ELHWWLYR GHOOD &DUWD GHL 6HUYL]L GHOOD )RUPD]LRQH q SRUUH JOL XWHQWL ³QHOOD FRQGL]LRQH GL FRQWUROODUH OD
TXDOLWjGHOVHUYL]LR´/D³&DUWD´qHVVHQ]LDOPHQWHYROWDDOODWXWHODGHLGLULWWLGHJOLXWHQWLQRQVLWUDWWDGL
XQDWXWHODLQWHVDFRPHPHURULFRQRVFLPHQWRIRUPDOHGLJDUDQ]LHDOO¶XWHQWHPDGLDWWULEX]LRQHDOORVWHVVR
GLXQSRWHUHGLFRQWUROORGLUHWWRVXOODTXDOLWjGHLVHUYL]LHURJDWL
/D &DUWD GHL 6HUYL]L GHOOD )RUPD]LRQH q VWDWD DSSURYDWD GDOOD 'LUH]LRQH D]LHQGDOH HG q VWDWD SXEEOLFDWD
VXOOHSDJLQH,QWUDQHWGHOO¶$]LHQGD
Ê VWDWR FRVWUXLWR XQ TXHVWLRQDULR SHU XQ¶LQGDJLQH D FDPSLRQH VXO JUDGR GL VRGGLVID]LRQH GHOO¶XWHQ]D GHO
6HWWRUH )RUPD]LRQH ,O FDPSR GL LQGDJLQH q VWDWR FLUFRVFULWWR DG DOFXQL VHUYL]L LQGLYLGXDWL DQFKH LQ
UHOD]LRQH DL UHTXLVLWL SHU O¶DFFUHGLWDPHQWRLVWLWX]LRQDOH ,O WDUJHW UHVSRQVDELOL VFLHQWLILFLWXWRUH UHIHUHQWL
GLSDUWLPHQWDOL GHOOD )RUPD]LRQH 5') UDSSUHVHQWD XQ FDPSLRQH UDJLRQDWR LQGLYLGXDWR LQ EDVH DL
SULQFLSDOLIUXLWRULGHLVHUYL]LRJJHWWRGLLQGDJLQH*OLLWHPGHOTXHVWLRQDULRVLULIHULVFRQRDOO¶XOWLPDLQL]LDWLYD
IRUPDWLYDRUJDQL]]DWDQHOO¶DQQRLQFRUVR
,OOLYHOORGLVRGGLVID]LRQHGHOO¶XWHQ]DqULVXOWDWRHVVHUHEXRQR3HUPLJOLRUDUHLOVHUYL]LRFRPSOHVVLYRVRQR
JLjVWDWHPHVVHLQDWWRD]LRQLFRUUHWWLYH
,Q SUHYLVLRQH GHOOD YLVLWD LVSHWWLYD GHL YDOXWDWRUL UHJLRQDOL GRYUj HVVHUH SLDQLILFDWD SHU OD SULPD SDUWH
GHOO¶DQQRXQDYLVLWDLVSHWWLYDFRQYDOXWDWRULLQWHUQLDOO¶$]LHQGD
3URJHWWLSULQFLSDOLDWWLYDWL
&RUVR GL )RUPD]LRQH 0DQDJHULDOH SHU 'LULJHQWL GL 6WUXWWXUD &RPSOHVVD GHOO¶$]LHQGD 2VSHGDOLHUR
8QLYHUVLWDULDGL3DUPD
,OFRUVRSURPRVVRGDOO¶$]LHQGDVXOIRUPDWSURJUDPPDFRQFRUGDWRWUDOH$]LHQGH6DQLWDULHGHOO¶$UHD9DVWD
(PLOLD 1RUG $9(1 KD O¶RELHWWLYR GL VXSSRUWDUH OR VYLOXSSR GHOOH FDSDFLWj PDQDJHULDOL GHL 'LUHWWRUL GL
6WUXWWXUD &RPSOHVVD L TXDOL SHU O
HVHUFL]LR GHOOH IXQ]LRQL GLULJHQ]LDOL VRQR FKLDPDWL D SRVVHGHUH
DGHJXDWH FRQRVFHQ]H H FRPSHWHQ]H QRQ VROR GL QDWXUD SURIHVVLRQDOH PD DQFKH RUJDQL]]DWLYH H
JHVWLRQDOL
,O FRUVR LQWHQGH SHUWDQWR RIIULUH XQD IRUPD]LRQH LQWHUGLVFLSOLQDUH GL FDUDWWHUH HFRQRPLFRFRQWDELOH
SLDQLILFD]LRQH SURJUDPPD]LRQH H FRQWUROOR GL JHVWLRQH GL FDUDWWHUH JLXULGLFR LO ODYRUR H OD
UHVSRQVDELOLWjQHOOHVWUXWWXUHVRFLRVDQLWDULHSXEEOLFKHHSULYDWHDFFUHGLWDWHHGLFDUDWWHUHRUJDQL]]DWLYRH
JHVWLRQDOHULVRUVHXPDQHFOLQLFDOJRYHUQDQFHTXDOLW\HULVNPDQDJHPHQW
/DTXDOLWjGHOOHDWWLYLWjGLPDQDJHPHQWQHOOHD]LHQGHVDQLWDULHqODULVXOWDQWHQRQVRORGLXQHOHYDWRJUDGR
GL FRPSHWHQ]H WHFQLFR±SURIHVVLRQDOL PD DQFKH GL XQD VSLFFDWD FDSDFLWj RUJDQL]]DWLYD LQ XQ FRQWHVWR GL
ULVRUVHGHILQLWH
/D , HGL]LRQH GHO FRUVR FKH KD SUHVR LO YLD LQ RWWREUH H WHUPLQHUj QHO JLXJQR FRQVHQWLUj LO
ULFRQRVFLPHQWRGHOWLWRORGLDELOLWD]LRQHDLGLUHWWRULGLVWUXWWXUDFRPSOHVVDDLVHQVLGHO'/JVQH
VPHGHO'35Q
1HO FRUVR GHO q VWDWR GHILQLWR LO SURJUDPPD GHWWDJOLDWR GHO FRUVR VXL WHPL GHOO¶RUJDQL]]D]LRQH
VDQLWDULD GHJOL VWUXPHQWLSHU ODJHVWLRQHH OD TXDOLWj GHL VHUYL]L GHOODJHVWLRQH GHOOH ULVRUVH XPDQH H GL
HOHPHQWLGLELODQFLRHFRQWUROOR,OFRUVRVXGGLYLVRLQPRGXOLKDXQDGXUDWDFRPSOHVVLYDGLRUH
3HU OH GRFHQ]H VRQR VWDWL VHOH]LRQDWL HVSHUWL GL DOWR SURILOR SURYHQLHQWL GD 8QLYHUVLWj &HQWUL GL 5LFHUFD
(QWLGL)RUPD]LRQHH6RFLHWjGLFRQVXOHQ]DFRDGLXYDWLGDGLVFXVVDQWD]LHQGDOLSHUO¶DSSURIRQGLPHQWRGHL
WHPLQHOOHGLQDPLFKHLQWHUQHDOO¶D]LHQGD
,O SURJUDPPD q VWDWR SUHVHQWDWR DL SURIHVVLRQLVWL SRWHQ]LDOPHQWH LQWHUHVVDWL QHOOD JLRUQDWD GHO
6XFFHVVLYDPHQWH LQ RWWREUH VL VRQR DSHUWH OH LVFUL]LRQL DOOD , HGL]LRQH GHO FRUVR 6L
VRQR LVFULWWL GLUHWWRUL GL VWUXWWXUD FRPSOHVVD GHOO¶$]LHQGD 2VSHGDOLHUR8QLYHUVLWDULD GL 3DUPD RVSHGDOLHULHXQLYHUVLWDUL
6X ),25( OD SLDWWDIRUPD HOHDUQLQJ GHOO
$]LHQGD q VWDWR LQROWUH DWWLYDWR XQ DPELHQWH GHGLFDWR DO FRUVR
GHQRPLQDWR&+,521(GRYHLSDUWHFLSDQWLSRVVRQRWURYDUHLPDWHULDOLGLGDWWLFLPHVVLDGLVSRVL]LRQHGDL
GRFHQWL H PXRYHUVL LQ XQR VSD]LR LQWHUDWWLYR SHU OD FRQGLYLVLRQH GHL FRPSLWL H O¶HODERUD]LRQH GHL SURMHFW
ZRUN
&RUVRGL)RUPD]LRQHSHU&RRUGLQDWRUL
2ELHWWLYR JHQHUDOH GHO FRUVR q TXHOOR GL LPSOHPHQWDUH OH FRPSHWHQ]H RUJDQL]]DWLYRPDQDJHULDOL GHL
FRRUGLQDWRULGHOO
$]LHQGD
,O SHUFRUVR IRUPDWLYR KD FRLQYROWR XQ JUXSSR ³SLORWD´ GL SHUVRQH FRPSRVWR GD WXWWL L FRRUGLQDWRUL
DIIHUHQWL DL 'LSDUWLPHQWL &DUGLRQHIURSROPRQDUH 2QFRHPDWRORJLFR H 3ROLVSHFLDOLVWLFR 3DWRORJLD H
0HGLFLQDGL/DERUDWRULRHL5$'GHL'LSDUWLPHQWLFRLQYROWL
1HO SHULRGR VHWWHPEUHRWWREUH VL VRQR WHQXWL LQFRQWUL ,Q TXHVWD SULPD IDVH GHO FRUVR DL
SDUWHFLSDQWL q VWDWR VRPPLQLVWUDWR XQ TXHVWLRQDULR PHWRGRORJLD GL DVVHVVPHQW 'ROTXHVW FKH KD
SHUPHVVR DL GRFHQWL GL GHOLQHDUH XQ SURILOR FRJQLWLYR SHUVRQDOL]]DWR &RQ O
DLXWR GL TXHVWR VWUXPHQWR L
SDUWHFLSDQWLVRQRVWDWL³JXLGDWL´QHOODSURSULDDXWRYDOXWD]LRQHULVSHWWRDOUXRORDWWHVRLQ$]LHQGDHQHOOD
GHILQL]LRQHGLRELHWWLYLLQGLYLGXDOLGLPLJOLRUDPHQWR6LqTXLQGLODYRUDWRSHUPHWWHUHDIXRFROHWHPDWLFKH
GL PDJJLRUH LQWHUHVVH H XWLOLWj GD VYLOXSSDUH QHL ODERUDWRUL IRUPDWLYL FKH VRQR ULVXOWDWH HVVHUH OD
FRPSUHQVLRQH H O
DPSOLDPHQWR GHOOR VWLOH GL OHDGHUVKLS QHOOD JHVWLRQH GHL FROODERUDWRUL LO
SURFHVVRGLGHOHJDODJHVWLRQHGHLFRQIOLWWLHLOVDSHUHSUHQGHUHGHFLVLRQLGLIILFLOL
/D PRGDOLWj GLGDWWLFD SULYLOHJLDWD q VWDWD GL WLSR LQWHUDWWLYR SHU IDYRULUH LO WUDVIHULPHQWR GHJOL DVSHWWL
WHRULFLQHOODYLWDTXRWLGLDQD'XUDQWHJOLLQFRQWULDLSDUWHFLSDQWLVRQRVWDWHFRQVHJQDWHDOFXQHVFKHGHGL
DQDOLVLGLFDVLFRQFUHWLHGLULIOHVVLRQHJXLGDWD
3HUIDYRULUHODFRQGLYLVLRQHGHLPDWHULDOLGLGDWWLFLHO
LQWHUD]LRQHWUDLSDUWHFLSDQWLDQFKHQHOO
RWWLFDGLXQD
FRQGLYLVLRQH FKH SRWHVVH DQGDUH ROWUH L WHPSL GHO FRUVR q VWDWR DWWLYDWR XQ DPELHQWH YLUWXDOH GHGLFDWR
VXOODSLDWWDIRUPDHOHDUQLQJGHOO
$]LHQGD),25(
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
)RUPD]LRQHPDQDJHULDOH
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
)RUPD]LRQHDOODULFHUFDSVLFRVRFLDOH
3URVHJXH QHO LO SURJHWWR IRUPDWLYR LQL]LDWR QHO FRQ XQ SHUFRUVR GL EDVH H XQ SHUFRUVR
DYDQ]DWR,QHQWUDPELLSHUFRUVLVRQRVWDWHDWWLYDWHULFHUFKHGLDPELWRVDQLWDULRXWLOL]]DQGRODPHWRGRORJLD
GHOODULFHUFDSVLFRVRFLDOH
1HOLO6HUYL]LR,QQRYD]LRQH6RFLDOHGHOO¶$JHQ]LD6DQLWDULDH6RFLDOHUHJLRQDOHKDFHQVLWRLSURJHWWLGL
ULFHUFDVRFLRVDQLWDULDFKHVLVRQRVYLOXSSDWLQHOOH$]LHQGD*UD]LHDOSHUFRUVRGLIRUPD]LRQHLQRJJHWWR
ODQRVWUD$]LHQGDKDSRWXWRLQYLDUHSURJHWWLGLULFHUFDULVSHWWLYDPHQWHVYLOXSSDWLQHLDQQLGLDWWLYLWj
GHL FRUVL H KD SDUWHFLSDWR DOOD GHILQL]LRQH GHOO¶DQDJUDIH UHJLRQDOH ULVSRQGHQGR D XQ
TXHVWLRQDULR VSHFLILFR , ULVXOWDWL GHL TXHVWLRQDUL UDFFROWL VRQR VWDWL SXEEOLFDWL QHO 'RVVLHU GHO ³/DULFHUFDVRFLDOHHVRFLRVDQLWDULDJOLDWWRULSXEEOLFLFRLQYROWLQHOO¶(PLOLD5RPDJQD8QDLQGDJLQHRQOLQH´
1HOqVWDWRUHVRSXEEOLFRHDFFHVVLELOHLOOLQNFKHFRQWLHQHOHFLUFDULFHUFKHWHUULWRULDOLHIIHWWXDWH
GDODO
, UHODWLYL UHSRUW HSURWRFROOL GL VWXGLR LQ IRUPDWR SGI VRQR DUWLFRODWLSHU WLSRORJLD GL &HQWULH DVVRFLDWL D
PDSSDWXUHFDUWRJUDILFKHUHJLRQDOLLQFXLVRQRGLVWULEXLWHOH$]LHQGHVWHVVH
6LSXzDFFHGHUHGLUHWWDPHQWHFRQLOVHJXHQWHOLQN
KWWSDVVUUHJLRQHHPLOLDURPDJQDLWLWDUHHBDWWLYLWDSDUWHFLSD]LRQHLQQRYD]LRQHVRFLDOHLQQRYD]LRQH
VRFLDOHULFHUFDVRFLDOHULFHUFKHLQWUR
&RUVR%DVH,OLYHOORAHGL]LRQH
1HOO¶DQQRLOFRUVRKDVYLOXSSDWRGLVWLQWLSURJHWWLGLULFHUFD
³&RPHLOFDULQJFHQWUDWRVXOODIDPLJOLDLQIOXLVFHVXOORVWDWRGLVDOXWHGHOSD]LHQWHRVSHGDOL]]DWR"´
/D ULFHUFD KD HYLGHQ]LDWRFRPH LO ³SUHQGHUVL FXUD´GHL IDPLOLDULRIIUHQGR ORURVRVWHJQR QHO SHUFRUVR
2VSHGDOLHURGHOORURSDUHQWHDPPDODWRSRVVDIDYRULUHORVYLOXSSRGLXQVHQVRGLHIILFDFLDQHOODFXUDH
QHL FRQIURQWL GHOOD PDODWWLD UHVLOLHQ]D IDYRUHQGR DO WHPSR VWHVVR OD SHUFH]LRQH GL XQD TXDOLWj GL
YLWD DFFHWWDELOH H GLJQLWRVD ,O FDULQJ TXLQGL SXz VHUYLUH DL IDPLOLDUL DG DIIURQWDUH HG HODERUDUH
O¶HVSHULHQ]DWUDXPDWLFDYLVVXWDFRQGLYLGHQGRODFRQOHYDULHILJXUHSURIHVVLRQDOLVDQLWDULHFRLQYROWH,O
FDULQJqXQHOHPHQWRLPSRUWDQWHQHOORVWXGLRGHOODUHOD]LRQHLQIHUPLHUHIDPLJOLDLQUHSDUWLGLGHJHQ]D
RVSHGDOLHUD,OSURFHVVRGLFDULQJqYLVWRFRPHXQDVHULHGLD]LRQLPLUDWHDVRGGLVIDUHOHQHFHVVLWjGHL
PHPEULGHOODIDPLJOLDHRPLJOLRUDUHODORURFRQGL]LRQH
³6HOIFDUHILGXFLDHDXWRHIILFDFLDQHOOHFDVHGHOODVDOXWHXQDULFHUFDHPSLULFD´ 1HOOD VRFLHWj RFFLGHQWDOH VWLDPR DVVLVWHQGR D XQ HQRUPH LQFUHPHQWR GL PDODWWLH FURQLFKH
GHJHQHUDWLYH FRPH LO GLDEHWH 'LYLHQH FRQVHJXHQWHPHQWH QHFHVVDULR UHDOL]]DUH SHU TXHVWL SD]LHQWL
XQ¶DVVLVWHQ]D VDQLWDULD GL TXDOLWj LQ JUDGR GL SRUWDUOL D XQ¶HGXFD]LRQH YHUVR LO VHOIFDUH SUHQGHUVL
FXUDGLVp2FFRUUHWHQHUHSUHVHQWHFKHSURPXRYHUHHPDQWHQHUHODVDOXWHQHLSD]LHQWLFURQLFLHLQ
SDUWLFRODUH QHL SD]LHQWL GLDEHWLFL FRPH QHOOD SRSROD]LRQH LQ JHQHUDOH FRPSRUWD QRQ VROR FXUH
PHGLFKHPDDVVLVWHQ]DVRFLDOHVWUDWHJLHGLHGXFD]LRQHGHOSD]LHQWHHGLLGHQWLILFD]LRQHSUHFRFHGHL
SUREOHPL H GHOOH FRPSOLFDQ]H OHJDWH DOOD PDODWWLD ,O SURIHVVLRQLVWD ROWUH D WUDVIHULUH LQIRUPD]LRQL
IDYRULVFH O¶RUJDQL]]D]LRQH GL XQD VWUXWWXUD GHOOD FRQRVFHQ]D LQ JUDGR GL PHWWHUH LO SD]LHQWH LQ
FRQGL]LRQH GL LGHQWLILFDUH L SURSUL RELHWWLYL LQWUDSUHQGHUH OH SURSULH D]LRQL H VSHULPHQWDUH LO SURSULR
SRWHUH O¶HPSRZHUPHQW GHO SD]LHQWH /R VWXGLR LQWHQGH LQYHVWLJDUH OD FRUUHOD]LRQH WUD OH D]LRQL GL
VHOIFDUHPHVVHLQDWWRGDSD]LHQWLFURQLFLFKHXVXIUXLVFRQRGHLVHUYL]LGLFXUDHURJDWLGDOOH&DVHGHOOD
VDOXWHHLOVHQVRGLILGXFLDSHUFHSLWRYHUVRLOSHUVRQDOHVDQLWDULR7DOHVWXGLRLQWHQGHTXLQGLULOHYDUH
DWWUDYHUVRXQDULFHUFDTXDQWLWDWLYDODFRUUHOD]LRQHWUDOHD]LRQLGLVHOIFDUHHLOJUDGRGLILGXFLDFRQLO
SHUVRQDOH VDQLWDULR GD SDUWH GHL SD]LHQWL FURQLFL /R VWXGLR q VWDWR UHDOL]]DWR DOO¶LQWHUQR GHOOH &DVD
GHOOD6DOXWHGL&RORUQRLQXQDSRSROD]LRQHGLFLUFDSD]LHQWLDIIHWWLGDGLDEHWHWLSR%
³6WRPLDHPLQDFFLDLGHQWLWDULDFRPHODUHOD]LRQHGLDLXWRFRQLOSURIHVVLRQLVWDPRGHUDO¶LPSDWWRVXOOD
TXDOLWjGLYLWD´
,OSUHVHQWHVWXGLRVLSURSRQHGLLQGDJDUHLSULQFLSDOLFDPELDPHQWLSVLFRVRFLDOLLQSD]LHQWLVWRPL]]DWL
RULHQWDQGR OD ULFHUFD YHUVR O¶LQGLYLGXD]LRQH GHL SULQFLSDOL ³FDPELDPHQWL SVLFRVRFLDOL´ GHOO¶XWHQWH
VRWWRSRVWR D FRQIH]LRQDPHQWR GL LOHR H FRORVWRPLD Ê VWDWR FRQGRWWR XQR VWXGLR TXDQWLWDWLYR
FRUUHOD]LRQDOHFKHKDFRLQYROWRSD]LHQWL,GDWLUDFFROWLKDQQRHYLGHQ]LDWRFKHQRUPDOPHQWHVRQR
WUH OH VHVVLRQL GL LQFRQWUR FKH LO SD]LHQWH VWRPL]]DWR KD FRQ O¶HQWHURVWRPLVWD IDVH SUHRSHUDWRULD
TXDOFKH JLRUQR SULPD GHOO¶LQWHUYHQWR QHOOD TXDOH YHQJRQR IRUQLWH LQIRUPD]LRQL VXOOD VWRPLD
LQIRUPD]LRQHVXOODPDODWWLDVXLGLVSRVLWLYLHVXOODFXUDHYLHQHPRVWUDWRLOGLVHJQRGHOODVWRPLDQHO
TXDOH YLHQH LQGLFDWD O¶XELFD]LRQH FKH OD VWRPLD DYUj QHO YHQWUH GHO SD]LHQWH IDVH SRVWRSHUDWRULD
TXDOFKHJLRUQRGRSRO¶LQWHUYHQWRQHOODTXDOHYHQJRQRLQVHJQDWHWHFQLFKHGLJHVWLRQHGHOODVWRPLDH
LQIRUPD]LRQLVSHFLILFKHVXOODFXUDGHOODVWRPLDHVXOORVWLOHGLYLWDGDDGRWWDUHIDVHSRVWGLPLVVLRQL
TXDOFKH JLRUQR GRSR OH GLPLVVLRQL GDOO¶RVSHGDOH QHOOD TXDOH YLHQH SULQFLSDOPHQWH YHULILFDWD OD
FDSDFLWj GHO VRJJHWWR GL SUHQGHUVL FXUD DXWRQRPDPHQWH GHOOD VWRPLD H OD QHFHVVLWj GL VXSSRUWR H
LQIRUPD]LRQL DJJLXQWLYL WHDFKEDFN /H DQDOLVL GHO TXHVWLRQDULR KDQQR ULOHYDWR FKH OD SHUFH]LRQH
GHOOD TXDOLWj GHOOD UHOD]LRQH GL FXUD SXz DYHUH XQ HIIHWWR SRVLWLYR VXOOD TXDOLWj GHOOD YLWD 42/ GL
TXHVWLSD]LHQWLEHQHILFLRFKHSXzHVVHUHPHGLDWRGDOODPLQDFFLDLGHQWLWDULDFRQVHJXHQWHDOODVWRPLD
LQIDWWL QHJDWLYD q ULVXOWDWD VLD OD FRUUHOD]LRQH WUD PLQDFFLD LGHQWLWDULD H TXDOLWj GHOOD YLWD U+2 S FKHWUDODSHUFH]LRQHGHOO
XWLOLWjGHOFROORTXLRFRQO
HQWHURVWRPLVWDSRVWGLPLVVLRQH
U+2 S ,QFRQFOXVLRQHXQDEXRQDUHOD]LRQHGLFXUDKDXQHIIHWWRVXOOD42/LSRWHVL
GLUHWWD XQD EXRQD UHOD]LRQH GL FXUD LQIOXHQ]D OD PLQDFFLD LGHQWLWDULD SHUFHSLWD GDO SD]LHQWH
YDULDELOHPHGLDWULFHFKHDVXDYROWDKDXQHIIHWWRVXOOD42/LSRWHVLLQGLUHWWD
,O&RUVR$YDQ]DWR,,OLYHOORAHGL]LRQH
1HOO¶DQQRLOFRUVRKDVYLOXSSDWRGLVWLQWLSURJHWWLGLULFHUFD
³/DYLVLRQHGLLQVLHPHQHOOHRUJDQL]]D]LRQLVDQLWDULH³
/R VFRSR GHOOD ULFHUFD q VWDWR LQGDJDUH OD VKDUHG YLVLRQ 69 DOO¶LQWHUQR GHOOH RUJDQL]]D]LRQL FRPH
VHJQDODWR GDOOH DJHQ]LH UHJLRQDOL GL SROLF\ VDQLWDULD 6HFRQGR LO SDUDGLJPD GL 6HQJH JOL
HOHPHQWL IRQGDQWL GHOOD 69 VRQRLO VRFLDO QHWZRUN GLPHQVLRQH VWUXWWXUDOH IOXVVLFDQDOL PHGLDQWH L
TXDOLVLYHLFRODO
DJLUHSURIHVVLRQDOHLOVRFLDOWUXVWGLPHQVLRQHUHOD]LRQDOHILGXFLDVRFLDOHVHQVRGL
DSSDUWHQHQ]DLVKDUHGJRDOGLPHQVLRQHFRJQLWLYDRELHWWLYLFRQGLYLVL$SDUWLUHGDWDOLSUHPHVVHOR
VWXGLR KD LQYHVWLJDWR FRPH OD 69 VL GLIIHUHQ]L LQ UHOD]LRQH DOOH SULQFLSDOL YDULDELOL RUJDQL]]DWLYH H
SURIHVVLRQDOL QHOO¶$28 GL 3DUPD FRLQYROJHQGR LQ IRFXV JURXS SURIHVVLRQLVWL VDQLWDUL PHGLFL
LQIHUPLHUL WHFQLFL GL ODERUDWRULR WHFQLFL 266 H DPPLQLVWUDWLYL DIIHUHQWL DOOH XQLWj IXQ]LRQDOL
6HUYL]LR GL ,PPXQRHPDWRORJLD H 7UDVIXVLRQDOH 'LSDUWLPHQWR &DUGLR1HIUR3ROPRQDUH 6HWWRUH
)RUPD]LRQHHG$JJLRUQDPHQWR6HUYL]LR*HVWLRQHH6YLOXSSRGHO3HUVRQDOH
'DLULVXOWDWLRWWHQXWLqSRVVLELOHIDUHGHOOHRVVHUYD]LRQLLQWHUHVVDQWLLQPHULWRDFRPHVLSHUFHSLVFDQRL
GLYHUVL SURIHVVLRQLVWL QHO VLVWHPD D]LHQGDOH VLD SHU TXDQWR ULJXDUGD JOL DVSHWWL GL DSSDUWHQHQ]D DO
FRQWHVWRVLDSHUFLzFKHFRQFHUQHJOLDVSHWWLGLFRQGLYLVLRQHHUHOD]LRQHFRQJOLDOWULSURIHVVLRQLVWL
³/DYDOXWD]LRQHGHOODTXDOLWjGHOOHFXUHULIHULWHDOGRORUH2OWUHODFXVWRPHUVDWLVIDFWLRQ´
$OODOXFHGHOODOHWWHUDWXUDHVDPLQDWDHGRSRDYHUULOHYDWRODFDUHQ]DGLLQGDJLQLSHUTXDQWRFRQFHUQH
OH LQWHUD]LRQL HWLFKH FRPSRUWDPHQWDOL WUD OH LQGLFD]LRQL IRUPDOL H OH SUDWLFKH TXRWLGLDQH GHL
SURIHVVLRQLVWLQHOO¶DPELWRGHOODJHVWLRQHGHOGRORUHODULFHUFDVLIRFDOL]]DVXOODYDOXWD]LRQHGHOODSUHVD
LQ FDULFR GHO SD]LHQWH H VXL IDWWRUL RVWDFRODQWLIDYRUHQWL XQ FRPSRUWDPHQWR HWLFDPHQWH FRUUHWWR GD
SDUWH GHJOL LQIHUPLHUL QHOOD FRUUHWWD JHVWLRQH GHO GRORUH QHO SD]LHQWH DGXOWR /D ULFHUFD KD FRLQYROWR
SURIHVVLRQLVWLLQIHUPLHUL0HWjPHGLDDQQL6' GLD]LHQGHVDQLWDULHGHOOD
5(5 H DIIHUHQWL DOOH GXH DUHH GL DWWLYLWj DVVLVWHQ]LDOL 'HJHQ]D 1 H $UHD FULWLFD 1 $WWUDYHUVRXQTXHVWLRQDULRFRPSRVWRGDVFDOHYDOLGDWHHGDYLJQHWWHFRVWUXLWHDGKRFORVWXGLRKD
WHVWDWR XQ PRGHOOR LQWHJUDWR FKH YDOXWD LO SHVR GL IDWWRUL FKH IDFLOLWDQR RG RVWDFRODQR O¶LQWHQ]LRQH GL
DGHULUHDXQDFRQGRWWDHWLFDGDSDUWHGHJOLLQIHUPLHULLQULIHULPHQWRDOODTXDOLWjGHOOHFXUHGLVSHQVDWH
QHOO¶DPELWR GHOOD JHVWLRQH GHO GRORUH 6L DQDOL]]DQR FRVu IDWWRUL FRUUHODWL DOO¶LQIHUPLHUH FRPH
DXWRHIILFDFLD EXUQRXW H OH ³LGHH LQJHQXH´ UHODWLYH DO GRORUH IDWWRUL FRUUHODWL DO SD]LHQWH TXDOL HWj
JHQHUH H SUHVHQ]D R PHQR GL XQD SDWRORJLD VWLJPDWL]]DWD $,'6 R 6752.( IDWWRUL FRUUHODWL DO
FRQWHVWR RVSHGDOLHUR XQLWj RSHUDWLYH GL GHJHQ]D R GL FXUH LQWHQVLYH H DO FOLPD RUJDQL]]DWLYR GHOOH
82 OD PLVXUD LQ FXL JOL LQIHUPLHUL FRQRVFRQR H GLFKLDUDQR GL DJLUH QHO ULVSHWWR GHO FRGLFH
GHRQWRORJLFRLQULIHULPHQWRDOGRORUH
3URJHWWLGL0LJOLRUDPHQWR
,OFRQVROLGDPHQWRGHOODUHWHGHL5HIHUHQWLGHOOD)RUPD]LRQH
/D QHFHVVLWj GL FRQVROLGDUH OD UHWH GHL 5HIHUHQWL GHOOD )RUPD]LRQH 5') JLj DWWLYD LQ $]LHQGD GD FLUFD
GLHFLDQQLQDVFHGDXQDHVLJHQ]DGLVYLOXSSRGHOO¶DWWLYLWjIRUPDWLYDD]LHQGDOHLQWHUPLQLTXDOLWDWLYL,QIDWWL
OD IRUPD]LRQH DVVXPH VHPSUH SL XQ UXROR DWWLYRTXDOH VXSSRUWR DL UDSLGL FDPELDPHQWLRUJDQL]]DWLYL HG
DOORVYLOXSSRGHOOHFRPSHWHQ]HSURIHVVLRQDOLHGLQWHUSURIHVVLRQDOL
,Q RJQL 'LSDUWLPHQWR DG DWWLYLWj LQWHJUDWD GHOO¶$]LHQGD '$, VRQR SUHVHQWL XQ UHIHUHQWH GLSDUWLPHQWDOH
GHOODIRUPD]LRQHGLDUHDPHGLFDHGXQUHIHUHQWHGHOODIRUPD]LRQHGHOO¶DUHDFRPSDUWR$VXDYROWDODUHWH
GHJOL5')qVXSSRUWDWDGDXQDUHWHGLUHIHUHQWLSUHVHQWLQHOOHGLYHUVH8QLWj2SHUDWLYH
/D UHWH GHJOL 5') ID ULIHULPHQWR DG XQ PRGHOORRUJDQL]]DWLYR RUL]]RQWDOH q GLIIXVD FDSLOODUPHQWH LQRJQL
DUWLFROD]LRQH D]LHQGDOH HG q UDSSUHVHQWDWLYD GL WXWWH OH SURIHVVLRQL ,O FRPSLWR SULQFLSDOH GHOOD UHWH q
TXHOOR GL VXSSRUWDUH L SURIHVVLRQLVWL LQ WXWWH OH IDVL GHO SURFHVVR GHOOD IRUPD]LRQH DQDOLVL GHL ELVRJQL
IRUPDWLYL SURJHWWD]LRQH H DFFUHGLWDPHQWR (&0 GHOOH DWWLYLWj IRUPDWLYH UHDOL]]D]LRQH GL TXHVWH XOWLPH
YDOXWD]LRQHGHLULVXOWDWL
1HO FRUVR GHO FRQ L GLYHUVL 'LSDUWLPHQWL GHOO¶$]LHQGD VL q DYYLDWR XQ FRQIURQWR FLUFD O¶DWWLYLWj GL
SURJUDPPD]LRQHHGLYDOXWD]LRQHGHOOD)RUPD]LRQH7DOHDWWLYLWjVLqVYLOXSSDWDDSDUWLUHGDO:RUNVKRS
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
³3HUXQDSURJUDPPD]LRQHFRQGLYLVDGHOOD)RUPD]LRQH´/¶LQFRQWURGLFDUDWWHUHLQIRUPDWLYRIRUPDWLYRHUD
ILQDOL]]DWRDOODFRVWLWX]LRQHHFRQGLYLVLRQHGLXQOLQJXDJJLRFRPXQHGLWHUPLQLHGLULIHULPHQWLWHPDWLFLHG
DOWUDVIHULPHQWRGL³VWUXPHQWLRSHUDWLYL´IUDLYDULDWWRULD]LHQGDOLFKHVLRFFXSDQRGLIRUPD]LRQHUHWHGHL
UHIHUHQWL UHIHUHQWL DPPLQLVWUDWLYL GHO VHWWRUH SURJHWWLVWL GHOOD IRUPD]LRQH GLULJHQWL HFFHWHUD
'DOO¶LQFRQWURqHPHUVDODQHFHVVLWjGLFRVWUXLUHXQVLVWHPDGLUHJROHFKHSRVVDHVVHUHFRQGLYLVRFRQWXWWLL
SURIHVVLRQLVWLFKHRSHUDQRQHLGLSDUWLPHQWLFRPSDUWRHGLULJHQ]D,OFRLQYROJLPHQWRGLUHWWRGHJOL5')KD
FRQWULEXLWRDYDORUL]]DUHLOUXRORHOHFRPSHWHQ]HGHJOL5')SHUWXWWDXQDVHULHGLDWWLYLWjLQGLYLGXD]LRQHH
GLYXOJD]LRQH GHJOL LQGLUL]]L JHQHUDOL GHOOD IRUPD]LRQH D]LHQGDOH DWWLYLWj GL LQWHUIDFFLD FRQ LO 6HWWRUH
)RUPD]LRQH SURPR]LRQH GL LQL]LDWLYH IRUPDWLYH SURPR]LRQH H GLYXOJD]LRQH GHJOL VWUXPHQWL H GHL GLYHUVL
SURJUDPPLGLIRUPD]LRQHGLSDUWLPHQWDOHPRQLWRUDJJLRHFRQWUROORGHOOHLQL]LDWLYHUHDOL]]DWH
3HU LO VL LQWHQGH SURPXRYHUH XOWHULRUPHQWH OD UHWH GHL UHIHUHQWL QHOOD YDOXWD]LRQH GHOOD ULFDGXWD
RUJDQL]]DWLYD GHOOH LQL]LDWLYH IRUPDWLYH GDWD O¶LPSRUWDQ]D GL WDOH IDVH QHO SURFHVVR FLUFRODUH GHOOD
IRUPD]LRQHFRQWLQXD$WDOILQHYHUUjSURSRVWRDOPHQRXQSURJHWWRIRUPDWLYRSHURJQL'LSDUWLPHQWRFKH
LQFOXGD OD YDOXWD]LRQH DO ILQH GL PRQLWRUDUH DQFKH D GLVWDQ]D GL WHPSR OH ULFDGXWH DVVLVWHQ]LDOL GHOOD
IRUPD]LRQH LQ WHUPLQL GL PLJOLRUDPHQWR FRQWLQXR GHOOD TXDOLWj GHOO¶DVVLVWHQ]D H GL LQQRYD]LRQH WHFQLFD
RUJDQL]]DWLYD H UHOD]LRQDOH QRQFKp JOL DSSUHQGLPHQWL VROOHFLWDWL LQ FRPSRUWDPHQWL SURIHVVLRQDOL DJLWL QHL
FRQWHVWLGLODYRUR
$O FRLQYROJLPHQWR DWWLYR GHJOL 5') VL FRQWUDSSRQH LO WXUQRYHU SULQFLSDOPHQWH GHL UHIHUHQWL GL 82 H OD
GLIILFROWjDWUDVIHULUHOHLQIRUPD]LRQLDOLYHOORSLSHULIHULFR
/¶LQIRUPDWL]]D]LRQHGHO'RVVLHU)RUPDWLYRDSSOLFD]LRQHGLXQPRGHOOR
/¶DFFRUGR6WDWR5HJLRQLGHO$JRVWRKDLQWURGRWWRLOGRVVLHUIRUPDWLYR')LQGLYLGXDOHHGLJUXSSR
FRPH VWUXPHQWR GL SURJUDPPD]LRQH H YDOXWD]LRQH GHO SHUFRUVR IRUPDWLYR GHO VLQJROR RSHUDWRUH
LQGLYLGXDOHRGHOJUXSSRGLFXLIDSDUWHHTXLSHRQHWZRUNSURIHVVLRQDOH
,O')VLDYYDOHGLWUHVSHFLILFKHDWWLYLWjGRFXPHQWDELOLTXDOLO¶LQGLYLGXD]LRQHGHOSLDQRIRUPDWLYRLQFXL
VRQRLQGLFDWLJOLRELHWWLYLIRUPDWLYLGHFOLQDWLLQIXQ]LRQHGHOOHDUHHHGHLFDPSLGLDSSUHQGLPHQWRHGHJOL
LQGLUL]]L SULRULWDUL RYYHUR TXHOOL ULVSRQGHQWL D ELVRJQL LQGLYLGXDOL OD SHULRGLFD H VLVWHPDWLFD DWWLYLWj GL
YHULILFD H GL DFTXLVL]LRQH GHOOD GRFXPHQWD]LRQH UHODWLYD DOOH DWWLYLWj GL IRUPD]LRQH FRQWLQXD VYROWH GDL
SURIHVVLRQLVWL DFFUHGLWDWL DOO¶(&0 OD YDOXWD]LRQH SHULRGLFD WULHQQDOH GHOO¶DQGDPHQWR H GHL ULVXOWDWL GHO
SHUFRUVR
$SDUWLUHGDOO¶DQQRO¶$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGL3DUPDKDUHDOL]]DWRLQYLDVSHULPHQWDOH
GXH 'RVVLHU IRUPDWLYL LQIRUPDWL]]DWL UHODWLYL D GXH 'LSDUWLPHQWL DG $WWLYLWj ,QWHJUDWD '$, 'XUDQWH OR
VFRUVRDQQRLOPRGHOORqVWDWRHVWHVRDWXWWLL'$,XWLOL]]DQGRXQRVSHFLILFRDSSOLFDWLYRFKHqO¶HVWHQVLRQH
GHOVLVWHPDLQIRUPDWLYRJLjXWLOL]]DWRSHUJHVWLUHLOSURFHVVRIRUPDWLYRD]LHQGDOH
,O PRGHOOR GHO 'RVVLHU )RUPDWLYR 'LSDUWLPHQWDOH LQIRUPDWL]]DWR SUHYHGH OH VHJXHQWL VH]LRQL JOL RELHWWLYL
IRUPDWLYLGLGLSDUWLPHQWRLQGLYLGXDWLDWWUDYHUVRO¶DQDOLVLGLIDEELVRJQRHGDOELODQFLRGLFRPSHWHQ]HGHO
JUXSSROHDUHHGLFRPSHWHQ]DWHFQLFRSURIHVVLRQDOLRUJDQL]]DWLYRJHVWLRQDOLFRPXQLFDWLYRUHOD]LRQDOL
ULFHUFD
/¶DSSOLFD]LRQHGHOPRGHOORHODERUDWRKDSHUVHJXLWRO¶RELHWWLYRGLSURPXRYHUHXQDPLJOLRUHLQWHJUD]LRQHGHL
VLQJROL SURIHVVLRQLVWL QHL FRQWHVWL ODYRUDWLYL LQ IXQ]LRQH GHJOL RELHWWLYL GL VYLOXSSR H GHOOH QHFHVVLWj GHOOH
8QLWj 2SHUDWLYH(TXLSH QRQFKp GL GHILQLUH LO SHUFRUVR SHU OD FRPSLOD]LRQH H O¶DJJLRUQDPHQWR GHO ')
GLSDUWLPHQWDOHSHUHIIHWWXDUHODSURJUDPPD]LRQHHODYDOXWD]LRQHGHOOHDWWLYLWjIRUPDWLYH
/H IDVL GL LQIRUPDWL]]D]LRQH GHO ') SRVVRQR HVVHUH GL VHJXLWR ULDVVXQWH LQGLYLGXD]LRQH D OLYHOOR
GLSDUWLPHQWDOH GHJOL RELHWWLYL SULRULWDUL DQQXDOL GHL ULVXOWDWL DWWHVL GHJOL VWUXPHQWL LQGLFDWRUL H GHOOH
PRGDOLWj GL YDOXWD]LRQH DWWUDYHUVR VSHFLILFKH VFKHGH SURJHWWR FKH FRQVLGHUDQR OH FRPSHWHQ]H
SURIHVVLRQDOL ULOHYDWH LQ D]LHQGD LQVHULPHQWR LQIRUPDWLFR GHOOH VFKHGH GL SURJHWWR SHU DJJLRUQDUH
DXWRPDWLFDPHQWHLO')FRQORVWDWRGLDYDQ]DPHQWRGHLFRUVLYLVXDOL]]D]LRQHGHO')HGLQYLRSHULRGLFR
DL'LSDUWLPHQWL
5LVSHWWR DJOL RELHWWLYL SUHILVVDWL O¶LQIRUPDWL]]D]LRQH GHO ') KD SHUVHJXLWR OD FRHUHQ]D GHOO¶DWWLYLWj
IRUPDWLYDUHDOL]]DWDFRQOHDUHHFKHLGHQWLILFDQRJOLRELHWWLYLIRUPDWLYLLQGLYLGXDWLQHOOHOLQHHGLLQGLUL]]RH
FRQ OH FRPSHWHQ]H ULOHYDWH LQ $]LHQGD SHU UXROR H 'LSDUWLPHQWR 7DOH ULVXOWDWR q VWDWR FRQIHUPDWR
GDOO¶DQDOLVLGL)RFXV*URXSFRQGRWWLQHOGDLTXDOLVLqHYLQWRFKHLO')IRUQLVFHDLSURIHVVLRQLVWLXQD
YLVLRQHJOREDOHGHOODIRUPD]LRQHHFUHDSLFRQQHVVLRQLWUD6HUYL]LWUDVYHUVDOLHL'LSDUWLPHQWLDOILQHGL
VYLOXSSDUH XQD IRUPD]LRQH LQWHJUDWD IDYRUHQGR OD SDUWHFLSD]LRQH DOOD IRUPD]LRQH HG LPSOHPHQWDQGR OD
FRQRVFHQ]DGHOOHILQDOLWjGHLFRUVL
$WWLYD]LRQHGLXQDSLDWWDIRUPDHOHDUQLQJ
$ VHJXLWR GHOOD ULFKLHVWD GL DWWLYD]LRQH GL XQD SLDWWDIRUPD H/HDUQLQJ FRPH GD FRQYHQ]LRQH $9(1 LQ
PDU]RqVWDWDLQDXJXUDWD),25()RUPD]LRQH,QWHJUDWD2VSHGDOLHUD5LVRUVH(OHWWURQLFKH/DSLDWWDIRUPD
q VWDWD RUJDQL]]DWD LQ FDWHJRULH FRUVL PHWD FRUVL QHWZRUN IRUPD]LRQH H ODERUDWRUL (
VWDWR
SURJUDPPDWR XQR VYLOXSSR H XQD LQWHJUD]LRQH GHOOD SLDWWDIRUPD DL FRUVL DOOH DWWLYLWj H DOOH ULFHUFKH LQ
DPELWR IRUPDWLYR FKH KD FRPSUHVR OD FUHD]LRQH GL XQ FRPLWDWR VFLHQWLILFR H GL XQ FRUVR SHU IRUPDWRUL
ULYROWR DL SURIHVVLRQLVWL GLSHQGHQWL H FROODERUDWRUL FRLQYROWL LQ DWWLYLWj IRUPDWLYH G
DJJLRUQDPHQWR H
JHVWLRQDOLGHOODFRQRVFHQ]D/DVSHULPHQWD]LRQHKDFRPSRUWDWRO
DGR]LRQHGHJOLDPELHQWLRQOLQHGDSDUWH
GL0DVWHUFRUVLHFRPXQLWjGLSUDWLFDFKHKDQQRSHUPHVVRGLWHVWDUHO
XWLOL]]RHFRQGLYLVLRQHGLULVRUVHH
DWWLYLWj
,QROWUH VRQR VWDWL FUHDWL HYHQWL IRUPDWLYL SHU JOL VWXGHQWL DO ILQH GL DFFHGHUH H GL DSSUHQGHUH O
XWLOL]]R
GHOODSLDWWDIRUPD
,Q QRYHPEUH VL q WHQXWR LQ D]LHQGD XQ ZRUNVKRS GDO WLWROR ³/R VYLOXSSR GHOOD IRUPD]LRQH D GLVWDQ]D
QHOO
$]LHQGD 2VSHGDOLHUR8QLYHUVLWDULD GL 3DUPD´ D FXL KDQQR SDUWHFLSDWR DOFXQL GHL SULPL XWHQWL GHOOD
SLDWWDIRUPDHLOSHUVRQDOHLQWHUHVVDWRDOORVYLOXSSRGHOODIRUPD]LRQHRQOLQH
$OODFKLXVXUDGHOO
DQQRVRODUHODSLDWWDIRUPDKDUHJLVWUDWRDFFHVVLSHUXWHQWLDXWHQWLFDWLKDVYLOXSSDWR
WUDFRUVLODERUDWRULHFRPXQLWjGLSUDWLFDJLjHURJDWHHGLQFDQWLHUHHKDULSRUWDWRXQDPHGLDGL
DFFHVVLDOPHVH
,QGLFHPEUHD5RPDDO&RQYHJQRQD]LRQDOHVXOO
H/HDUQLQJRUJDQL]]DWRGDO6LH/6RFLHWj,WDOLDQD
H/HDUQLQJqVWDWDSUHVHQWDWRXQSDSHUGDOWLWROR³),25(±/DIRUPD]LRQHHOHWWURQLFDFRFRVWUXLUHXVHUV
H 9LUWXDO /HDUQLQJ (QYLURQPHQW DOO
$]LHQGD 2VSHGDOLHUR8QLYHUVLWDULD GL 3DUPD´ LO FXL YLGHR UHOD]LRQH q
GLVSRQLELOHVX<RXWXEHQHOFDQDOH6LH/HGDFFHVVLELOHGDOO
LQGLUL]]RZHEGL),25(KWWSILRUHXQLPRUHLW
,Q WDOH RFFDVLRQH q VWDWR SUHVHQWDWR LO PRGHOOR GHOO
LQWHUIDFFLD &$5 &RPPXQLW\ $FWLYLWLHV 5HVRXUFHV
VYLOXSSDWDDGKRFSHU),25(HOHVXHFRPXQLWjG
DSSUHQGLPHQWRVHFRQGRXQPRGHOORVRFLRFRVWUXWWLYLVWD
GHOODFRQRVFHQ]DHGHOODIRUPD]LRQHVFLHQWLILFDDQGUDJRJLFD
,QGDJLQH VXOO¶XWLOL]]R GHOOH EDQFKH GDWL H GHOOH ULYLVWH VFLHQWLILFKH LO SDUHUH GHL SURIHVVLRQLVWL SHU
PLJOLRUDUHLOVHUYL]LR
/D IRUPD]LRQH H OR VYLOXSSR GHOOH FRPSHWHQ]H GHOOH ULVRUVH XPDQH VRQR HVVHQ]LDOL SHU O¶DWWXD]LRQH GHL
SURFHVVL GL PLJOLRUDPHQWR H SHU OD JHVWLRQH GHOOH IDVL GL FDPELDPHQWR QHOOH RUJDQL]]D]LRQL VDQLWDULH $O
ILQH GL VRVWHQHUH OR VYLOXSSR GHOOD PHGLFLQD O¶LQQRYD]LRQH WHFQRORJLFD FUHVFHQWH L FDPELDPHQWL
RUJDQL]]DWLYL H VRSUDWWXWWR OH ULFKLHVWH H OH HVLJHQ]H GD SDUWH GHOOD SRSROD]LRQH DIIHUHQWH DO 6LVWHPD
6DQLWDULRO¶$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGL3DUPDKDVHQWLWRODQHFHVVLWjGLSURPXRYHUHSURJUDPPL
SHU O¶HGXFD]LRQH FRQWLQXD GHL SURIHVVLRQLVWL VDQLWDUL ILQDOL]]DWL D LPSOHPHQWDUH H D SRWHQ]LDUH O¶H[SHUWLVH
DWWUDYHUVR OD FUHD]LRQH GL XQ TXHVWLRQDULR LQIRUPDWL]]DWR DWWR D ULOHYDUH O
XWLOL]]R GHOOH ULVRUVH
ELEOLRJUDILFKH LQ IRUPDWR HOHWWURQLFR EDQFKH GDWL H SHULRGLFL VFLHQWLILFL XVXIUXLELOL DWWUDYHUVR O
$]LHQGD
2VSHGDOLHUR8QLYHUVLWDULD H OD %LEOLRWHFD GL 0HGLFLQD H &KLUXUJLD 8QLYHUVLWj GL 3DUPD FKH JLj GD DQQL
FROODERUDQR SHU LQWHJUDUH H PHWWHUH D GLVSRVL]LRQH GHJOL RSHUDWRUL VDQLWDUL OH SURSULH SRWHQ]LDOLWj
QHOO¶DPELWRGHOO¶LQIRUPD]LRQHHGHOODGRFXPHQWD]LRQHVFLHQWLILFD&RQYHQ]LRQHSHUO¶DFFHVVRGHOSHUVRQDOH
RVSHGDOLHUR DOOD ELEOLRWHFD FHQWUDOH GL PHGLFLQD HG DL VXRL VHUYL]L 'HOLEHUD GHO 'LUHWWRUH *HQHUDOH Q
$WWUDYHUVR TXHVWR SURJHWWR O
$]LHQGD LQ FROODERUD]LRQH FRQ O
8QLYHUVLWj LQWHQGH YDORUL]]DUH HGLIIRQGHUH
O
LQIRUPD]LRQHVFLHQWLILFDSHUSRWHQ]LDUHODIRUPD]LRQHSHUPDQHQWHHO
DJJLRUQDPHQWRSURIHVVLRQDOHGHJOL
RSHUDWRULVDQLWDULSRWHQ]LDUHO
DJJLRUQDPHQWRVFLHQWLILFRGHLPHGLFLHGHLGRFHQWLQRQVRORDILQLGLGDWWLFL
H GL ULFHUFD PD DQFKH SHU LO PLJOLRUDPHQWR GHOO
DWWLYLWj DVVLVWHQ]LDOH YHULILFDUH O
XWLOL]]R GHOOH ULVRUVH
HOHWWURQLFKHSHUPLJOLRUDUHO
HIILFLHQ]DO
HFRQRPLFLWjHO
HIILFDFLDGHLVHUYL]L
3HUUDJJLXQJHUHWDOLRELHWWLYLqVWDWRFRVWUXLWRXQTXHVWLRQDULRRQOLQH³6FKHGDGLXWLOL]]RGHOOHEDQFKHGDWL
H ULYLVWH VFLHQWLILFKH ,O WXR SDUHUH SHU PLJOLRUDUH LO VHUYL]LR´ DWWUDYHUVR OD UHYLVLRQH GHL TXHVWLRQDUL
XWLOL]]DWL H SXEEOLFDWL QHL YDUL VLWL GHOOH D]LHQGH RVSHGDOLHUH ,WDOLDQH H 5HSRUW SHU LQGDJDUH VWUXPHQWL
YDOLGDWL7DOHULOHYD]LRQHKDFRLQYROWRWXWWLLSURIHVVLRQLVWLDIIHUHQWLDOO
$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGL
3DUPD
,O TXHVWLRQDULR VHPLVWUXWWXUDWR q FRVWLWXLWR GD GLYHUVH DUHH UHODWLYH D OD FRQRVFHQ]D SHUVRQDOH UHODWLYD
DOOH EDQFKH GDWL RIIHUWH VLD GDOO
$]LHQGD FKH GDOO
8QLYHUVLWj OD IUHTXHQ]D GHOO
XVR H GHOOD FRQVXOWD]LRQH
GHOOH EDQFKH GDWL L GDWL VRFLRDQDJUDILFL H UHODWLYL DOO
DWWLYLWj SURIHVVLRQDOH HWj JHQHUH SURIHVVLRQH
DIIHUHQ]D LVWLWX]LRQDOH WLWROR VWXGLR FRQVHJXLWR GLSDUWLPHQWR H VWUXWWXUD GL DSSDUWHQHQ]D DQ]LDQLWj GL
VHUYL]LR
6RQR VWDWL HODERUDWL TXHVWLRQDUL /D PDJJLRU SDUWH GHO FDPSLRQH )HPPLQH 0DVFKL 0LVVLQJ q FRVWLWXLWR GDO 1 LQIHUPLHUL GDO 1 PHGLFL GDO 1
VWXGHQWL XQLYHUVLWDUL 'DOOH SULPH DQDOLVL VL HYLQFH FKH LO q D FRQRVFHQ]D GHOOD SRVVLELOLWj GL
FRQVXOWDUHULVRUVHHOHWWURQLFKHSHULRGLFLEDQFKHGDWLDFFHVVLELOLGDOOHSRVWD]LRQLLQIRUPDWLFKHD]LHQGDOL
PHQWUH LO QRQ FRQRVFH WDOL ULVRUVH ,O GHL SURIHVVLRQLVWL JLXGLFD PROWR LPSRUWDQWH O
XWLOL]]R
GHOOH ULVRUVH HOHWWURQLFKH 3HU O
HVHUFL]LR GHOOD DWWLYLWj SURIHVVLRQDOH L SURIHVVLRQLVWL FRQVXOWDQR OH EDQFKH
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
GDWL H OH ULYLVWH VFLHQWLILFKH SULQFLSDOPHQWH FRQ OR VFRSR GL DJJLRUQDUVL GL UHYLVLRQDUH OD
ELEOLRJUDILD GL ULFHUFD GL VWXGLR H GL PLJOLRUDUH O
DVVLVWHQ]D 5LVSHWWR
DOOD FRQRVFHQ]D GHO SHUFRUVR SHU DFFHGHUH DOOH ULVRUVH D]LHQGDOL XQLYHUVLWDULH LO KD ULVSRVWR GL
VDSHUOR HIIHWWXDUH DO FRQWUDULR LO QRQ OR FRQRVFH ,O YDOXWD DEEDVWDQ]D IXQ]LRQDOH OD
PRGDOLWjGLDFFHVVRDOOHULVRUVHLOODULWLHQHSRFRIXQ]LRQDOHLOODJLXGLFDPROWRIXQ]LRQDOHH
VRORLOODULWLHQHQRQIXQ]LRQDOH/HULVRUVHYHQJRQRFRQVXOWDWHVSHVVRGDOSRFRGDO
DEEDVWDQ]DGDOHPDLGDO
3URJHWWLLQFROODERUD]LRQHFRQOD5HJLRQH(PLOLD5RPDJQD
3URJHWWR UHJLRQDOH $OOHDQ]D H SUHYHQ]LRQH VHFRQGDULD LQ 5(5 9DOXWD]LRQH GL ULFDGXWD GHOOD
IRUPD]LRQH
/¶RELHWWLYRJHQHUDOHGHOSHUFRUVRIRUPDWLYRqVWDWRTXHOORGLIRUPDUHLSURIHVVLRQLVWLLQIHUPLHULQHOODSUHVD
LQFDULFRPXOWLGLPHQVLRQDOHGHOODSHUVRQDFRQ6LQGURPH&RURQDULFD$FXWD67(0,167(0,8$DOILQHGL
LPSOHPHQWDUHXQSHUFRUVRVWUXWWXUDWRLQWHQVLYRGLSUHYHQ]LRQHVHFRQGDULDFDUGLRYDVFRODUH
/H FRPSHWHQ]H LQIHUPLHULVWLFKH DFTXLVLWH H DJLWH VXO FDPSR VRQR VWDWH FDSDFLWj GL FRFRVWUX]LRQH GL XQ
SLDQR WHUDSHXWLFR SHUVRQDOL]]DWR DWWUDYHUVR XQD DGHJXDWD HGXFD]LRQH VXOO¶DVVXQ]LRQH GL IDUPDFL H
VXOO¶DGHVLRQHDVWLOLGLYLWDFRUUHWWLILQDOL]]DWLLQXOWLPRDOODULGX]LRQHGHOODPRUWDOLWjFDUGLRYDVFRODUHGHO
UHLQIDUWRQRQIDWDOHHGHOORVWURNHQRQIDWDOH
*OLLQIHUPLHULIRUPDWLQHOSURFHVVRDVVLVWHQ]LDOHDOSD]LHQWHFRQ6&$XWLOL]]DQRXQPRGHOORDVVLVWHQ]LDOH
LQWHJUDWR/HDWWLYLWjPHVVHLQSUDWLFDLQWXWWHHWUHOHIDVLGHOSURFHVVRQXUVLQJLQIDWWLULVSHFFKLDQRJOL
DVVXQWL WHRULFL GHO PRGHOOR LQWHJUDWR ,Q PRGR SDUWLFRODUH VL HYLGHQ]LD O¶DGHUHQ]D GHJOL LQWHUYHQWL
HGXFDWLYLQHOODIDVHGHOO¶HGXFD]LRQHULVSHWWRDOPRGHOORWHRULFR4XHVWRDVSHWWRIDDYDQ]DUHO¶LGHDFKHOD
IRUPD]LRQHDFXLJOLLQIHUPLHULKDQQRSDUWHFLSDWRDEELDSURGRWWRGHLFDPELDPHQWLFRPSRUWDPHQWDOLQHOOD
JHVWLRQHGHOSD]LHQWHFRQ6&$HFKHTXLQGLLOPRGHOORLQWHJUDWRFRVuFRPHqVWDWRVWUXWWXUDWRSXzHVVHUH
WUDVIHULWRQHOO¶RSHUDWRGHLSURIHVVLRQLVWLFRQGHOOHLPSOLFD]LRQLFRPHVLqYLVWRDQFKHSUDWLFKH
/HHVSHULHQ]HGHOODULFHUFDUHJLRQDOHVXOUXRORGHL7XWRU
$ SDUWLUH GDO OD QRVWUD $]LHQGD KD FROODERUDWRDO SURJHWWR UHJLRQDOH GL DSSURIRQGLPHQWR GHOO¶DQDOLVL
GHO SURFHVVR WXWRULDOH QHOOH $]LHQGH 6DQLWDULH GHOO¶(PLOLD5RPDJQD SHU OD YDORUL]]D]LRQH H LO
ULFRQRVFLPHQWR GHOOD IXQ]LRQH WXWRULDOH DJLWD ,Q TXHVWR DPELWR D SDUWLUH GDO KD SUHVR LO YLD LO
SURJHWWRULFHUFDD]LRQHDUWLFRODWRLQIDVLGXHGHOOHTXDOLJLjUHDOL]]DWH/DSULPDIDVHqVWDWDUHDOL]]DWD
DWWUDYHUVRODVRPPLQLVWUD]LRQHGLXQTXHVWLRQDULRRQOLQHSHUXQDUDFFROWDGLGDWLTXDQWLWDWLYLDOORVFRSRGL
GHVFULYHUHLOSURFHVVRWXWRULDOHQHOOH$]LHQGH6DQLWDULH$9(1GDOSXQWRGLYLVWDGHLSURIHVVLRQLVWLVDQLWDUL
,TXHVWLRQDULULSRUWDYDQROHJHQHUDOLWjOHIXQ]LRQLVYROWHJOLVWUXPHQWLXWLOL]]DWLSHUVYROJHUHODIXQ]LRQH
WXWRULDOH OD IRUPDOL]]D]LRQH GHOO¶LQFDULFR H LO VXR ULFRQRVFLPHQWR LO FDULFR GL ODYRUR OD YDOXWD]LRQH
GHOO¶DWWLYLWj GL WXWRUDJJLR O¶DJJLRUQDPHQWR H LO ELVRJQR IRUPDWLYR LO VHQVR GL (PSRZHUPHQW H OD
VRGGLVID]LRQHSHUFHSLWDUHODWLYDPHQWHDOUXRORWXWRULDOHVYROWR
3HU UHDOL]]DUH LO VHFRQGR SXQWR GHOOD ULFHUFD VRQR VWDWL UHDOL]]DWL IRFXV JURXS FRQ SURIHVVLRQLVWL GHO
FRPSDUWR H GHOOD GLULJHQ]D SHU RJQL $]LHQGD GHO JUXSSR $9(1 OD FXL ILQDOLWj HUD TXHOOD GL
DSSURIRQGLPHQWR GHOOH FRQRVFHQ]H QHFHVVDULH SHU VYROJHUH OD IXQ]LRQH WXWRULDOH GDO SXQWR GL YLVWD GHL
SURIHVVLRQLVWLHGDOSXQWRGLYLVWDGHOODIRUPD]LRQHUHVSRQVDELOLFRRUGLQDWRUL&'/HFFHWHUD
/¶DQDOLVL GHL GLDORJKL q LQ FRUVR PD DOFXQH VSHFLILFKH VRQR JLj HYLGHQWH GD XQD SULPD DQDOLVL GHOOH
WUDVFUL]LRQL
,WXWRULQWHUYLVWDWLKDQQRFRQVDSHYROH]]DGHOORURUXRORDIIHUPDQRLQIDWWLGLVYROJHUHGLYHUVHIXQ]LRQDOLWj
QRQ OLPLWDWH DO ³VDSHUH´ PD GHO VDSHUH YV LO ³VDSHU IDU IDUH´ H GHO VDSHUH YV LO ³VDSHU HVVHUH´
VRWWROLQHDQGR OD GLPHQVLRQH WHFQLFD IRUPDWLYD PD DQFKH UHOD]LRQDOH HG HWLFD GHOOD WXWRUVKLS ,QROWUH L
WXWRULQWHUYLVWDWLKDQQRHYLGHQ]LDWRFKHSHUSRWHUHVHUFLWDUHODIXQ]LRQHWXWRULDOHRFFRUUH
y
VDSHUHFRQRVFHUH L SULQFLSL SHGDJRJLFL GHOO¶DSSUHQGLPHQWR GHOOD PHWRGRORJLD H GHJOL VWUXPHQWL
GDXWLOL]]DUHGHOODYDOXWD]LRQHIRUPDWLYDHFHUWLILFDWLYD
y
VDSHUIDUIDUHFRQRVFHQ]DGHOOHWHFQLFKHSURFHGXUHVDSHUIDUULIOHWWHUHVXOOHD]LRQLULFRQRVFHUH
OHUHVSRQVDELOLWjOHJDWHDOODSURIHVVLRQHHDOO¶DXWRQRPLDSURIHVVLRQDOH
y
VDSHU HVVHUH UHOD]LRQDUVL H JHVWLUH L FRQIOLWWL IOHVVLELOLWj GLVSRQLELOLWj FDSDFLWj GL DVFROWR
DXWRUHYROH]]DROWUHFKHDWWXDUHXQFRPSRUWDPHQWRHWLFRGHRQWRORJLFR
$SSDUHLQWHUHVVDQWHVRWWROLQHDUHFRPHJOLLQWHUYLVWDWLGLFKLDUDQRFKHVHEEHQHODWXWRUVKLSVLDXQ¶DWWLWXGLQH
FKHVLSXzLPSDUDUHPLJOLRUDUHQRQWXWWLLSURIHVVLRQLVWLSRVVRQRHVVHUHWXWRU5LVSHWWRDOODIRUPD]LRQHL
WXWRUDIIHUPDQRFKHRFFRUUHDYHUHXQ³WURQFRFRPXQH´WUDLSURIHVVLRQLVWLHSRLGLYHUVLILFDUHULVSHWWRDOOD
SURSULD GLVFLSOLQD H FKH WDOH IRUPD]LRQH DEELVRJQD GL XQ UHWUDLQLQJ SHULRGLFR PHJOLR VH FRQWLQXR H
FRPXQTXHSHULRGLFR
,WXWRULQWHUYLVWDWLDSSDLRQRFRQFRUGLQHOO¶DIIHUPDUHFKHRFFRUUHYDORUL]]DUHHULFRQRVFHUHLOUXRORWXWRULDOH
QRQVRORFRQLFUHGLWL(&0PDDQFKHFRQRUHGHGLFDWHDJOLVWXGHQWLDIILGDWLDWWUDYHUVRODIRUPDOL]]D]LRQH
GHOORURUXRORHDQFKHDWWUDYHUVRODYDOXWD]LRQHGHJOLVWXGHQWL
8OWHULRULVXJJHULPHQWLVRQRVWDWLGDWLGXUDQWHLIRFXVJURXSULJXDUGRDOO¶LPSOHPHQWD]LRQHGLXQSURFHVVRGL
FRQIURQWRFRQO¶8QLYHUVLWj
/DWHU]DIDVHLQYLDGLUHDOL]]D]LRQHVLSURSRQHGLFRFRVWUXLUHGHOOHOLQHHGLLQGLUL]]RSHUODGHILQL]LRQHGL
XQSURJUDPPDIRUPDWLYRULYROWRDLSURIHVVLRQLVWLFKHVYROJRQRODIXQ]LRQHGLWXWRUQHOOH$]LHQGHVDQLWDULH
FRLQYROWHQHOODULFHUFD
$WWLYD]LRQHGHOWLURFLQLRFOLQLFRGHOFRUVRWULHQQDOHGLIRUPD]LRQHVSHFLILFDLQPHGLFLQDJHQHUDOH
3HU O¶HVHUFL]LR GHOO¶DWWLYLWj GL PHGLFR GL PHGLFLQD JHQHUDOH 00* QHOO¶DPELWR GHO 6HUYL]LR 6DQLWDULR
1D]LRQDOH q QHFHVVDULR LO SRVVHVVR GHO GLSORPD GL IRUPD]LRQH VSHFLILFD LQ 0HGLFLQD *HQHUDOH FRPH
SUHYLVWRGDL'/JVQGHOQGHOOXJOLRHGDO'0
,O GLSORPD VL DFTXLVLVFH PHGLDQWH OD IUHTXHQ]D DO FRUVR GL IRUPD]LRQH WULHQQDOH LQ 0HGLFLQD *HQHUDOH
/¶$]LHQGD FROODERUD DOOD SLDQLILFD]LRQH GHL WLURFLQL VLD RVSHGDOLHUL FKH LQWHJUDWL FRQ OD $86/ GL 3DUPD
UHODWLYLDOFRUVRGLIRUPD]LRQH
1HOFRUVLVWLKDQQRIUHTXHQWDWRLWLURFLQLLQ$]LHQGDVRWWRODJXLGDGLWXWRUPHGLFL
/¶DWWLYLWjIRUPDWLYDGLQDWXUDSUDWLFDVLVYROJHSUHVVRO
$]LHQGD
6HFRQGRSURJUDPPDUHJLRQDOHLOWRWDOHFRPSOHVVLYRGHOO
DWWLYLWjIRUPDWLYDLQ$]LHQGDFRUULVSRQGHSHUL
DQQL D RUH SHU RJQL FRUVLVWD VXGGLYLVH LQ GXH EUDQFKH VSHFLDOLVWLFKH XQD GL PHGLFLQD H XQD GL
FKLUXUJLDVXSSRUWDWHROWUHFKHGDLWXWRUGL82DQFKHGDWXWRUGLDUHD
/HUHVWDQWLVSHFLDOLWjFKHLFRUVLVWLGHYRQRIUHTXHQWDUHVRQRLQWHJUDWHFRQO
$86/GL3DUPD
1HOFRUVRGHOO
DQQRKDQQRWHUPLQDWRLOORURSHUFRUVRGLWLURFLQLRPHGLFLFKHVLVRQRGLSORPDWLLQ
RWWREUH
3URJHWWLVXVSHFLILFLDUJRPHQWLWHFQLFRVFLHQWLILFL
)RUPD]LRQHGHOFDUHJLYHUQHOODWUDFKHREURQFRDVSLUD]LRQHGRPLFLOLDUH /¶DFFRUGR WUD LO *RYHUQR OH 5HJLRQL H OH 3URYLQFH $XWRQRPH GL 7UHQWR H %RO]DQR GHO DSULOH FRQFHUQHQWHODIRUPD]LRQHGLSHUVRQHFKHHIIHWWXDQRODWUDFKHREURQFRDVSLUD]LRQHDGRPLFLOLRGHOSD]LHQWH
QRQRVSHGDOL]]DWRVDQFLVFHFKHHVVHQGRWDOHSUDWLFDXQDPDQRYUDLQGLVSHQVDELOHFKHVLUHQGHQHFHVVDULD
LQ PRPHQWL QRQ SLDQLILFDELOL H FKH SXz GRYHUH HVVHUH HIIHWWXDWD LQ XUJHQ]D O¶DVSLUD]LRQH HQGRWUDFKHDOH
GHYHSRWHUHVVHUHHIIHWWXDWDDQFKHGDSHUVRQDOHQRQVDQLWDULRIDPLOLDULRDOWULVRJJHWWLFKHDVVLVWRQRLQ
YLD FRQWLQXDWLYD LO SD]LHQWH GL VHJXLWR GHILQLWLFDUH JLYHU VX SUHVFUL]LRQH PHGLFD HG HVFOXVLYDPHQWH GD
VRJJHWWL VSHFLILFDPHQWH DGGHVWUDWL PHGLDQWH XQD IRUPD]LRQH GHILQLWD H SHULRGLFDPHQWH DJJLRUQDWD H
YHULILFDWD
/D WUDFKHREURQFRDVSLUD]LRQH q XQD WHFQLFD FKH ULFKLHGH VSHFLILFKH FRQRVFHQ]H ± DO ILQH GL ULFRQRVFHUH
O¶LQGLFD]LRQH D SURFHGHUH ± H SDUWLFRODUL FDXWHOH SHU HYLWDUH OH FRPSOLFDQ]H FKH SRVVRQR HVVHUH DQFKH
JUDYL &RQVLGHUDWD FKH OD VXGGHWWD SUDWLFD DVVLVWHQ]LDOH UHQGH QHFHVVDULR SURYYHGHUH DG XQD DGHJXDWD
IRUPD]LRQHGHOFDUHJLYHULQPRGRGDSHUPHWWHUHGLLQWHUYHQLUHFRQSURQWH]]DHVLFXUH]]DRJQLTXDOYROWD
VLYHULILFKLODQHFHVVLWjGLWUDFKHREURQFRDVSLUDUHLOSD]LHQWH
,OSHUFRUVRIRUPDWLYRVLHVSOLFDDWWUDYHUVRWUHVWHS
)RUPD]LRQHGLJUXSSRGLODYRURLQWHUD]LHQGDOHFRQFRLQYROJLPHQWRGLSURIHVVLRQLVWLPHGLFLHLQIHUPLHUL
IUHTXHQWHPHQWH D FRQWDWWR FRQ SD]LHQWL WUDFKHRWRPL]]DWL GHOO¶$28 GL 3DUPD H GHOO¶$86/ GL 3DUPD FRQ
O¶RELHWWLYR GL XQD UHYLVLRQH VLVWHPLFD VXOOD WHPDWLFD LQ RJJHWWR H OD IRUPXOD]LRQH GL GXH RSXVFROL
LQIRUPDWLYLXQRULYROWRDLSURIHVVLRQLVWLHXQRULYROWRDLFDUHJLYHU
3HUFRUVRIRUPDWLYRULYROWRDSURIHVVLRQLVWLLQIHUPLHUL$28H$86/GL3DUPDFRQODVXSHUYLVLRQHGL
WXWRU FKH VL HVSOLFKHUj DWWUDYHUVR RUH GL IRUPD]LRQH FRQ PHWRGRORJLH GLGDWWLFKH LQWHUDWWLYH
VLPXOD]LRQH JUXSSL GL ODYRUR H FRQ O¶RELHWWLYR GL DSSURIRQGLUH OH FRQRVFHQ]H GHOOH WHFQLFKH GL
WUDFKHRDVSLUD]LRQHHFRQRVFHQ]HHGXFDWLYH
)RUPD]LRQHGHOOHFDSDFLWjWHFQLFKHQHOODWUDFKHRDVSLUD]LRQHGHOFDUHJLYHUHUHODWLYDFHUWLILFD]LRQHGD
SDUWHGHLSURIHVVLRQLVWLIRUPDWL
,O SHUFRUVR IRUPDWLYR VDUj YDOXWDWR DWWUDYHUVR XQ WHVW GL JUDGLPHQWR GHOOD IRUPD]LRQH ULYROWR DL GLYHUVL
GHVWLQDWDULGHOODIRUPD]LRQHJUXSSRGLODYRURLQIHUPLHULFDUHJLYHU
)RUPD]LRQH LQWUDRVSHGDOLHUD QHOO¶(PHUJHQF\ &DUGLRYDVFXODU &DUH (&& H $FXWH &DUGLRYDVFXODU
&DUH $&& FRUVL GL ULDQLPD]LRQH GL EDVH H DYDQ]DWL SHU LO SHUVRQDOH GHOO¶$]LHQGD 2VSHGDOLHUR
8QLYHUVLWDULD
,O SURJHWWR GL IRUPD]LRQH LQWUDRSVHGDOLHUD QHOO¶(PHUJHQF\ &DUGLRYDVFXODU &DUH H $FXWH &DUGLRYDVFXODU
&DUH FRLQYROJH WXWWH OH XQLWj RSHUDWLYH GHOO¶$]LHQGD H SUHYHGH OD UHDOL]]D]LRQH GL XQ SHUFRUVR IRUPDWLYR
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
FRQWLQXR H VRVWHQLELOH QHO FDPSR GHOO¶HPHUJHQ]DXUJHQ]D FDUGLRYDVFRODUH SHU WXWWR LO SHUVRQDOH VDQLWDULR
GHOO¶$]LHQGD
LOSURJHWWRDOVXRVHFRQGRDQQRGLDWWLYLWjHGHOODGXUDWDGLWUHDQQLVLDUWLFRODLQDOFXQLSXQWL
&RUVL GL ULDQLPD]LRQH GL EDVH UHDOL]]D]LRQH GLXQ SHUFRUVR IRUPDWLYR FRQWLQXR H VRVWHQLELOH SHUWXWWL L
GLSHQGHQWLGHOO¶$]LHQGD2VSHGDOLHUR8QLYHUVLWDULD
&RUVL GL ULDQLPD]LRQH DYDQ]DWL UHDOL]]D]LRQH GL XQ SHUFRUVR IRUPDWLYR FRQWLQXR H VRVWHQLELOH SHU L
PHGLFL H LQIHUPLHUL GHOOH WHUDSLH LQWHQVLYH GHO 3URQWR 6RFFRUVR 2%, 0HGLFLQD G¶8UJHQ]D &DUGLRORJLD H
&DUGLRFKLUXUJLDGHOO¶$]LHQGD2VSHGDOLHUR8QLYHUVLWDULD
&RUVL GL $FXWH &DUGLRYDVFXODU &DUH +LJK )LGHOLW\ ± &ULVLV 5HVRXUFH 0DQDJHPHQW $&& +)&50´
UHDOL]]D]LRQHGHLFRUVL$&&+)&50HGLXQFHQWURDXWRQRPRSHUTXHVWLFRUVL5DSSUHVHQWDQRO
LQQRYD]LRQH
GHOO
DQQR 6L UHDOL]]HUDQQR QHO FHQWUR GL VLPXOD]LRQH DXWRQRPR D]LHQGDOH H VDUDQQR LQGLUL]]DWL DO
SHUVRQDOH PHGLFL H LQIHUPLHUL FKH KD JLj ULFHYXWR XQD IRUPD]LRQH DYDQ]DWD QHOOD JHVWLRQH GHOOD
ULDQLPD]LRQH FDUGLRSROPRQDUH H FKH RSHUD QHOOH WHUDSLH LQWHQVLYH LQ 3URQWR 6RFFRUVR 2%, 0HGLFLQD
G¶8UJHQ]D&DUGLRORJLDH&DUGLRFKLUXUJLD7,
1RYLWj LQ PHULWR DL FRUVL %/6' q VWDWD TXHOOD GHOOD UHDOL]]D]LRQH GL XQ FRUVR %/6' )$' FKH D SDUWLUH GD
VHWWHPEUH GHO YHUUj SURSRVWR DL SURIHVVLRQLVWL GL DOFXQH 82 6L WUDWWD GL XQ FRUVR DVVROXWDPHQWH
LQQRYDWLYR QRQ HVLVWHQGR LQ (XURSD DOPHQR SHU LO PRPHQWR HVSHULHQ]H VLPLOL (¶ UDSSUHVHQWDWR GD XQ
SHUFRUVR HOHDUQLQJ GHOOD GXUDWD GL DOPHQR PLQXWL FKH L SDUWHFLSDQWL DO FRUVR %/6' GHYRQR HVHJXLUH
SULPDGLSURFHGHUHDOODSDUWHSUDWLFDVXOPDQLFKLQR,YDQWDJJLVRQRTXHOOLGLXQDXOWHULRUHULGX]LRQHGHOOD
WHPSLVWLFDGHLFRUVLFRQODFRQVHJXHQWHSRVVLELOLWjGLHURJDUOLDGXQPDJJLRUQXPHURGLVDQLWDULGLSRWHU
HVHJXLUHUHWUDLQLQJSHULRGLFLGLPLQRUGXUDWDULVSHWWRDLFRUVLDWWXDOL
3HULFRUVLGLULDQLPD]LRQHDYDQ]DWLRUJDQL]]DWLSHUPHGLFLHLQIHUPLHULGHOODVWHVVD82qVWDWDLQVHULWDOD
YDULDELOHGHLSXQWL&50LQL]LDQGRDIRFDOL]]DUHLSULQFLSL&50RYYHURXQD VHULHGLFRQFHWWLWHRULFLSHUOD
SUHYHQ]LRQH H OD JHVWLRQH GHOOH VLWXD]LRQL FULWLFKH FKH SRVVRQR SUHVHQWDUVL GXUDQWH OD QRUPDOH DWWLYLWj
FOLQLFD GHO SHUVRQDOH VDQLWDULR 4XHVWL FRQFHWWL WHRULFL VRQR UDSSUHVHQWDWL GD DOFXQL SXQWL FKH YHQJRQR
ULDVVXQWLLQ³FKLDUH]]DGHLUXROL´³FRUUHWWDGHOODFRPXQLFD]LRQH´³VXSSRUWRGHOSHUVRQDOH´³JHVWLRQHGHOOH
ULVRUVH´H³YDOXWD]LRQHJOREDOH´HFKHVLSRVVRQRULDVVXPHUHEUHYHPHQWHLQDOFXQLDVSHWWLFRQFHWWXDOLHGL
FRPSRUWDPHQWRGHLSURIHVVLRQLVWLFRPH³ODULDQLPD]LRQHFDUGLRSROPRQDUHqXQ¶DWWLYLWjVYROWDLQWHDP´³VL
UDJJLXQJRQR SHUIRUPDQFH HOHYDWH VROR VH LO WHDP q FRRUGLQDWR´ ³O¶LQDGHJXDWH]]D GHOOD FRPXQLFD]LRQH H
GHO ODYRUR GL VTXDGUD VRQR WUD L ³IDWWRUL XPDQL´ UHVSRQVDELOL GHJOL HUURUL H GHO IDOOLPHQWR GHOOD
ULDQLPD]LRQH´
/D UHDOL]]D]LRQH GL XQ FHQWUR GL VLPXOD]LRQH DQFKH SHU L FRUVL DYDQ]DWL DG DOWD IHGHOWj q LQL]LDWD QHO
VHFRQGR VHPHVWUH GHO 3HU OD VHQVLELOL]]D]LRQH GHO SHUVRQDOH GHOO¶$]LHQGD 2VSHGDOLHUD q VWDWR
RUJDQL]]DWR QHO VHWWHPEUH XQ &RQYHJQR GDO WLWROR ³)RUPD]LRQH ,QWUDRVSHGDOLHUD QHOO¶(PHUJHQF\
&DUGLRYDVFXODU &DUH QXRYL SHUFRUVL H SURVSHWWLYH IXWXUH´ DO TXDOH KDQQR SUHVR SDUWH ROWUH SDUWHFLSDQWLÊVWDWRRUJDQL]]DWRXQSULPRFRUVRGL$&&+)&50SHUJOLLVWUXWWRULGHOFHQWURGLVLPXOD]LRQH
%,26 H WUD TXHVWL VRQR VWDWL VHOH]LRQDWL DOFXQL SRWHQ]LDOL LVWUXWWRUL PHGLFL H LQIHUPLHUL FKH KDQQR
SDUWHFLSDWR DO , FRUVR ,VWUXWWRUL 1D]LRQDOH FKH q VWDWR VYROWR D 3DUPD QHO GLFHPEUH GHO ,O FRUVR LQ
RJJHWWR KD YLVWR OD SDUWHFLSD]LRQH GL 3HWHU 'LFNPDQ HVSHUWR GL IDPD LQWHUQD]LRQDOH VXOOD VLPXOD]LRQH H
VXOODIRUPD]LRQHGHJOLDGXOWLDXWRUHGHOODOLQHDJXLGDVXOODIRUPD]LRQHFRQSULQFLSL&50
,QROWUHLOFHQWURGLVLPXOD]LRQH%,26KDFRQWLQXDWRDRUJDQL]]DUHFRUVL%/6'VDQLWDULHODLFLSHUHVWHUQL
,FRUVLSHULOSHUVRQDOHGHOO¶$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDVRQRULDVVXQWLQHOODWDEHOODGLVHJXLWR
/ŶĨĞƌŵŝĞƌŝ
DĞĚŝĐŝ
KZ^/>^
ůƚƌŽ
;ĨŝƐŝŽƚ͘Ͳ
ƚĞĐŶŝĐŝͿ
K^^
dŽƚĂůĞ
/ŶĨĞƌŵŝĞƌŝ
KZ^/>^
DĞĚŝĐŝ
dŽƚĂůĞ
/ŶĨĞƌŵŝĞƌŝ
KZ^/,&ͲZD
DĞĚŝĐŝ
dŽƚĂůĞ
ϮϬϭϮ
ϮϬϭϯ
ϭϴϭ
ϮϬϮ
ϭϰϱ
ϭϴϯ
Ϯϲ
ϯϵ
ϳϱ
ϲϮ
ϰϮϳ
ϰϴϲ
ϰϭ
ϲϱ
ϰϯ
ϴϴ
ϴϰ
ϭϱϯ
ͬ
Ϯϴ
ͬ
ϭϰ
ͬ
ϰϮ
3URJHWWLGL&RPXQLFD]LRQH
/DQDUUD]LRQH
,OSURJHWWRSUHYHGHXQSHUFRUVRGLIRUPD]LRQHD]LRQHFRQODILQDOLWjGLIRUQLUHDLSURIHVVLRQLVWLVDQLWDULJOL
VWUXPHQWLSHUVYLOXSSDUHXQDFRPSUHQVLRQHSLDGHJXDWDGHOODPDODWWLDGHOODPHGLFLQDHGHLSHUFRUVLGL
FXUD D SDUWLUH GD XQD IHQRPHQRORJLD GHL YLVVXWL GL PDODWWLD GHO SD]LHQWH H GHOOH UHODWLYH FRVWUX]LRQL GL
VLJQLILFDWR VWLPRODUH L SURIHVVLRQLVWL VWHVVL D ULSHQVDUH L SURSUL YLVVXWL SURIHVVLRQDOL TXDOL HVSHULHQ]H
VLJQLILFDWLYH LQ UHOD]LRQH DL SHUFRUVL GL FXUD LQ FXL HVVL RSHUDQR VYLOXSSDUH VSHFLILFKH FRPSHWHQ]H
QDUUDWLYHGLWLSRIHQRPHQRORJLFRULSHQVDUHODVWHVVDRUJDQL]]D]LRQHGHLSHUFRUVLGLFXUDHOHORURDWWLYLWj
DO ORUR LQWHUQR DO ILQH GL PLJOLRUDUQH OD TXDOLWj LQ WHUPLQL GL DSSURSULDWH]]D DFFHVVLELOLWj DFFHWWDELOLWj H
VRGGLVID]LRQHGHOSD]LHQWHVWHVVR
/¶HVSHULHQ]DIRUPDWLYDVXOOHUHOD]LRQLLQWHUSURIHVVLRQDOLLQDUHDVDQLWDULD
,O FRQYHJQR D QRYHPEUH ³/H UHOD]LRQL LQWHUSURIHVVLRQDOL LQ DUHD VDQLWDULD ULVFRSULUH OD
FROODERUD]LRQH8Q¶HVSHULHQ]DGLIRUPD]LRQHHSURSRVWHGLVYLOXSSR´KDVLQWHWL]]DWRHVRFLDOL]]DWRLOODYRUR
GL ULFHUFDD]LRQH VXOOH UHOD]LRQL LQWHUSURIHVVLRQDOL LQ DUHD VDQLWDULD UHDOL]]DWR LQ D]LHQGD QHOO¶DUFR GL XQ
SHULRGRGLTXDVLTXDWWURDQQLGDODO
7DOHFRQYHJQRKDFROWRO
XUJHQ]DGLYDORUL]]DUHPROWHSOLFLVIRU]LFKHUHQGRQRSRVVLELOHODWHQXWDG
LQVLHPH
GL XQ
RUJDQL]]D]LRQH FRPSOHVVD H VL q DSHUWR FRQ OD GHVFUL]LRQH GHO SHUFRUVR GDOO¶DQDOLVL GHO ELVRJQR
IRUPDWLYR DOO¶HVSHULHQ]D GL ULFHUFDD]LRQH H DOOD IRUPD]LRQH UHDOL]]DWD ,Q SDUWLFRODUH L FRQWHQXWL
HPHUJHQWL KDQQR ULJXDUGDWR OH SUDWLFKH GL FROODERUD]LRQH QHOO¶RUJDQL]]D]LRQH VDQLWDULD FRQ L UHODWLYL HVLWL
GHLSHUFRUVLIRUPDWLYL
6RQR HPHUVL GLYHUVL WHPL TXDOL LO ODYRUR GL UHWH O¶LQWHJUD]LRQH OD PXOWLGLVFLSOLQDULHWj H OD FRQGLYLVLRQH
LQWHUSURIHVVLRQDOH GHOOD FXUD VKDUHG FDUH FKH VL FRQQHWWRQR DO FRQFHWWR GHOOD FROODERUD]LRQH
LQWHUSURIHVVLRQDOH
$OWUR DVSHWWR FDUGLQH q OD VFRSHUWD GHOOD FROODERUD]LRQH UHVLOLHQWH H OH UHODWLYH SUDWLFKH FROODERUDWLYH 6L
WUDWWD GL TXHOOH SUDWLFKH RUGLQDULH GL FXL q LQWHVVXWD OD TXRWLGLDQLWj GHO ODYRUR GL FXUD FKH YHGRQR L
SURIHVVLRQLVWLGHOODVDOXWHDIIHUHQWLDFRPXQLWjSURIHVVLRQDOLHVWUXWWXUHRUJDQL]]DWLYHGLIIHUHQWLPHWWHUH
LQJLRFROHUHJROHRUJDQL]]DWLYHSHUUDJJLXQJHUHVSHFLILFLRELHWWLYLGLFXUD
/
DQDOLVL GHOOH FULWLFLWj LQWHUSURIHVVLRQDOL FRQ XQD ULIOHVVLRQH YHLFRODWD GDL FRQWHQXWL GHOOD FROODERUD]LRQH
UHVLOLHQWH q VWDWD XQD WHPDWLFD FRQ ³VIXPDWXUH´ WUDVYHUVDOL FKH KD YLVWR XQ FRLQYROJLPHQWR DWWLYR GHL
SDUWHFLSDQWLGXUDQWHOHGLVFXVVLRQLGHOODJLRUQDWD
&RXQVHOOLQJ RUJDQL]]DWLYR HTXLSH SURIHVVLRQDOH FXOWXUD RUJDQL]]DWLYD SURIHVVLRQDOLWj HG
HPR]LRQL
/¶DYHUH FXUD GHL SURIHVVLRQLVWL HGHOORUR PLFURVLVWHPD LPSOLFD OD YDOXWD]LRQHGHO ELVRJQR UHOD]LRQDOH HG
RUJDQL]]DWLYRDWXWWLLOLYHOOLGLUHVSRQVDELOLWjDFFRPSDJQDUHWXWWDO¶RUJDQL]]D]LRQHDGLVVROYHUHO¶HYHQWXDOL
SUREOHPDWLFKHHDLQGLYLGXDUQHSRVVLELOLVWUDWHJLHGLULVROX]LRQH
/¶RELHWWLYR SULQFLSDOH q VWDWR TXHOOR GL IDFLOLWDUH OD VXSHUYLVLRQH GL VLWXD]LRQL UHOD]LRQDOL H RUJDQL]]DWLYH
DOO¶LQWHUQRGHOO¶HTXLSHGLODYRURGRYHLFRQWHQXWLSRVVLELOLQHOSHUFRUVRSRVVRQRHVVHUHVXGGLYLVLLQTXDWWUR
DUHHWHPDWLFKHLQWHJUDWH
/$ 5(/$=,21( ( /$ &2081,&$=,21( ± /( (02=,21, OD UHOD]LRQH FRQ VH VWHVVL H FRQ JOL DOWUL QHO
FRQWHVWRSURIHVVLRQDOHULIOHVVLRQLVXOODSURSULDFDSDFLWjGLDVFROWROHGLQDPLFKHUHOD]LRQDOLQHOO¶HTXLSHGL
ODYRURFOLPDRUJDQL]]DWLYRGLQDPLFKHGLJUXSSRDOILQHGHOO¶LQWHJUD]LRQHPXOWLSURIHVVLRQDOHJHVWLRQHGHO
FRQIOLWWR
/$ &8/785$ 25*$1,==$7,9$ ± /$ 5(63216$%,/,7$¶ 352)(66,21$/( DQDOLVL GHO SURSULR FRQWHVWR
SURIHVVLRQDOH LO FDPELDPHQWR SURIHVVLRQDOH FXOWXUDOH HRUJDQL]]DWLYR OD UHVSRQVDELOLWj SURIHVVLRQDOH OD
SRVL]LRQH SURIHVVLRQDOH YV UHOD]LRQDOH LO Vp SURIHVVLRQDOH YV SHUVRQDOH O¶LQGLYLGXD]LRQH GHL YDUL OLYHOOL GL
UHVSRQVDELOLWjQHOODULVROX]LRQLGLSUREOHPDWLFKHRUJDQL]]DWLYH
/HPRGDOLWjGLYDOXWD]LRQHGHOELVRJQRVRQRVWDWHFROORTXLLQGLYLGXDOLGLJUXSSRHULXQLRQL
/H PRGDOLWj GL DSSUHQGLPHQWR VRQR VWDWH SDUWLFRODUPHQWH DWWLYH LQ WXWWH OH JLRUQDWH DWWUDYHUVR
HVHUFLWD]LRQLHVSHULHQ]LDOLVLPXODWHODYRULLQJUXSSR
, ULVXOWDWL RWWHQXWL VRQR VWDWL VX GXH OLYHOOL VRVWHQHUH SHU GLVVROYHUH FRQWUDVWL H FRQIOLWWL UHOD]LRQDOL
QHOO¶HTXLSH DWWUDYHUVR LO FRXQVHOOLQJ LQGLYLGXD]LRQH GHOOH SUREOHPDWLFKH RUJDQL]]DWLYH GHOOH DWWLYLWj
GHOO¶82SHVDQGRQHOHSULRULWj
,ULVXOWDWLUDJJLXQWLVRQRVWDWLVHQVRGLDSSDUWHQHQ]DDTXHOJUXSSRLQIRUPD]LRQHFRQVDSHYROH]]DDOIDUH
JUXSSR PRWLYD]LRQH DO FDPELDPHQWR RUJDQL]]DWLYRHUHOD]LRQDOH YHUVXV LO JUXSSR PDJJLRUH FRQRVFHQ]D
GHOO¶DOWURFOLPDFROODERUDWLYRLQWHUSURIHVVLRQDOHPDJJLRUFRQRVFHQ]DGHOOHFRPSHWHQ]HSURSULHHGHOO¶DOWUR
SURIHVVLRQLVWD ,QIHUPLHUH 2660HGLFL PDJJLRUH FRQVDSHYROH]]D DOO¶DVFROWR DSSUHQGLPHQWR
FRRSHUDWLYR
&RPHPLJOLRUDUHODUHOD]LRQHFRQO¶DQ]LDQRDWWLYLWjGLDQLPD]LRQHLQRVSHGDOH
/¶RELHWWLYR GL TXHVWD LQL]LDWLYD IRUPDWLYD q TXHOOR GL SUHVHUYDUH H SURPXRYHUH LO VLJQLILFDWR GHOOD YLWD
GHOO¶DQ]LDQRLQRVSHGDOHUHQGHQGRODDOFRQWHPSRSLSLDFHYROH/¶DQLPD]LRQHVRFLDOHqXQDSUDWLFDVRFLDOH
LQGLUL]]DWDDOODSUHVDGLFRVFLHQ]DHDOORVYLOXSSRGHOSRWHQ]LDOHGHJOLLQGLYLGXLSLFFROLJUXSSLHFRPXQLWj
$WWUDYHUVR LO SHUFRUVR IRUPDWLYR GHOOD GXUDWD GL RUH VL q FHUFDWR GL VHQVLELOL]]DUH JOL RSHUDWRUL GHO
FRQWHVWR JHULDWULFRULDELOLWDWLYR DOOH WHFQLFKH GL DQLPD]LRQH FRQ O¶RELHWWLYR GL IDYRULUH OD VRFLDOL]]D]LRQH
GHOO¶DQ]LDQRDOO¶LQWHUQRGHOUHSDUWRIDYRULUHPRPHQWLGLSDUWHFLSD]LRQHVSD]LGLDXWRQRPLDHRFFDVLRQLGL
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
FRLQYROJLPHQWR GLPLQXLUH LO VHQVR GL VROLWXGLQH GHOO¶DQ]LDQR QRQFKp IDYRULUH LO PDQWHQLPHQWR GHOOH
FDSDFLWj ILVLFKH FRJQLWLYH VRFLDOL 2ELHWWLYR GHOOD IRUPD]LRQH HUD TXHOOR GL JLXQJHUH DG XQD
FRQVDSHYROH]]D HPSDWLFD QHL FRQIURQWL GHO SD]LHQWH DWWUDYHUVR XQ ODYRUR LQWURVSHWWLYR LQ FXL L
SDUWHFLSDQWL266HLQIHUPLHULHUDQRFKLDPDWLD³PHWWHUVLQHLSDQQLGHOO¶DOWUR´/DPHWRGRORJLDXWLOL]]DWD
qVWDWDLQWHUDWWLYDDWWUDYHUVRVLPXOD]LRQLGLVFXVVLRQLLQSOHQDULDODYRULGLFRSSLD
,OSHUFRUVRIRUPDWLYRqVWDWRPLVXUDWRDWWUDYHUVRXQWHVWGLJUDGLPHQWRFRPSLODWRDOWHUPLQHGHOSHUFRUVR
&XUDUHODUHOD]LRQHSHUSUHQGHUVLFXUDGHOODSHUVRQD,PSLHJRGLYRORQWDULLQVHUYL]LRFLYLOH
/
DQ]LDQLWj SRUWD FRQ Vp XQD VHULH GL FDPELDPHQWL VHQVRULDOL ILVLFL H SVLFRORJLFL $OWHUD]LRQL FKH
FRQGXFRQR OD SHUVRQD YHUVR XQD JOREDOH IUDJLOLWj 3HU WDOL UDJLRQL OD SHUVRQD DQ]LDQD QHFHVVLWD GL
DWWHQ]LRQLSDUWLFRODULVLDQHOO
DPELWRDVVLVWHQ]LDOHFKHQHOO
DPELWRGHLGLULWWLVRFLDOL$UWLROL&RUELQ
GHILQLVFH FROXL FKH VL SUHQGH FXUD GL XQD SHUVRQD FKL GLVSRQH GL FRQRVFHQ]H FRPSHWHQ]H
UHOD]LRQDOLHGHPRWLYHHGLFDSDFLWjGLSUREOHPVROYLQJHGLGHFLVLRQPDNLQJ3HUTXHVWHUDJLRQLHSHUOD
SDUWLFRODULWjGHOSD]LHQWHO¶$]LHQGDKDGHFLVRGLVYLOXSSDUHLOSURJHWWR³&XUDUHODUHOD]LRQHSHUSUHQGHUVL
FXUD GHOOD SHUVRQD´ GHO 6HUYL]LR &LYLOH FIU LO SDUDJUDIR GHGLFDWR QHO FDSLWROR VH]LRQH &HQWUDOLWj GHO
FLWWDGLQR SUHVVR OD /XQJRGHJHQ]D &ULWLFD VH]LRQH GHGLFDWD D SD]LHQWL PDJJLRUPHQWH VWDELOL]]DWL GDO
SXQWRGLYLVWDFOLQLFRPDELVRJQRVLGLFXUHLQIHUPLHULVWLFKHHULDELOLWDWLYHDGHOHYDWDLQWHQVLWjSHUIDYRULUH
LOULHQWURQHOFRQWHVWRIDPLOLDUHHVRFLDOHGLSURYHQLHQ]D/
RELHWWLYRJHQHUDOHGHOSURJHWWRSHUO
LPSLHJRGL
YRORQWDULLQVHUYL]LRFLYLOHqTXHOORGLLQWURGXUUHSUHVVRLO'LSDUWLPHQWR/XQJRGHJHQ]DLQDPELWR*HULDWULFR
5LDELOLWDWLYR H QHOOR VSHFLILFR LQ /XQJRGHJHQ]D &ULWLFD H 3RVW $FX]LH RSSRUWXQLWj UHOD]LRQDOL SHU JOL XWHQWL
FKH SRVVDQR SRVLWLYDPHQWH LQIOXLUH VXL ULVXOWDWL GL FXUD H LQFLGHUH VXOOD FRQFH]LRQH FRPXQH GHOO
RVSHGDOH
FRPH OXRJR ³DOWUR´ GDOO
DPELHQWH GL YLWD H GL UHOD]LRQH 1HOOR VSHFLILFR TXLQGL LO SURJHWWR VL SURSRQH GL
FUHDUHXQDPELHQWHFRPXQLFDWLYRHUHOD]LRQDOHSRVLWLYRSHULOSD]LHQWHHLVXRLIDPLOLDULLQXQFRQWHVWRLQ
FXL ULVXOWD HVVHUH PHQR FRQWLQXR H VWUXWWXUDWR LO FRQWULEXWR GL LQL]LDWLYH SURYHQLHQWL GDO FRQWHVWR VRFLDOH
WHUULWRULDOHHGDOYRORQWDULDWR
/DIRUPD]LRQHGHJOLRSHUDWRULVDQLWDULQHOO¶DPELWR
UHOD]LRQDOHGDOODFXUDDOSUHQGHUVLFXUD
1HO PHVH GL PDJJLR VRQR VWDWH UHDOL]]DWH GXH HGL]LRQL GHO FRUVR ³/D &RPXQLFD]LRQH LQ 7HUDSLD
,QWHQVLYD´HQWUDPEHDFFUHGLWDWH(&0SURPRVVHGDOODSVLFRORJDGHO6HUYL]LRGL3VLFRORJLD2VSHGDOLHUD,O
FRUVR KD DIIURQWDWR LO WHPD GHOOD UHOD]LRQH FRQ L SD]LHQWL H L IDPLOLDUL LQ WHUDSLD LQWHQVLYD DWWUDYHUVR
O¶XWLOL]]R GL XQD PHWRGRORJLD GLQDPLFD SUHYDOHQWHPHQWH EDVDWD VX YLVLRQH GL ILOPDWL H YLGHRUHJLVWUD]LRQL
VSD]L GL FRQGLYLVLRQL H FRQIURQWR GHOOH SURSULH HVSHULHQ]H GHL SDUWHFLSDQWL Q SDUWHFLSDQWL SHU
HGL]LRQH )UD L WHPL DSSURIRQGLWL VL ULFRUGDQR OD FRPXQLFD]LRQH FRQ LO SD]LHQWH H FRQ L IDPLOLDUL OH
HPR]LRQL GHOO¶RSHUDWRUH O¶DJHQGD GHO SD]LHQWH OD PHGLFLQD FHQWUDWD VXOOD PDODWWLD H TXHOOD FHQWUDWD VXO
SD]LHQWHO¶DSHUWXUDGHOOHWHUDSLHLQWHQVLYHHO¶XPDQL]]D]LRQHGHOODFXUD
*OLXOWHULRULLQWHUYHQWLDWWLYDWLQHOYROWLDSURPXRYHUHORVYLOXSSRGHOOHFRPSHWHQ]HUHOD]LRQDOLGHJOL
RSHUDWRULDOILQHGLPLJOLRUDUHLOUDSSRUWRGHOO¶RUJDQL]]D]LRQHFRQJOLXWHQWLHFRQLFLWWDGLQLHSHUVRVWHQHUH
JOL RSHUDWRUL LPSHJQDWL QHOOD SURIHVVLRQH GL DLXWR QHO WHQWDWLYR GL ULGXUUH L IHQRPHQL GL EXUQRXW VRQR
VWDWLUHQGLFRQWDWLQHOODVH]LRQHSUHFHGHQWH)RUPD]LRQH
6LVWHPDLQIRUPDWLYRGHOSHUVRQDOH
,O VLVWHPD LQIRUPDWLYR GHO SHUVRQDOH VL FRQILJXUD FRPH XQ FRPSOHVVR GL HOHPHQWL LQ JUDGR GL IRUQLUH XQ
HIILFDFH VXSSRUWR SHU GLVSRUUH GL WXWWH OH LQIRUPD]LRQL FKH VRQR QHFHVVDULH SHU GHFLGHUH JHVWLUH HG
RSHUDUH
,Q XQ FRQWHVWR LQ FXL OD VWUDWHJLD GHOO¶$]LHQGD VL PRGLILFD QHO WHPSR H VHPSUH SL UDSLGDPHQWH VL
PRGLILFDQR JOL RELHWWLYL GD SHUVHJXLUH LQ UHOD]LRQH DOOD SHFXOLDULWj GHOOH IXQ]LRQL H DL VHPSUH FUHVFHQWL
GHELWL LQIRUPDWLYL VLD LQWHUQL FKH HVWHUQL GLYHQWD LQGLVSHQVDELOH GLVSRUUH GL XQ VLVWHPD DJJLRUQDWR H
FRPSOHWR
&RQ ULIHULPHQWR DO VLVWHPD LQIRUPDWLYR GHO SHUVRQDOH QHO FRUVR GHOO¶DQQR q SURVHJXLWD O¶DWWLYLWj GL
DJJLRUQDPHQWR GHO VRIWZDUH GL JHVWLRQH GHO SHUVRQDOH MRE WLPH PRGXOR JLXULGLFR PHGLDQWH
O¶LPSOHPHQWD]LRQH GL VH]LRQL GHGLFDWH GDOO¶LQVHULPHQWR GHL GDWL UHODWLYL DJOL LQFDULFKL GLULJHQ]LDOL GL
SRVL]LRQHRUJDQL]]DWLYDHGLFRRUGLQDPHQWRSHUODPDSSDWXUDGHOOHSRVL]LRQLHODJHVWLRQHGHOOHVFDGHQ]H
GHJOLVWHVVL
,QROWUHVHPSUHQHOO¶DPELWRGHOPRGXORJLXULGLFRVLqSURYYHGXWRDGDWWLYDUHODSDUWHUHODWLYDDOODJHVWLRQH
GHOOHLQIRUPD]LRQLGHOSHUVRQDOHWLWRODUHGLFRQWUDWWLOLEHURSURIHVVLRQDOHHGLFROODERUD]LRQHQRQFKpGHJOL
LQFDULFKL GL GRFHQ]D &Lz FRQ O¶RELHWWLYR GL IDFLOLWDUH OD FRQVXOWD]LRQH GHL GDWL GL LQWHUHVVH D]LHQGDOH H
VRSUDWWXWWRLOULVSHWWRGHOODQRUPDWLYDYLJHQWHLQPDWHULDGLVLFXUH]]DLQIRUPDWLFDSULYDF\HJHVWLRQHGHL
GDWLSHUVRQDOLQRQFKpGLGLVSRUUHGLXQD$QDJUDILFDXQLFDD]LHQGDOH
1HOFRUVRGHOLQROWUHDOILQHGLRWWHPSHUDUHDOGHFUHWROHJLVODWLYRQLQPHULWRDJOLREEOLJKL
GL SXEEOLFLWj VXO VLWR LQWHUQHW D]LHQGDOH GL XQD VHULH GL LQIRUPD]LRQL UHODWLYH DO SHUVRQDOH GLSHQGHQWH H
FRQVXOHQWLFROODERUDWRUL VL q SURYYHGXWR DOOD FUHD]LRQH GL DSSRVLWH VWUXWWXUH H FROOHJDPHQWL LQIRUPDWLFL
FKH FRQVHQWRQR OD SXEEOLFD]LRQH LQ YLD DXWRPDWLFD GHL GDWL ULFKLHVWL DWWLQJHQGR GLUHWWDPHQWH GDOOH
LQIRUPD]LRQLFKHYDQQRDGDOLPHQWDUHODSURFHGXUDGLJHVWLRQHGHOSHUVRQDOH
6L q DOWUHVu SURVHJXLWD O¶DWWLYLWj GL DJJLRUQDPHQWR GHOOD VH]LRQH GHOOD ,QWUDQHW $]LHQGDOH GHGLFDWD DO
6HUYL]LR *HVWLRQH H 6YLOXSSR GHO 3HUVRQDOH DO ILQH GL UHQGHUH IDFLOPHQWH DFFHVVLELOL H GLVSRQLELOL DO
SHUVRQDOHOHLQIRUPD]LRQLHOHQRYLWjUHODWLYHDOUDSSRUWRGLODYRURQRQFKpODPRGXOLVWLFDQHFHVVDULDSHUOD
SUHVHQWD]LRQHGHOOHGLYHUVHLVWDQ]HHULFKLHVWHDGHVHPSLRIHULHDVSHWWDWLYHSHUPHVVLHFFHWHUD
,QILQHVLqPDQWHQXWRLOUXRORGL³5HJLVWUDWLRQ$XWKRULW\´FRQWLQXDQGRO¶DXWRQRPDDWWLYLWjGLRUGLQHGHOOH
&DUWH1D]LRQDOLGHL6HUYL]LFG&16D&83HODORURFRQVHJXHQWHDWWLYD]LRQHIRUQHQGRVXSSRUWR
DJOL RSHUDWRUL QHOOD IDVH GL SULPR XWLOL]]R H GL HYHQWXDOH PDOIXQ]LRQDPHQWR FRQ LO FRVWDQWH
LQWHUIDFFLDPHQWRFRQLO6HUYL]LRLQIRUPDWLYRD]LHQGDOHHLWHFQLFLUHIHUHQWLGL&83
6WUXWWXUDGHOOHUHOD]LRQLFRQLOSHUVRQDOHGLSHQGHQWH
HFRQOHVXHUDSSUHVHQWDQ]H
5HOD]LRQLVLQGDFDOL
$QFKH O¶DPELWR QHJR]LDOH GHO q VWDWR FDUDWWHUL]]DWR GDO TXDGUR QRUPDWLYR QD]LRQDOH H UHJLRQDOH
DWWXDWLYRGHOOHPLVXUHGLFRQWHQLPHQWRGHOODVSHVDGHOSHUVRQDOH
/D VRVWHQLELOLWj HFRQRPLFRILQDQ]LDULD GHO 665 q VWDWD FDUDWWHUL]]DWD GD XQD ULGX]LRQH GHOOH ULVRUVH
GLVSRQLELOL H KD ULFKLHVWR XQ JRYHUQR DWWHQWR GHOOD VSHVD VDQLWDULD QRQFKp OD WHPSHVWLYD DWWXD]LRQH GL
SROLWLFKH GL UD]LRQDOL]]D]LRQH H GL ULRUJDQL]]D]LRQH GHO VLVWHPD QHO ULVSHWWR GHO TXDGUR QRUPDWLYR GL
SDUHJJLRGLELODQFLR
$ OLYHOOR DWWXDWLYR VRQR VWDWL DYYLDWL SURFHVVL GL LQWHJUD]LRQH GL DWWLYLWj H IXQ]LRQL WUD $]LHQGH SHU
FRQGLYLGHUH OH SURIHVVLRQDOLWj UD]LRQDOL]]DQGR ULVRUVH WHFQRORJLFKH H XPDQH FRQFHQWUDQGR
VWUXWWXUDOPHQWHOHIXQ]LRQLDPPLQLVWUDWLYHWHFQLFRSURIHVVLRQDOLHVDQLWDULH
/D UHJROD JHQHUDOH YROXWD GDO OHJLVODWRUH GL SRUUH XQ OLPLWH DOOD FUHVFLWD GHL IRQGL GHOOD FRQWUDWWD]LRQH
LQWHJUDWLYD XQLWDPHQWH DOOD ILVVD]LRQH GL XQ WHWWR DO WUDWWDPHQWR HFRQRPLFR GHL GLSHQGHQWL QRQFKp LO
EORFFR GHO ULQQRYR GHL FRQWUDWWL FROOHWWLYL QD]LRQDOL VH GD XQ ODWR KDQQR FRQGL]LRQDWR OH SROLWLFKH GL
JHVWLRQHGHOOHULVRUVHXPDQHGDOO¶DOWURKDQQRDFFHQWXDWRODFDSDFLWjHODUHVSRQVDELOL]]D]LRQHGHOOHSDUWL
QHJR]LDOL QHOO¶DQDOLVL GHL YLQFROL H QHOOD UD]LRQDOL]]D]LRQH GHOOD VSHVD FRQGXFHQGR LO FRQIURQWR DQFKH VX
VWUXPHQWLGLIOHVVLELOLWjRUJDQL]]DWLYDLQWHUPLQLGLIXQ]LRQDPHQWRHGHIILFLHQ]DGHOO¶DSSDUDWRD]LHQGDOH
(QWUR WDOH FRQWHVWR OD VHVVLRQH QHJR]LDOH KD ULJXDUGDWR LQFRQWUL GL FRQVXOWD]LRQH LQHUHQWL SURFHVVL GL
UD]LRQDOL]]D]LRQH GHOO¶RUJDQL]]D]LRQH GHO ODYRUR LQ FRQQHVVLRQH D PRGLILFKH VWUXWWXUDOL LQWHUYHQXWH LQ
DPELWRD]LHQGDOHQRQFKpDSURJHWWLGLULRUJDQL]]D]LRQHGLDOFXQHDUWLFROD]LRQLD]LHQGDOLDLTXDOLVRQRVWDWL
OHJDWLPHFFDQLVPLLQFHQWLYDQWLSHULOSHUVRQDOHFRLQYROWR
'L VHJXLWR VL HOHQFDQR L SULQFLSDOL GRFXPHQWL QHJR]LDOL VLJODWL H VL GHOLQHDQR OH PDWHULH WUDWWDWH SHU RJQL
DUHD
$5($'(/&203$572
y
,QWHVDULJXDUGDQWHJOLLQWHUYHQWLFRUUHODWLDOSURJHWWRGLULRUJDQL]]D]LRQHGHOFHQWUR6HUYL]L
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
5HYLVLRQH GHO SURWRFROOR GL ,QWHVD H GHOOD QRWD LQWHJUDWLYD FRQFHUQHQWH O¶DVVHWWR D]LHQGDOH GHJOL
LQFDULFKLGLFRRUGLQDPHQWRHODFRQWHVWXDOHULJUDGXD]LRQHGHOOHIXQ]LRQLGLFRRUGLQDPHQWRVRWWRVFULWWL
LQGDWDHGLQGDWD
y
$FFRUGRD]LHQGDOHFRQFHUQHQWHLOVLVWHPDGLSURGXWWLYLWjSHUO¶DQQR
y
9HUEDOH GL LQFRQWUR FRQ OD UDSSUHVHQWDQ]D VLQGDFDOH GHO SHUVRQDOH GHO &RPSDUWR LQ RUGLQH DO
GRFXPHQWRGLRUJDQL]]D]LRQHGHO6HWWRUH)RUPD]LRQHHG$JJLRUQDPHQWR
y
,QWHVDLQRUGLQHDOVLVWHPDSUHPLDQWHSHUO¶DQQR
y
9HUEDOHGLFRQFHUWD]LRQHLQRUGLQHDOSLDQRD]LHQGDOHULJXDUGDQWHLVHUYL]LGLSURQWDGLVSRQLELOLWj
y
9HUEDOHGLLQFRQWUR±UHYLVLRQHGHOUHJRODPHQWRD]LHQGDOHULJXDUGDQWHOHSURFHGXUHSHUODYDULD]LRQH
GHOODFROORFD]LRQHODYRUDWLYDDOO¶LQWHUQRGHOODVWUXWWXUDD]LHQGDOHGHOSHUVRQDOHGHO&RPSDUWRDIIHUHQWH
DOOD'LUH]LRQHGHO6HUYL]LR$VVLVWHQ]LDOH
y
9HUEDOH GL LQFRQWUR UHODWLYR DOOH OLQHH GL LQGLUL]]R SHU OD JHVWLRQH GHOO¶RUDULR GL ODYRUR GHO SHUVRQDOH
DIIHUHQWHDOOD'LUH]LRQHGHO6HUYL]LR$VVLVWHQ]LDOH
y
$FFRUGRD]LHQGDOHFRQFHUQHQWHODTXDQWLILFD]LRQHGHLIRQGLFRQWUDWWXDOLSHUO¶HVHUFL]LR
y
9HUEDOHGLDFFRUGRLQPDWHULDGLSURQWDGLVSRQLELOLWj
$5($',5,*(1=$0(',&$
y
$FFRUGRD]LHQGDOHFRQFHUQHQWHODTXDQWLILFD]LRQHGHLIRQGLFRQWUDWWXDOLSHUO¶HVHUFL]LR
y
8OWHULRUHQRWDLQWHJUDWLYDDOYHUEDOHGLFRQFHUWD]LRQHLQRUGLQHDOSLDQRD]LHQGDOHULJXDUGDQWHL
VHUYL]LGLFRQWLQXLWjDVVLVWHQ]LDOHHGHPHUJHQ]DXUJHQ]D
y
$FFRUGRD]LHQGDOHFRQFHUQHQWHODUHWULEX]LRQHGLULVXOWDWR
y
$FFRUGRD]LHQGDOHFRQFHUQHQWHODTXDQWLILFD]LRQHGHLIRQGLFRQWUDWWXDOLSHUO¶HVHUFL]LR
y
9HUEDOHGLFRQFHUWD]LRQHLQRUGLQHDOSLDQRD]LHQGDOHDQQXDOHULJXDUGDQWHLVHUYL]LGLFRQWLQXLWj
DVVLVWHQ]LDOHHGHPHUJHQ]DXUJHQ]D
y
$FFRUGRD]LHQGDOHFRQFHUQHQWHODUHWULEX]LRQHGLULVXOWDWRSHUO¶DQQR
y
9HUEDOH GL LQWHVD LQ PHULWR DOOH PRGDOLWj GL XWLOL]]R GHOOH ULVRUVH HFRQRPLFKH UHVLGXH GHO IRQGR GL
SHUHTXD]LRQHGLFXLDOO¶DUWGHO&&1/
$5($',5,*(1=$637$
y
$FFRUGRD]LHQGDOHFRQFHUQHQWHODUHWULEX]LRQHGLULVXOWDWRSHUO¶DQQR
y
$FFRUGRD]LHQGDOHFRQFHUQHQWHODTXDQWLILFD]LRQHGHLIRQGLFRQWUDWWXDOLSHUO¶HVHUFL]LR
y
9HUEDOHGLFRQFHUWD]LRQHLQRUGLQHDOSLDQRD]LHQGDOHDQQXDOHULJXDUGDQWHLVHUYL]LGLFRQWLQXLWj
DVVLVWHQ]LDOHHGHPHUJHQ]DXUJHQ]D
y
$FFRUGRD]LHQGDOHFRQFHUQHQWHODUHWULEX]LRQHGLULVXOWDWRSHUO¶DQQR
y
9HUEDOH GL LQWHVD LQ PHULWR DOOH PRGDOLWj GL XWLOL]]R GHOOH ULVRUVH HFRQRPLFKH UHVLGXH GHO IRQGR GL
SHUHTXD]LRQHGLFXLDOO¶DUWGHO&&1/
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
y
/LEHUDSURIHVVLRQH
1HOO¶DQQRO¶$]LHQGD2VSHGDOLHUR±8QLYHUVLWDULDGL3DUPDKDDWWXDWROHOLQHHJXLGDUHJLRQDOLLQPDWHULD
GLDWWLYLWjOLEHURSURIHVVLRQDOHDSSURYDWHFRQ'HOLEHUDGHOOD*LXQWD5HJLRQDOHGHOO¶(PLOLD5RPDJQDQ
GHODJRVWR
6HJXHQGR L SUHFHWWL UHJLRQDOL q VWDWR SHUIH]LRQDWR LO VLVWHPD LQIRUPDWLFR D VXSSRUWR GHOO¶$/3 DWWLYLWj
OLEHURSURIHVVLRQDOH FRQ XQD QXRYD LQWHUIDFFLD JUDILFD GHOOH DJHQGH PDJJLRUPHQWH IXQ]LRQDOH SHU L
SURIHVVLRQLVWL FKH FRQVHQWH GD XQ ODWR XQD PLJOLRUH IOHVVLELOLWj H YLVLELOLWj GHOOD SUHQRWD]LRQH GHJOL
DSSXQWDPHQWL H GDOO¶DOWUR O¶LQVHULPHQWR LQ WHPSR UHDOH GHOO¶RUDULR HIIHWWLYDPHQWH UHVR LQ OLEHUD
SURIHVVLRQHGHLSD]LHQWLYLVLWDWLHGHOOHSUHVWD]LRQLHIIHWWLYDPHQWHHURJDWH
6L q TXLQGL XOWHULRUPHQWH SHUIH]LRQDWRLO VLVWHPD GLPRQLWRUDJJLR D]LHQGDOH FKH JLj SUHYHGHYD D SDUWLUH
GDOXQDVSHFLILFDWLPEUDWXUDGHJOLRUDULLQFXLLGLULJHQWLPHGLFLHIIHWWXDQROD/LEHUD3URIHVVLRQH
6RQR FRQWLQXDWH GD SDUWH GHO 6HWWRUH /LEHUD 3URIHVVLRQH OH YHULILFKH D FDPSLRQH VXOOH DWWLYLWj SRVWH LQ
HVVHUHGDLSURIHVVLRQLVWLVDQLWDULHGLQSDUWLFRODUHGHOODVSHFLILFDWLPEUDWDLQ/LEHUD3URIHVVLRQH
$QFKH OH YHULILFKH VXL YROXPL GHOOH SUHVWD]LRQL OLEHUR±SURIHVVLRQDOL QRQ KDQQR HYLGHQ]LDWR DQRPDOLH
FRQIHUPDQGRODQHWWDSUHYDOHQ]DGHOO¶DWWLYLWjLVWLWX]LRQDOHQHOSLHQRULVSHWWRGHLSUHFHWWLGHOODQRUPDWLYD
YLJHQWH
(VLWR DQDORJR VL q DYXWR QHOOD FRPSDUD]LRQH WUD L YROXPL GL SURGX]LRQH GL ULFRYHUR LQ UHJLPH OLEHUR SURIHVVLRQDOH H TXHOOL GHOO¶DWWLYLWj LVWLWX]LRQDOH SHU SD]LHQWL ULFRYHUDWL UHODWLYDPHQWH DOOH SUHVWD]LRQL
RJJHWWRGLPRQLWRUDJJLRQRQVRQRVWDWHHYLGHQ]LDWHFULWLFLWj
$QFKHQHOVRQRVWDWHHIIHWWXDWHVHGXWHGL/3LQUHJLPHGLOLEHUDSURIHVVLRQH³DJJLXQWLYD´FG6LPLO
$/3 LQWHQGHQGRVL SHU WDOL DWWLYLWj TXHOOH SUHVWD]LRQL LQWHJUDWLYH GHOO¶DWWLYLWj LVWLWX]LRQDOH ULFKLHVWH
GDOO¶$]LHQGDDLSURSULGLSHQGHQWLDOORVFRSRGLULGXUUHOHOLVWHGLDWWHVDRYYHURSHUIDUIURQWHDOODQHFHVVLWj
GLXQWHPSRUDQHRDXPHQWRGLDWWLYLWjRYYHURLQSUHVHQ]DGLFDUHQ]DGLRUJDQLFR
1HOO¶DQQR OD JHVWLRQH GLUHWWD GHOOH YHUWHQ]H SUHFHGHQWHPHQWH DYYLDWD q SURFHGXWD SRVLWLYDPHQWH
SHUTXDQWRDWWLQHQWHDOODOLPLWD]LRQHGHLFRVWLDOODJHVWLRQHFRQJLXQWDFRQLYDULDWWRULDOODXWLOHVROX]LRQH
GHOOHFRQWURYHUVLHSHUIH]LRQDQGROHLQWHUUHOD]LRQLFRQLOSHUVRQDOHGLSHQGHQWHDOORVFRSRGLULFHUFDUHVH
SRVVLELOHXQDVROX]LRQHERQDULDGHOODOLWHHSUHYHQLUHSRVVLELOLFRQWHQ]LRVL
,WHQWDWLYLGLFRQFLOLD]LRQHVWDQWHODIDFROWDWLYLWjGHOODORURHVSHULELOLWjSRVVRQRHVVHUHSURPRVVLLQQDQ]LOD
&RPPLVVLRQH3URYLQFLDOHGL&RQFLOLD]LRQHLQVHGLDWDSUHVVROD'LUH]LRQH7HUULWRULDOHGHO/DYRUR
,QWHUPLQLTXDQWLWDWLYLQHOO¶DQQRVRQRSHUYHQXWHGRPDQGHGLWHQWDWLYRGLFRQFLOLD]LRQHULJXDUGDQWL
SHUVRQDOHGHOO¶$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGL3DUPD
,QUHOD]LRQHDOOHSRVL]LRQLLQHUHQWLLOSHUVRQDOHGHOQRVRFRPLR
y
VRQRVWDWHFRQFLOLDWH
y
qVWDWDDUFKLYLDWD
3HU TXDQWR ULJXDUGD LO FRQWHQ]LRVR DYYLDWR GD SHUVRQDOH GLSHQGHQWH SUHVVR LO 7ULEXQDOH &LYLOH ± 6H]LRQH
/DYRUR VRQR VWDWH LQVWDXUDWH QXRYH YHUWHQ]H PHQWUH SUHVVR OD &RUWH G¶$SSHOOR GL %RORJQD 6H]LRQH
/DYRURVRQRVWDWHLQVWDXUDWHQXRYHYHUWHQ]H
,O QXPHUR GHOOH QXRYH YHUWHQ]H DWWLYDWH q LQ OHJJHUR DXPHQWR ULPDQHQGR WXWWDYLD VX YDORUL FRQWHQXWL
ULVSHWWRDOQXPHURGHLGLSHQGHQWLHDOODFRPSOHVVLWjRUJDQL]]DWLYDGHOO¶$]LHQGD
/HD]LRQLLQWHPDGLVHUYL]LDOODSHUVRQDHDJOL
RSHUDWRUL
,OQLGRD]LHQGDOH
1HO VRQR SURVHJXLWH OH DWWLYLWj GHOO¶DVLOR D]LHQGDOH GHVWLQDWR DL ILJOL GHL GLSHQGHQWL H IUXWWR GHOOD
SURILFXD FROODERUD]LRQH FRQ LO &RPXQH GL 3DUPD QRQFKp FRQ O¶$]LHQGD 6DQLWDULD WHUULWRULDOH FRQWLQXDQGR
QHOODUHDOL]]D]LRQHGLXQSURJHWWRYROWRDGDJHYRODUHLSURIHVVLRQLVWLD]LHQGDOLHGRWDWRGLXQDVLJQLILFDWLYD
ULOHYDQ]DDQFKHLQDPELWRFRPXQDOH
,OQLGRqULVHUYDWRDLILJOLGHLGLSHQGHQWLWUDLPHVLHLPHVLFRQXQDFDSDFLWjULFHWWLYDGLSRVWLH
DSHUWXUDDUWLFRODWDLQFLQTXHJLRUQLVHWWLPDQDOLGDOOXQHGuDOYHQHUGu
(¶ SUHYLVWD OD SRVVLELOLWj GL DSHUWXUD DO VDEDWR PDWWLQD SXUFKp LQ SUHVHQ]D GL XQ QXPHUR PLQLPR GL
ULFKLHVWH
/¶DPSLR RUDULR GL DSHUWXUD GDOOH DOOH FRQVHQWH XQD FRQVLGHUHYROH FRSHUWXUD GHOO¶RUDULR GL
ODYRURGHLJHQLWRULIDYRUHQGROHHVLJHQ]HGHOSHUVRQDOHWXUQLVWD
/D VRVWD HVWLYD QHO FRUVR GHOO¶DQQR WUDVFRUVR q VWDWD FLUFRVFULWWD DO VROR PHVH GL DJRVWR GL GXUDWD
LQIHULRUHULVSHWWRDTXHOODUHDOL]]DWDLQDOWULDVLOLGHOWHUULWRULRFRPXQDOH
6LJQLILFDWLYD LQILQH OD SRVVLELOLWj GL FRQYHQLUH FRQ LO JHVWRUH XQ RUDULR SL HODVWLFR H PDJJLRUPHQWH
VRYUDSSRQLELOH D TXHOOR ODYRUDWLYR VRSUDWWXWWR VH UDSSRUWDWR DJOL RUDUL HIIHWWXDWL GDOOH DOWUH DQDORJKH
VWUXWWXUHSURPXRYHQGRODFRQFLOLD]LRQHWUDWHPSLGLYLWDHWHPSLGLODYRURLQXQ¶RWWLFDYROWDDLUUREXVWLUH
OH SDUL RSSRUWXQLWj GHOOH ODYRUDWULFL H PHWWHQGR D GLVSRVL]LRQH GL HQWUDPEL L JHQLWRUL GLSHQGHQWL OD
SRVVLELOLWjGLDVVRFLDUHDOPHJOLRLOUXRORGLJHQLWRUHFRQTXHOORGLODYRUDWRUH
8QD DJHYROD]LRQH FRQFUHWD H G¶LQGXEELD XWLOLWj UHDOL]]DWD SHU IDYRULUH XQ FRQFUHWR PLJOLRUDPHQWR GHOOD
YLWDGHOOHODYRUDWULFLHGHLODYRUDWRULGHOO¶$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGL3DUPD
,VHUYL]LDOODSHUVRQD
1HOFRUVRGHOO¶DQQRSHUTXDQWRULJXDUGDLVHUYL]LDOODSHUVRQDVRQRVWDWHULSURSRVWHOHDJHYROD]LRQL
D IDYRUH GHL GLSHQGHQWL JLj IDYRUHYROPHQWH VSHULPHQWDWH QHJOL DQQL SUHFHGHQWL SHU IDFLOLWDUH LO WUDJLWWR
FDVDODYRURHLOSDUFKHJJLRGHOODSURSULDDXWRYHWWXUDGXUDQWHO¶RUDULRGLODYRUR
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
*HVWLRQHGHOFRQWHQ]LRVR
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
1HOO¶DPELWR GHOOD FRQYHQ]LRQH FRQ ,QIRPRELOLW\ H &RPXQH GL 3DUPD Q GLSHQGHQWL KDQQR ULFKLHVWR H
RWWHQXWRO¶DEERQDPHQWRDWDULIIDDJHYRODWDSHUODVRVWDQHOOHDUHHGHOLPLWDWHGDOOHULJKHEOXLQGXH]RQH
DGLDFHQWLDOO¶RVSHGDOH
*OL DEERQDPHQWL VRQR GHVWLQDWL DL GLSHQGHQWL FKH RVVHUYDQR XQ RUDULR GL ODYRUR QRQ GLVDJLDWR FKH QH
IDQQRDSSRVLWDULFKLHVWDHFRQVHJQDWLLQEDVHDOFULWHULRGHOODGLVWDQ]DGDOODUHVLGHQ]DRGDOGRPLFLOLRDO
OXRJRGLODYRUR
&RQWHPSRUDQHDPHQWHO¶$]LHQGDKDPDQWHQXWRODSURSULDDGHVLRQHDOODFRQYHQ]LRQHFRQOD7(3O¶D]LHQGD
GL WUDVSRUWL ORFDOH SHU ULVHUYDUH DJOL RSHUDWRUL GHOO¶RVSHGDOH DEERQDPHQWL DJOL DXWREXV XUEDQL HG H[WUD
XUEDQLDWDULIIDDJHYRODWD1HOVLVRQRDYYDOVLGLWDOHRSSRUWXQLWjQGLSHQGHQWL
$OO¶LQWHUQRGHOO¶DUHDRVSHGDOLHUDqLQILQHSURVHJXLWRLOVHUYL]LRGLEXVQDYHWWDGHOO¶2VSHGDOHFKHFROOHJDFRQ
SHUFRUVRFLUFRODUHLSULQFLSDOLSXQWLGHOO¶DUHDRVSHGDOLHUD
,OVHUYL]LRXWLOL]]DELOHJUDWXLWDPHQWHGDGLSHQGHQWLHXWHQWLqDVVLFXUDWRGDOOXQHGuDOYHQHUGuGDOOH
DOOHSHUIDYRULUHJOLVSRVWDPHQWLGLFKLSHUPRWLYLSHUVRQDOLRSHUPRWLYLGLODYRURVLGHYHVSRVWDUH
GDXQDSDUWHDOO¶DOWUDQHOO¶DPELWRGHOSHULPHWURRVSHGDOLHUR
$OILQHGLWXWHODUHODVLFXUH]]DGHJOLRSHUDWRULVRSUDWWXWWRGLFRORURLOFXLWXUQRLQL]LDRWHUPLQDQHOOHRUH
VHUDOLQRWWXUQH VL q PDQWHQXWR DOWUHVu LO VHUYL]LR GL YLJLODQ]D LQWHUQD GD DOOHUWDUH LQ FDVR GL SUREOHPL
ULFRQGXFLELOL DOO¶RUGLQH SXEEOLFR HR GL SHULFROR ULVFRQWUDWR DOO¶LQWHUQR GHOO¶$]LHQGD H QHL SDUFKHJJL GL YLD
9ROWXUQR9LD$EEHYHUDWRLD9LD/HSRUDWLH9LD5DVRUL
&RPSDWLELOLWjIUDWHPSLGLYLWDHGLODYRUR
/H SROLWLFKH SHU OD FRQFLOLD]LRQH GHL WHPSL GL YLWD H GL ODYRUR UDSSUHVHQWDQR XQ LPSRUWDQWH HOHPHQWR GL
LQQRYD]LRQH GHL PRGHOOL VRFLDOL HFRQRPLFL H FXOWXUDOL FRQ OD ILQDOLWj GL IRUQLUH VWUXPHQWL FKH
FRQWHPSHUDQGRO¶DPELWRODYRUDWLYRHO¶DPELWRIDPLOLDUHFRQVHQWDQRDFLDVFXQLQGLYLGXRGLYLYHUHDOPHJOLR
LPROWHSOLFLUXROLFKHULYHVWHDOO
LQWHUQRGLVRFLHWjFRPSOHVVH
(VVHFRLQYROJRQRLQHYLWDELOPHQWHODVIHUDSULYDWDGHLODYRUDWRUL±VLDXRPLQLFKHGRQQHPDDQFKHTXHOOD
SXEEOLFDSROLWLFDHVRFLDOHHKDQQRXQLPSDWWRHYLGHQWHVXOO
RUJDQL]]D]LRQHGHOODYRURHVXOULHTXLOLEULRGHL
FDULFKLGLFXUDDOO
LQWHUQRGHOODIDPLJOLDQRQFKpVXOFRRUGLQDPHQWRGHLVHUYL]LGLLQWHUHVVHSXEEOLFRHGHL
WHPSL GL YLWD GHOOH FLWWj (¶ HYLGHQWH FKH OD UHDOL]]D]LRQH GL WDOL SROLWLFKH ULVXOWD SULRULWDULD SHU OD TXDOLWj
GHOOD YLWD GHOOH IDPLJOLH WDQWR FKH VLD D OLYHOOR QD]LRQDOH FKH HXURSHR VRQR VWDWH DYYLDWH PROWHSOLFL
LQL]LDWLYH RULHQWDWH D IDYRULUH LO UDGLFDPHQWR H OR VFDPELR GHOOH PLJOLRUL HVSHULHQ]H QRQFKp OD
VSHULPHQWD]LRQHGLQXRYLPRGHOOLGLRUJDQL]]D]LRQHGHOODYRUR
,Q ,WDOLD OD QRUPDWLYD GL ULIHULPHQWRLQ PDWHULD qDQFRUD UDSSUHVHQWDWD GDOOD OHJJH PDU]R Q FKHROWUHDLQWURGXUUHLFRQJHGLSDUHQWDOLIDYRUHQGRXQPDJJLRUFRLQYROJLPHQWRGHLSDGULQHOODFXUDGHL
ILJOL KD IRFDOL]]DWR O
DWWHQ]LRQH VXOO
LPSRUWDQ]D GL ULRUJDQL]]DUH L WHPSL GHOOH FLWWj H KD SURPRVVR OD
VSHULPHQWD]LRQH GL D]LRQL SRVLWLYH SHU OD FRQFLOLD]LRQH VXO OXRJR GL ODYRUR VHQVLELOL]]DQGR LQ WDO VHQVR
D]LHQGHHSDUWLVRFLDOL
$QFKH QHO O¶$]LHQGD KD FHUFDWR GL DWWXDUH L SULQFLSL VRSUD GHVFULWWL QHOO¶DPELWR GHJOL VWUXPHQWL D
SURSULDGLVSRVL]LRQHDWWUDYHUVRO¶DSSOLFD]LRQHGHOODQRUPDWLYDFRQWHQXWDQHOWHVWRXQLFRVXOODWXWHODGHOOD
PDWHUQLWj H SDWHUQLWj &Lz VL q WUDGRWWR QHO ULFRQRVFLPHQWR SXU QHO ULVSHWWR GHL OLPLWL H FRQ OH PRGDOLWj
SUHYLVWH GDOOD QRUPDWLYD VWHVVD GL SDUW WLPH SHUPHVVL FRQJHGL H DVSHWWDWLYH QRQ VROR SHU TXHL
ODYRUDWRUL FKH VYROJRQR O¶LPSRUWDQWH UXROR JHQLWRULDOH PD DQFKH SHU FRORUR FKH DVVLVWRQR IDPLOLDUL LQ
VLWXD]LRQH GL GLVDELOLWj QRQFKp LQ WDOXQH LSRWHVL QHOOH TXDOL OH HVLJHQ]H RUJDQL]]DWLYH OR KDQQR
FRQVHQWLWR GL FRQFHVVLRQH GL RUDUL IOHVVLELOL SHU YHQLUH LQFRQWUR DOOH QHFHVVLWj GHO GLSHQGHQWH GHULYDQWL
GDOODSURSULDVLWXD]LRQHSHUVRQDOHHIDPLOLDUH
,QWHPDGLIOHVVLELOLWjRUDULDUHODWLYDPHQWHDOSHUVRQDOHGHL6HUYL]LGHOOD'LUH]LRQH$PPLQLVWUDWLYDHSHUOD
IXQ]LRQHDPPLQLVWUDWLYDGHOOD'LUH]LRQH6DQLWDULDVLqFRQIHUPDWDFRPHGDGLYHUVLDQQLDTXHVWDSDUWH
XQD IDVFLD GL IOHVVLELOLWj GL XQ¶RUD LQ HQWUDWD GDOOH RUH DOOH RUH H FRUUHODWLYDPHQWH LQ XVFLWD
GDOOHRUHDOOHRUH
$QDOL]]DQGRQHOGHWWDJOLRLGDWLUHODWLYLDOO¶XWLOL]]RGLSHUPHVVLFRQJHGLHDVSHWWDWLYHSHUODFXUDGHLILJOLH
GHLIDPLOLDULVLFRQIHUPDQHOO¶DQGDPHQWRJLjULOHYDWRQHJOLDQQLSUHFHGHQWLO¶DVVHQ]DGDOODYRURSHU
TXHVWH PRWLYD]LRQL YLHQH IUXLWD GDOOD SRSROD]LRQH IHPPLQLOH LQ SDUWLFRODUH GL TXHOOD GHOO¶DUHD GHO
FRPSDUWRPHQWUHFRQWLQXDDGHVVHUHSLHVLJXRLOQXPHURGLODYRUDWRULPDVFKLDVVHQWLSHUODFXUDGLILJOL
RIDPLOLDULFRVuFRPHFRQVHJXHQWHPHQWHqOLPLWDWRLOQXPHURGLJLRUQDWHGLDVVHQ]DIUXLWH
7DEHOOD*LRUQDWHGLDVVHQ]DSHUODFXUDGLILJOLRIDPLOLDULDQQR
$VVHQ]HSHUPDODWWLDILJOLR
8QLWj
*LRUQLDVVHQ]D $UHD&RQWUDWWXDOH
)
&203$572
0
&203$572
)
',5,*(1=$
',5,*(1=$
0
$VVHQ]DSHUFRQJHGRSDUHQWDOH
6HVVR
8QLWj
*LRUQLDVVHQ]D $UHD&RQWUDWWXDOH
)
&203$572
0
&203$572
)
',5,*(1=$
',5,*(1=$
0
&RQJHGRQRQUHWULEXLWRSHUJUDYLPRWLYLGLIDPLJOLD
6HVVR
8QLWj
*LRUQLDVVHQ]D $UHD&RQWUDWWXDOH
)
&203$572
0
&203$572
&RQJHGRUHWULEXLWRDUW'/JV
6HVVR
8QLWj
*LRUQLDVVHQ]D $UHD&RQWUDWWXDOH
)
&203$572
0
&203$572
)
',5,*(1=$
0
',5,*(1=$
$VVHQ]DSHUDVSHWWDWLYDQRQUHWULEXLWDDVVLVWHQ]DILJOLPLQRUL
GLDQQL
6HVVR
8QLWj
*LRUQLDVVHQ]D $UHD&RQWUDWWXDOH
)
&203$572
0
&203$572
$VVHQ]HSHUSHUPHVVROHJJH
6HVVR
8QLWj
*LRUQLDVVHQ]D $UHD&RQWUDWWXDOH
)
&203$572
0
&203$572
)
',5,*(1=$
0
',5,*(1=$
7DEHOOD,QFLGHQ]DSHUFHQWXDOHGHOOHJLRUQDWHGLDVVHQ]DSHUFXUDGHLIDPLOLDULHGHLILJOLH
PHGLDGHOOHJLRUQDWHXWLOL]]DWHGLVWULEX]LRQHSHUJHQHUHHDUHDFRQWUDWWXDOH
'LVWULEX]LRQHGLSHQGHQWL
VXOWRWDOH
7LSRORJLH
JHQHUHHDUHD
FRQWUDWWXDOH
IHPPLQH
FRPSDUWR
PDVFKLFRPSDUWR
IHPPLQHGLULJHQ]D
PDVFKLGLULJHQ]D
JLRUQDWHGLDVVHQ]DIUXLWHHJLRUQDWHPHGLHGLDVVHQ]DJJP
&RQJHGR
SDUHQWDOH
3HUPHVVL
OHJJH
0DODWWLD
ILJOLR
*JP
*JP
&RQJHGR
UHWULEXLWRDUW
'/JV
$VSHWWDWLYD
QRQUHWULEXLWD
ILJOLPLQRUL
DQQL
*JP
*JP
*JP
&RQJHGRQRQ
UHWULEXLWRSHU
JUDYLPRWLYL
IDPLOLDUL
*JP
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
6HVVR
&RQGL]LRQLGLODYRURFRPSHWHQ]HGHOSHUVRQDOHHGHIILFLHQ]DGHOO¶RUJDQL]]D]LRQH
1HOOD WDEHOOD SUHFHGHQWH q ULOHYDWD O¶LQFLGHQ]D SHUFHQWXDOH GHOOH JLRUQDWH GL DVVHQ]D IUXLWH LQ EDVH DO
JHQHUH H DOO¶DUHD FRQWUDWWXDOH 6L RVVHUYD VXELWR FKH OD SRSROD]LRQH IHPPLQLOH GHO FRPSDUWR q OD
FRPSRQHQWHFKHSUHYDOHQWHPHQWHVLDVWLHQHGDOODYRURSHUOHQHFHVVLWjIDPLOLDUL
/DSRSROD]LRQHPDVFKLOHGHOFRPSDUWRFKHUDSSUHVHQWDLOGHOWRWDOHGHLGLSHQGHQWLKDXWLOL]]DWR
VHSSXU VHPSUH LQ PLVXUD ULGRWWD ULVSHWWR DOOH ODYRUDWULFL GRQQH LO GHOOH JLRUQDWH GL DVVHQ]D SHU
FRQJHGRUHWULEXLWRGLFXLDOO¶DUW'/JV3HUTXDQWRULJXDUGDODGLULJHQ]DODSULQFLSDOHFDXVDOH
GL DVVHQ]D GHOOH ODYRUDWULFL q DQFRUD UDSSUHVHQWDWD GDO FRQJHGR SDUHQWDOH SHU JLRUQDWH
PHGLH GL DVVHQ]D 1HOO¶DPELWR GHOOD SRSROD]LRQH PDVFKLOH GHO FRPSDUWR q GD ULOHYDUH O¶XQLFR FDVR GL
DVVHQ]DSHUFRQJHGRUHWULEXLWRSHUJLRUQLPHGLGLDVVHQ]D
6LVWHPDGLUHOD]LRQLH
VWUXPHQWLGL
FRPXQLFD]LRQH
,O SUHVHQWH FDSLWROR q ILQDOL]]DWR D SUHVHQWDUH JOL
LQWHUYHQWL UHDOL]]DWL H OH D]LRQL LQWUDSUHVH GDOO¶$]LHQGD
SHU SRWHQ]LDUH R TXDOLILFDUH LO VLVWHPD GHOOH UHOD]LRQL H
JOLVWUXPHQWLGLFRPXQLFD]LRQHVLDFRQLVRJJHWWLLQWHUQL
VLD FRL VRJJHWWL HVWHUQL XWHQWL FLWWDGLQL ORUR
UDSSUHVHQWDQ]H VRFLDOL H LVWLWX]LRQDOL FRQ SDUWLFRODUH
ULIHULPHQWRDWUHDPELWL
•
/DFRPXQLFD]LRQHSHUO¶DFFHVVRDLVHUYL]L
•
/DFRPXQLFD]LRQHSHUOHVFHOWHGLLQWHUHVVHSHU
ODFRPXQLWj
•
/DFRPXQLFD]LRQHLQWHUQDD]LHQGDOH
6LVWHPDGLUHOD]LRQLHVWUXPHQWLGLFRPXQLFD]LRQH
/D FRPXQLFD]LRQH q WHVWLPRQLDQ]D FRQFUHWD GHOO¶DWWLYLWj GHOO¶$]LHQGD H IDWWRUH GL FRPSUHQVLRQH GHOOD
VWUXWWXUD RVSHGDOLHUD 3HU TXHVWR L VLVWHPL GL UHOD]LRQH LQWHUQL HG HVWHUQL FKH O¶$]LHQGD LQVWDXUD FRQ LO
SHUVRQDOH LO FLWWDGLQR OH DVVRFLD]LRQL GL YRORQWDULDWR JOL HQWL ORFDOL H L PHGLD HVSULPRQR LO ³FDUDWWHUH´
GHOO¶HQWHHQHVRQRIXQ]LRQHVWUDWHJLFDHGLVYLOXSSR,QTXHVWDSURVSHWWLYDODFRPXQLFD]LRQHIDYRULVFHLO
UHDOL]]DUVLGLXQ¶D]LRQHFRPXQHIUDLGLYHUVLDWWRULHGLYHQWDVWUXPHQWRLPSRUWDQWHSHUODSURPR]LRQHGHOOD
VDOXWHDJDUDQ]LDGHLYDORULGLHTXLWjDFFHVVLELOLWjHIILFDFLDHDSSURSULDWH]]DGHOO¶DVVLVWHQ]D
1HO FRUVR GHO O¶$]LHQGD 2VSHGDOLHUR8QLYHUVLWDULD KD SURPRVVR OR VYLOXSSR GL XQ VLVWHPD GL
FRPXQLFD]LRQH DO ILQH GL JDUDQWLUH XQ PHVVDJJLR FRUUHWWR H LO SL SRVVLELOH HVDXVWLYR 1HOOH SDJLQH GL
TXHVWR FDSLWROR VDUDQQR UHQGLFRQWDWL DWWLYLWj H VWUXPHQWL PHVVL LQ DWWR SHU JDUDQWLUH ROWUH DG XQD
LQIRUPD]LRQHWUDVSDUHQWHXQD³EXRQD´FRPXQLFD]LRQH
3URPXRYHUH OD FRQRVFHQ]D H O¶XVR FRUUHWWR GHL VHUYL]L q XQD GHOOH QHFHVVLWj H GHOOH ILQDOLWj GHOO¶$]LHQGD
2VSHGDOLHUR8QLYHUVLWDULD 'LYHUVL VRQR JOL VWUXPHQWL XWLOL]]DWL H DWWLYDWL FKH PLUDQR DG DYYLFLQDUH L
FLWWDGLQLDOO¶2VSHGDOH)RQGDPHQWDOHqODUHDOL]]D]LRQHGLXQVLVWHPDGLJDUDQ]LHFKHVRGGLVILODGRPDQGD
GL LQIRUPD]LRQH OD ULFKLHVWD GL DFFHVVR DL VHUYL]L H FKH GLD ULVSRVWD D GXEEL H TXHVLWL FKH LO FLWWDGLQR
DYYHUWH TXDQGR HQWUD LQ FRQWDWWR FRQ OD VWUXWWXUD ,QIDWWL SL LO FLWWDGLQR VL VHQWH VLFXUR H RULHQWDWR
DOO¶LQWHUQRGHOO¶HQWHSLVLVHQWLUjJDUDQWLWRQHOVXRGLULWWRDOO¶DVVLVWHQ]DSHUTXHVWRULVXOWDHVVHQ]LDOHXQD
FRPXQLFD]LRQH FKH VYLOXSSL XQD FRQRVFHQ]D HVDXVWLYD H FKH DVFROWL OD SHUFH]LRQH GL VRGGLVID]LRQH
GHOO¶XWHQWH ,Q TXHVWR SDUDJUDIR VRQR LOOXVWUDWL JOL VWUXPHQWL H L VHUYL]L PHVVL LQ DWWR GDOO¶$]LHQGD SHU
SURPXRYHUHHPLJOLRUDUHODTXDOLWjHO¶DFFHVVRDOOHVWUXWWXUH
6LWRZHE
'RSRODPHVVDRQOLQHGHOVLWRULQQRYDWRQHOODJUDILFDFRPSOHWDPHQWHULYLVWRHLPSOHPHQWDWRQHLSHUFRUVL
GL QDYLJD]LRQH H QHL FRQWHQXWL DYYHQXWD LO VHWWH
QRYHPEUH FIU LO %LODQFLR GL 0LVVLRQH FDSLWROR O¶DWWLYLWj GHOO¶XIILFLR &RPXQLFD]LRQH
D]LHQGDOH
VL
q
FRQFHQWUDWD
VRSUDWWXWWR
QHOO¶LQVHULPHQWR GHOOH QRWL]LH QHOO¶DJJLRUQDPHQWR
GHOO¶DJHQGD QHOOD OHJJLELOLWj GHOOH LQIRUPD]LRQH
SULYLOHJLDQGRLFRQWHQXWLLSHUWHVWXDOLHFRUUHGDQGR
L FRQWHQXWL FRQ LPPDJLQL H XQD VHULH GL JDOOHULH
IRWRJUDILFKH7DOHDWWLYLWjGLFRPXQLFD]LRQHqVWDWD
LPSOHPHQWDWD QHO FRUVR GHOO¶DQQR RJJHWWR GL
UHQGLFRQWD]LRQH SDVVDQGR GDOOH QRWL]LH
SXEEOLFDWH QHO DOOH SXEEOLFDWH QHO $JJLRUQDPHQWR FRVWDQWH UHVR SRVVLELOH JUD]LH DOOD
QXRYDSLDWWDIRUPDGLJHVWLRQHGHLFRQWHQXWL&06
GL WLSR RSHQ VRXUFH EDVDWD VX :RUG 3UHVV FKH KD
SHUPHVVR OD JHVWLRQH DXWRQRPD GHOOD PDJJLRU
SDUWHGHLFRQWHQXWLGDSDUWHGHOO¶XIILFLR&RPXQLFD]LRQH
/¶RELHWWLYRDOODEDVHGHOULQQRYDPHQWRDWWXDWRQHOHUDLQIDWWLTXHOORGLUHQGHUHLOVLWRSLGLQDPLFR
HIILFLHQWHHDFFHVVLELOHHFKHVYROJHVVHQRQVRORXQDIXQ]LRQHGLYLVLELOLWjHSURPR]LRQHGHOO¶LPPDJLQHPD
DQFKHHVRSUDWWXWWRXQDIXQ]LRQHGLVHUYL]LRRULHQWDWDYHUVRODFRPXQLWj
,O VLWR ZHE UDSSUHVHQWD LQIDWWL SHU LO FLWWDGLQR OD SULQFLSDOH SRUWD G¶LQJUHVVR SHU FRQRVFHUH LQ PDQLHUD
GHWWDJOLDWD OH VWUXWWXUH GHO 0DJJLRUH OH DWWLYLWj VDQLWDULH HURJDWH OH LQIRUPD]LRQL VXOO¶DFFHVVR DL VHUYL]L
VXOOH PRGDOLWj GL SUHQRWD]LRQH GL YLVLWH HG HVDPL VSHFLDOLVWLFL H VWUXPHQWDOL DWWUDYHUVR LO ZHE LQIDWWL LO
FLWWDGLQRSXzDGHVHPSLRSDJDUHLOWLFNHWHFRQVXOWDUHO¶HOHQFRGHOOHSUHVWD]LRQLFKHqSRVVLELOHVYROJHUH
LQOLEHUDSURIHVVLRQH
3HU TXHVWL PRWLYL LO VLWR GHYH ULVXOWDUH FRPSOHWR WHPSHVWLYR H DJJLRUQDWR SHU GDUH FHUWH]]H DOO¶XWHQWH H
SURPXRYHUH DWWUDYHUVR O¶LQIRUPD]LRQH XQD PDJJLRUH SDUWHFLSD]LRQH DOOD YLWD GHOO¶HQWH ,O VLWR LQROWUH
ULVSRQGH D GRYHUL GL SXEEOLFD]LRQH GHWWDWL GDOOD QRUPDWLYD UHJLRQDOH H QD]LRQDOH 1HO LQ
RWWHPSHUDQ]DDJOLREEOLJKLOHJLVODWLYLLQPDWHULDGL7UDVSDUHQ]DH$QWLFRUUX]LRQHVRQRVWDWHFUHDWHGXH
6LVWHPDGLUHOD]LRQLHVWUXPHQWLGLFRPXQLFD]LRQH
/DFRPXQLFD]LRQHSHUO¶DFFHVVRDLVHUYL]L
QXRYH VHVVLRQL FKH FRQWHQJRQR QHOOR VSHFLILFR WXWWH OH LQIRUPD]LRQL ULFKLHVWH GDOOH OHJJL LQ PDWHULD
'XUDQWH WXWWR LO q SURVHJXLWR LQILQH DQFKH O¶DJJLRUQDPHQWR GHOOH VFKHGH GL UHSDUWR YHUR H SURSULR
³FRUHEXVLQHVV´GHOVLWROHVFKHGHLQIRUPDWLYHVRQRVWDWHDJJLRUQDWHHLQSDUWHLPSOHPHQWDWH
&RPH VL QRWD VLQWHWLFDPHQWH GDL GDWL HVWUDSRODWL GDOOH DQDOLVL GHO SL LPSRUWDQWH PRWRUH GL ULFHUFD QHO
FRUVR GHO JOL DFFHVVL DO VLWR VRQR VWDWL HIIHWWXDWL GD XWHQWL VLQJROL FRQ XQD
YLVXDOL]]D]LRQH GL TXDVL SDJLQH 3L QHOOR VSHFLILFR PHGLDPHQWH LQ RJQL SHUFRUVR GL
QDYLJD]LRQHVRQRVWDWHYLVWHSDJLQHHRJQLDFFHVVRqGXUDWRPLQXWLHVHFRQGL
7UDOHSDJLQHSLYLVXDOL]]DWHDSDUWHOD+RPHSDJHFRQYLVLWHHO¶$UHDULVHUYDWD
DFFHVVL D GLPRVWUD]LRQH GL FRPH LO VLWR ZHE VLD GLYHQWDWR VWUXPHQWR LPSRUWDQWH SHU L SURIHVVLRQLVWL SHU
FRQWUROODUH OD SRVWD HOHWWURQLFD R SHU DFFHGHUH GLUHWWDPHQWH DG DOFXQL DSSOLFDWLYL GL ODYRUR WURYLDPR
TXHOOH SDJLQH FKH ULSRUWDQR LQGLFD]LRQL SHU O¶DFFHVVR DL VHUYL]L 5HSDUWL H VHUYL]L VDQLWDUL YLVLWDWRUL &RQWDWWL YLVLWH H OD VH]LRQH /DYRUDUH FRQ DFFHVVL XWLOH SHU DFFHGHUH D
GRFXPHQWLFRPHLEDQGLRJOLDYYLVLGLFRQFRUVR
7DEHOOD6LQWHVLWUDIILFRVLWRDQQR
6LQWHVLWUDIILFRZZZDRSULW
6HVVLRQLGLQDYLJD]LRQHDFFHVVL
8WHQWL
3DJLQHYLVXDOL]]DWH
1ƒGLSDJLQHYLVXDOL]]DWHSHU6HVVLRQH
'XUDWDVHVVLRQHPHGLD
6LVWHPDGLUHOD]LRQLHVWUXPHQWLGLFRPXQLFD]LRQH
7DEHOOD3DJLQHSLYLVLWDWHDQQR
3DJLQH
9LVXDOL]]D]LRQL 7HPSRPHGLR
+RPHSDJH
$UHDULVHUYDWD
5HSDUWLHVHUYL]LVDQLWDUL
/DYRUDUH
&RQWDWWL
9LVLWHHG(VDPL
&KLVLDPR
&XUDUVL
5DJJLXQJHUHO¶RVSHGDOH
2VWHWULFLDHJLQHFRORJLD
5LFHUFD
)RUPD]LRQH
5HSDUWLHVHUYL]LVDQLWDUL$=
0D[LOOR)DFFLDOH
$OERSUHWRULR
$PPLQLVWUD]LRQHWUDVSDUHQWH
&OLQLFDSHGLDWULFD
2UJDQL]]D]LRQHD]LHQGDOH
2WRULQR2WRQHXURFKLUXUJLD
&DUGLRORJLD
8IILFLR5HOD]LRQLFRQLO3XEEOLFR
1HO FRUVR GHOO¶DQQR O¶8IILFLR 5HOD]LRQL FRQ LO 3XEEOLFR 853 KD JDUDQWLWR XQ FRUUHWWR IOXVVR GL
LQIRUPD]LRQL FDSDFH GL PLJOLRUDUH OD TXDOLWj GHO VHUYL]LR H LO UDSSRUWR GL ILGXFLD WUD LO FLWWDGLQRXWHQWH H
D]LHQGD FROODERUDQGR DOOH SROLWLFKH SHU O¶DFFRJOLHQ]D H OD SDUWHFLSD]LRQH PDQWHQHQGR VDOGDPHQWH LO VXR
SHFXOLDUHVWLOHGLUDSSRUWRFRQJOLXWHQWL3HUTXDQWRFRQFHUQHODFRPXQLFD]LRQHHOHUHOD]LRQLHVWHUQHHG
LQWHUQH O¶HVHUFL]LR GHOO¶DWWLYLWj LVWLWX]LRQDOH YHUVR JOL (QWL GL ULIHULPHQWR H L GLYHUVL VRJJHWWL SRUWDWRUL GL
LQWHUHVVLQHLFRQIURQWLGHOO¶DWWLYLWjLVWLWX]LRQDOHO¶853KDPHVVRLQFDPSRPROWHD]LRQL
+D DJLWR LQ PRGR GLUHWWR VXOO¶LPPDJLQH H VXOOD FXOWXUD GHOO¶$]LHQGD LQ TXDOLWj GL VWUXPHQWR LQWHJUDQWH
QHOOR VYLOXSSR D]LHQGDOH FRQVHQWHQGR GD XQ ODWR OR VYLOXSSR GL XQ VLVWHPD GL UHOD]LRQH GLUHWWD DL
FLWWDGLQLXWHQWL H DOOH DVVRFLD]LRQL GL YRORQWDULDWR H GDOO¶DOWUR LO UDIIRU]DUVL GHOOH FDSDFLWj GL UHOD]LRQL
LQWHUQH WUD JOL RSHUDWRUL GHOOH VWUXWWXUH H GHL SURJUDPPL VDQLWDUL DO ILQH GL JDUDQWLUH XQD FRPXQLFD]LRQH
FRUUHWWDHGLOSLSRVVLELOHHVDXVWLYD+DFRQWLQXDWRDGRFFXSDUVLGHJOLDVSHWWLUHODWLYLDOO¶DFFHVVRDLVHUYL]L
DO ILQH GL VRGGLVIDUH SULRULWDULDPHQWH OD GRPDQGD GL LQIRUPD]LRQH VXO FRPH PXRYHUVL SHU ULVROYHUH XQ
GHWHUPLQDWRSUREOHPDVRGGLVIDUHXQDGHWHUPLQDWDULFKLHVWDDIIURQWDUHXQRVSHFLILFRSHUFRUVRGLVDOXWH
+DFRQFUHWL]]DWRUHOD]LRQLSLIRUWLFRQODFLWWDGLQDQ]DLQFUHPHQWDQGRODIHGHOWjHODILGXFLDGHOO¶XWHQWHD
FXL O¶$]LHQGD LQWHQGH IRUQLUH WXWWH OH RFFDVLRQL XWLOL SHU HVSULPHUH HYHQWXDOL UHFODPL ULOLHYL HORJL H
VXJJHULPHQWLDOILQHGLLQFLGHUHVXOPLJOLRUDPHQWRGHOODTXDOLWjGHOVHUYL]LRHURJDWR/HSUREOHPDWLFKHSL
FRPSOHVVHGHOFLWWDGLQRXWHQWHVRQRVWDWHDQDOL]]DWHHYHULILFDWHVRQRVWDWLHODERUDWLLGDWLSHUYHQXWLHG
DWWXDWHVWUDWHJLHDOILQHGLRWWLPL]]DUHLVHUYL]LHGLVRGGLVIDUHLELVRJQLVDQLWDULHVRFLDOLHPHUVL
1HOO¶DPELWRGHOODPHGLD]LRQHGHLFRQIOLWWLVRQRVWDWLJHVWLWLLQFRQWULLQFROODERUD]LRQHFRQLO0HGLFR/HJDOH
PLUDWL D ULVWDELOLUH LO GLDORJR WUD XWHQWL H SURIHVVLRQLVWL FRQ LO UDJJLXQJLPHQWR GHOO¶RELHWWLYR SULPDULR
RYYHUR OD UHDOL]]D]LRQH GL XQ SURFHVVR GL ULDWWLYD]LRQH GHOOH UHOD]LRQL , EHQHILFL RWWHQXWL GDOO¶DWWLYD]LRQH
GHOODIXQ]LRQHGLPHGLD]LRQHKDQQRFRQVHQWLWRGLIDYRULUHODFUHD]LRQHGLXQFOLPDGLDVFROWRHDWWHQ]LRQH
WUDSURIHVVLRQLVWLGHOVLVWHPDVDQLWDULRSD]LHQWLHORURIDPLOLDULQRQFKpGLVWLPRODUHO¶DGR]LRQHGDSDUWH
GHLSURIHVVLRQLVWLGLFRPSRUWDPHQWLUHOD]LRQDOLFKHULGXFDQRLOULVFKLRGLFRQIOLWWXDOLWjFRQLSD]LHQWLHLORUR
IDPLOLDULJLXQJHQGRFRVuDGXQDGLPLQX]LRQHGLSURFHGXUHJLXGL]LDULHHULFKLHVWHGLULVDUFLPHQWR
/¶DWWLYLWjGLGLIIXVLRQHGLPDWHULDOLLQIRUPDWLYLGHOOHFDPSDJQHGLLQIRUPD]LRQHUHJLRQDOLqSURVHJXLWDDQFKH
QHOFRQODGLVWULEX]LRQHPLQX]LRVDGLSLHJKHYROLHORFDQGLQHLQWXWWLLOXRJKLGLPDJJLRUHDIIOXHQ]DGL
FLWWDGLQLSUHYHQ]LRQH$,'6WHUDSLDGHOGRORUHHLOFRQWUROORGHOGRORUHSRVWRSHUDWRULRIDVFLFRORVDQLWDULR
HOHWWURQLFR YDFFLQD]LRQH DQWLQIOXHQ]DOH GRQD]LRQH VDQJXH SURYYHGLPHQWL GL VRVWHJQR GD SDUWH GHO
665HFFHWHUD
'LVHJXLWRVLULSRUWDQRLSULQFLSDOLULVXOWDWLGHOOHVHJQDOD]LRQLGHLFLWWDGLQLULIHULWHDOO¶DQQRVLFRQVLGHUL
FKH LQ WDOH SHULRGR VRQR VWDWL HIIHWWXDWL LQ $]LHQGD ULFRYHUL H ROWUH PLOLRQL GL SUHVWD]LRQL
DPEXODWRULDOL
,OJUDILFRSURSRQHLOFRQIURQWRFRQLGDWLGHOO¶DQQRSUHFHGHQWH
7DEHOOD/HVHJQDOD]LRQLSHUYHQXWHDOO¶8USQHO
7RWDOHVHJQDOD]LRQL
HORJL
UHFODPL
ULOLHYL
VXJJHULPHQWL
LPSURSUL
*UDILFR7LSRORJLDGLVHJQDOD]LRQLSHUYHQXWHDOO¶8USDQQL
dŝƉŽůŽŐŝĂƐĞŐŶĂůĂnjŝŽŶŝ
ϴϮϰ
ϵϬϬ
ϴϬϬ
ϳϬϬ
ϲϬϬ
ϰϬϬ
ϮϬϭϮ
ϰϱϴ
ϱϬϬ
ϮϬϭϯ
ϯϮϭ Ϯϲϱ
ϯϬϬ
ϮϬϬ
ϭϬϬ
ϴϯ ϱϵ
ϲ
Ϭ
ϭ
ϭ
6LVWHPDGLUHOD]LRQLHVWUXPHQWLGLFRPXQLFD]LRQH
1XPHURYHUGH
/¶$]LHQGD 2VSHGDOLHUR8QLYHUVLWDULD GL 3DUPD QHO FRUVR GHO KD DJJLRUQDWR FRVWDQWHPHQWH OH
LQIRUPD]LRQL FRQWHQXWH QHOOD EDQFD GDWL GHO 1XPHUR 9HUGH UHJLRQDOH DO ILQH GL VRGGLVIDUH L ELVRJQL
VSHFLILFL VRSUDWWXWWR LQ WHPD GL DFFHVVR DL 6HUYL]L H FRQ SDUWLFRODUH DWWHQ]LRQH YHUVR OH SUHVWD]LRQL GL
VSHFLDOLVWLFDDPEXODWRULDOHPDJJLRUPHQWHULFKLHVWHGDJOLXWHQWL
/D JDUDQ]LD GL GDWL HVDWWL H YDOLGL KD FRQVHQWLWR XQD FRUUHWWD DWWLYLWj LQIRUPDWLYD GHO FDOO FHQWHU H XQD
SURILFXD FRQVXOWD]LRQH RQOLQH GD SDUWH GHL FLWWDGLQLVXO SRUWDOH ³6DOXWHU´ GHOOD 5HJLRQH (PLOLD5RPDJQD
/¶8US KD LQROWUH JDUDQWLWROH ULVSRVWH DOOH GRPDQGHGL VHFRQGR OLYHOORSHUYHQXWH GDO FDOO FHQWHU UHJLRQDOH
JHVWHQGR FRQ OD FRQVXHWD DWWHQ]LRQH LQIRUPD]LRQL FRPSOHVVH FKH KDQQR ULFKLHVWR VSHFLILFL
DSSURIRQGLPHQWL
6LVWHPDGLUHOD]LRQLHVWUXPHQWLGLFRPXQLFD]LRQH
/DFRPXQLFD]LRQHSHUOHVFHOWHGLLQWHUHVVHSHUOD
FRPXQLWj
/D FRPXQLFD]LRQH SHU OH VFHOWH GL LQWHUHVVH SHU OD FRPXQLWj ROWUH DG HVVHUH YHLFRODWD DWWUDYHUVR LO VLWR
LQWHUQHWD]LHQGDOHDYYLHQHWUDPLWHODUHGD]LRQHGLFRPXQLFDWLVWDPSDHDOO¶RUJDQL]]D]LRQHGLFRQIHUHQ]H
VWDPSD GD SDUWH GHOO¶XIILFLR &RPXQLFD]LRQH D]LHQGDOH /H SULQFLSDOL DWWLYLWj GHOO¶2VSHGDOH GL 3DUPD
YHQJRQRFRVuSRUWDWHDFRQRVFHQ]DGHLFLWWDGLQLWUDPLWHJOLRUJDQLGLLQIRUPD]LRQL
$OWUR LPSRUWDQWH VWUXPHQWR SHU OD FRPXQLWj q LQROWUH UDSSUHVHQWDWR GDOOH FDPSDJQH LQIRUPDWLYH VLD D
OLYHOOR ORFDOH FKH VX VFDOD UHJLRQDOH R QD]LRQDOH PLUDWH DOOD SURPR]LRQH GL VSHFLILFKH LQL]LDWLYH WHVH DG
LQFLGHUHVXDELWXGLQLFRPSRUWDPHQWLHFRUUHWWLVWLOLGLYLWD/¶$]LHQGDLQIDWWLSDUWHFLSDDOFRRUGLQDPHQWR
UHJLRQDOHSHUODFRPXQLFD]LRQHHO¶LQIRUPD]LRQHLQVDQLWjGHOOD5HJLRQH(PLOLD5RPDJQD
,Q TXHVWD VHGH YHQJRQR SURSRVWH GLVFXVVH HG HODERUDWH OH FDPSDJQH GL LQIRUPD]LRQH D YDVWR UDJJLR
GRQD]LRQHVDQJXHYDFFLQD]LRQHDQWLQIOXHQ]DOHVFUHHQLQJHFFHWHUDFKHYHGRQRLPSHJQDWLJOLRSHUDWRUL
GHJOL 8IILFL &RPXQLFD]LRQH GHOOH $]LHQGH GLUHWWDPHQWH FRLQYROWH ,QILQH QHOO¶RWWLFD GL VRGGLVIDUH VHPSUH
PHJOLRLOELVRJQRLQIRUPDWLYRGHLVLQJROLXWHQWLHGLIDFLOLWDUHO¶DFFHVVRDLVHUYL]LDOO¶LQWHUQRGHOODVWUXWWXUH
VDQLWDULHqSURVHJXLWDQHOFRUVRGHOODSUHGLVSRVL]LRQHGLEURFKXUHHPDWHULDOHLQIRUPDWLYR
/¶2VSHGDOHGHL%DPELQLGL3DUPD
,O JHQQDLR q VWDWR LQDXJXUDWR O¶2VSHGDOH GHL
%DPELQL GL 3DUPD GHGLFDWR D 3LHWUR %DULOOD
/¶LQDXJXUD]LRQH FIU %G0 FDSLWROR O¶HQWUDWD LQ
IXQ]LRQH GHL UHSDUWL H OH YDULH LQL]LDWLYH FKH VL VRQR
VXVVHJXLWH GXUDQWH LO FRUVR GHOO¶DQQR KDQQR LPSHJQDWR
XQDSDUWHFRQVLVWHQWHGHOO¶DWWLYLWjGLFRPXQLFD]LRQHWUDOD
ILQHGHOHLOGLFHPEUH
/¶LQDXJXUD]LRQH GHOO¶2VSHGDOH SHGLDWULFR DOOD SUHVHQ]D
GHO 0LQLVWUR GHOOD 6DOXWH H GHO 3UHVLGHQWH GHOOD 5HJLRQH
(PLOLD5RPDJQD KD ULVFRVVR XQ VHQWLWR FRLQYROJLPHQWR
GHOOD FLWWDGLQDQ]D H XQD IRUWH ULVRQDQ]D GD SDUWH GHL
PHGLD ORFDOL ,O JUDQGH LQWHUHVVH H O¶DOWR OLYHOOR GL
DWWHQ]LRQH VXVFLWDWR GDOOD QXRYD VWUXWWXUD SHGLDWULFD KD
ULFKLHVWR GD SDUWH GHOO¶$]LHQGD XQD JRYHUQDQFH GHOOD
FRPXQLFD]LRQHSURSULRSHUSRWHUULVSRQGHUHDOOHULFKLHVWH
GHJOL RSHUDWRUL GHOOH DVVRFLD]LRQL GL YRORQWDULDWR H GHL
FLWWDGLQLDWWUDYHUVRLPH]]LGLLQIRUPD]LRQHGLPDVVD
/¶DWWLYLWjGLFRPXQLFD]LRQHGHOO¶$]LHQGDVLqTXLQGLFRQWUDGGLVWLQWDILQGDVXELWRVHJXHQGRWXWWHOHIDVLGL
WUDVIHULPHQWR GHL UHSDUWL GL FXUD GDO YHFFKLR SDGLJOLRQH SHGLDWULFR DO QXRYR 2VSHGDOH GHL %DPELQL
DQQXQFLDQGR RJQL VSRVWDPHQWR VLD DWWUDYHUVR O¶LQYLR GHL FRPXQLFDWL DOOD VWDPSD ORFDOH VLD FRQ OD
SXEEOLFD]LRQH GHL WUDVIHULPHQWL QHO VLWR ZHE H QHOOD LQWUDQHW 8QD FRPXQLFD]LRQH TXLQGL ULYROWD VLD
DOO¶LQWHUQRFKHDOO¶HVWHUQRDOILQHGLJDUDQWLUHODFRUUHWWH]]DGHOOHLQIRUPD]LRQLDWXWWLJOLDWWRULFRLQYROWL
/¶RVSHGDOHGHL%DPELQLGL3DUPDVLFRQWUDGGLVWLQJXH
SHU XQ¶DOWD VSHFLDOL]]D]LRQH GHOOH FXUH H SHU XQD
RUJDQL]]D]LRQH
GHOO¶DVVLVWHQ]D
FKH
SRQH
XQ¶DWWHQ]LRQH SDUWLFRODUH YHUVR L EDPELQL OH ORUR
IDPLJOLHSHUWHQGHUHLOSLSRVVLELOHYHUVRLOPDVVLPR
EHQHVVHUH ILVLFR PD DQFKH SVLFRORJLFR /¶DOWD
FRPSOHVVLWjGHOOHFXUHHGHOO¶DVVLVWHQ]DGHOO¶RVSHGDOH
GHL%DPELQLKDULFKLHVWRXQ¶DWWHQ]LRQHSDUWLFRODUHGD
SDUWH GL WXWWR LO SHUVRQDOH GHOO¶$]LHQGD GXUDQWH OD
IDVH GHL WUDVIHULPHQWL GHL UHSDUWL SHU IDU VL FKH LO
SDVVDJJLRGDOYHFFKLRSDGLJOLRQHSHGLDWULFRDOQXRYR
2VSHGDOH GHL %DPELQL SRWHVVH DYYHQLUH VHQ]D
DOFXQDLQWHUUX]LRQHGHOO¶DWWLYLWjVLDGDOSXQWRGLYLVWD
PHGLFRFKHLQIHUPLHULVWLFR
,O WUDVIHULPHQWR GHL UHSDUWL GL FXUD RUJDQL]]DWR LQ
WUH IDVL GL VSRVWDPHQWR q LQL]LDWR D SDUWLUH GD
IHEEUDLR /D GHJHQ]D H LO 'D\ KRVSLWDO
GHOO¶8QLWj 2SHUDWLYD GL 3HGLDWULD H 2QFRHPDWRORJLD VRQR VWDWL L SULPL UHSDUWL DG RFFXSDUH OD QXRYD
VWUXWWXUD , SLFFROL DPPDODWL GHO UHSDUWR VRQR VWDWL DFFRPSDJQDWL QHOOH QXRYH VWDQ]H FDUDWWHUL]]DWH GD
FRORUL YLYDFL DUUHGL FKH RIIURQR WDYROL SHU L FRPSLWL DPSL VSD]L SHU SHUPHWWHUH DWWLYLWj OXGLFKH H SDUHWL
DWWUH]]DWH SHU YLGHRJLRFKL H ULSURGX]LRQH GL ILOP /¶DFFRJOLHQ]D GHJOL DPELHQWL UHDOL]]DWL QHOOD QXRYD
VWUXWWXUDSHGLDWULFDVRQRO¶DWWXD]LRQHGLXQSURJHWWRFKHKDSRVWRXQDSDUWLFRODUHDWWHQ]LRQHDO³EDPELQR´
FKHULFRYHUDWRLQRVSHGDOHHVSULPHFRPXQTXHODQHFHVVLWjGLFRQWLQXDUHDYLYHUHODSURSULDGLPHQVLRQH
GLJLRFRHDSSUHQGLPHQWR
6HPSUH D IHEEUDLR LQ TXHVWD SULPD IDVH LO WUDVIHULPHQWR GHOOH XQLWj RSHUDWLYH q SURVHJXLWR FRQ
O¶DWWLYD]LRQH GHOOD 3HGLDWULD *HQHUDOH H G¶XUJHQ]D H OD &OLQLFD SHGLDWULFD DO WHU]R SLDQR GHO SDGLJOLRQH H
O¶DSHUWXUDGHOO¶RVVHUYD]LRQHEUHYHHGHOODUDGLRORJLDSHGLDWULFDDOSLDQRWHUUD
1HO PHVH GL PDU]R FRQ LO WUDVIHULPHQWR GHOOD &KLUXUJLD SHGLDWULFD H O¶DWWLYD]LRQH GHO EORFFR RSHUDWRULR DO
VHFRQGRSLDQRO¶2VSHGDOHGHL%DPELQLqHQWUDWRQHOYLYRGHOOHSURSULHIXQ]LRQL
,QILQHQHOPHVHGLDSULOHVRQRVWDWHWUDVIHULWHOD1HRQDWRORJLDHOD7HUDSLDLQWHQVLYDQHRQDWDOHSUHVVRLO
VHFRQGRSLDQRGHOODVWUXWWXUDSHGLDWULFD,OUHSDUWRHVWUHPDPHQWHDOO¶DYDQJXDUGLDRVSLWDLSLFFROLSD]LHQWL
QDWLSUHPDWXULRFRQJUDYLSDWRORJLHHGqGRWDWRGLSRVWLOHWWRGHGLFDWLDOODGHJHQ]DHSRVWLOHWWRGL
WHUDSLDLQWHQVLYDQHRQDWDOH
/¶DSHUWXUDGHO*LDUGLQRGHLVRUULVL
1HO PHVH GL PDJJLR q VWDWR LQDXJXUDWR LO JLDUGLQR GHL 6RUULVL GHOO¶2VSHGDOH GHL %DPELQL GL 3DUPD
³3LHWUR %DULOOD´ LO SDUFR JLRFKL UHDOL]]DWR JUD]LH D XQD GRQD]LRQH GL XQ¶D]LHQGD SULYDWD FKH QH KD
VRVWHQXWRGLUHWWDPHQWHODSURJHWWD]LRQHHODUHDOL]]D]LRQHFRQODVXSHUYLVLRQHGHOO¶2VSHGDOH
6RQRVWDWLRUJDQL]]DWLXQDVHULHGLHYHQWLOXGLFLSHQVDWL
SHULSLFFROLGHJHQWLGHOODVWUXWWXUDSHGLDWULFDHULYROWLD
WXWWL L EDPELQL GHOOD FLWWj LQWHUHVVDWL 3URVHJXH FRVu OD
PLVVLRQ GHOOD QXRYD VWUXWWXUD SHGLDWULFD FKH WHQGH
DOO¶LQWHJUD]LRQHWUDTXRWLGLDQLWjHFXUDSHUIDUVLFKHL
SD]LHQWL RVSLWL VL VHQWDQR VHPSUH PHQR LVRODWL H
SRVVDQR FRQWLQXDUH D YLYHUH OD GLPHQVLRQH GL JLRFR
SURSULDGHOO¶LQIDQ]LDHDGROHVFHQ]D
,O SULPR LQFRQWUR QHO JLDUGLQR GHL VRUULVL VL q VYROWR
DOO¶LQVHJQD GHOOD QDUUD]LRQH DQLPDWD VWRULH GLYHUWHQWL
EDWWXWHHVLWXD]LRQLEXIIHKDQQRDOOLHWDWRODJLRUQDWDq
VWDWR LQROWUH UHDOL]]DWR LO ODERUDWRULR FUHDWLYR ³9LDJJLR
GL VRJQL D FRORUL´ FRQ OD FRVWUX]LRQH GHO NDPLVKLEDL
IDPRVRWHDWURGLFDUWDGHOODWUDGL]LRQHJLDSSRQHVHFRQWHQLWRUHGLVWRULHHDWWLYLWjSHUODJLRLDGHLSLFFROL
SD]LHQWL 1HO PHVH GL OXJOLR D GLVWDQ]D XQ PHVH VL q WHQXWR LO VHFRQGR DSSXQWDPHQWR QHO JLDUGLQR ³'D
FRVDQDVFHFRVD´ORVSHWWDFRORWHDWUDOHUHDOL]]DWRGDJOLHGXFDWRULGL$XURUDGRPXVFRQODFROODERUD]LRQHGL
*LRFDPLFR ,O WHPD GHOOD UDSSUHVHQWD]LRQH WHDWUDOH q VWDWR LO ULFLFOR JOL DWWRUL ³SHU GLOHWWR´ DWWUDYHUVR OD
6LVWHPDGLUHOD]LRQLHVWUXPHQWLGLFRPXQLFD]LRQH
,WUDVIHULPHQWLGHLUHSDUWL
UDSSUHVHQWD]LRQH GL SHUVRQDJJL GL IDQWDVLD H EDWWXWH GLYHUWHQWL KDQQR DFFRPSDJQDWR L EDPELQL DOOD
VFRSHUWD GHOOH LQILQLWH SRVVLELOLWj GL ULFLFOR FKH KDQQR RJJHWWL VHQ]D YDORUH FRVu GD FRQVHQWLUH D WXWWL L
SUHVHQWL GL SRWHU VSHULPHQWDUH ³OD WUDVIRUPD]LRQH´ ,O WHU]R H XOWLPR LQFRQWUR QHO JLDUGLQR GHL VRUULVL
³6SLD]]D OD SLD]]D´ KD YLVWR PHVVD LQ VFHQD GL XQR VSHWWDFROR FLUFHQVH DG RSHUD GHJOL DQLPDWRUL
GHOO¶DVVRFLD]LRQH &LUFRODUPHQWH *LRFROLHUL VDOWLPEDQFKL FORZQ H PDHVWUL GL PDJLD KDQQR DQLPDWR LO
SRPHULJJLROXGLFRGHLSLFFROLSD]LHQWLJHQLWRULHFLWWDGLQLFRQFOXGHQGRFRVuLOFLFORGHJOLDSSXQWDPHQWLSHU
LOSHULRGRHVWLYR
6LVWHPDGLUHOD]LRQLHVWUXPHQWLGLFRPXQLFD]LRQH
/D%LEOLRWHFD³7URYD3HQVLHUL´
1HO FRUVR GHO q SURVHJXLWD OD FRPXQLFD]LRQH D VRVWHJQR GHL SURJHWWL GL XPDQL]]D]LRQH LQ DWWR
DOO¶2VSHGDOH GL 3DUPD 7UD TXHVWL WURYD VSD]LR
O¶LQDXJXUD]LRQHGHOODELEOLRWHFD³7URYD3HQVLHUL´GHGLFDWD
DLSD]LHQWLGHOUHSDUWRGL0HGLFLQD5LDELOLWDWLYD
8QD EXRQD OHWWXUD WL DFFRPSDJQD VHPSUH DQFKH LQ
2VSHGDOH
TXHVWR
LO
PHVVDJJLR
ODQFLDWR
SHU
DFFRPSDJQDUHLOQXRYRSURJHWWRQDWRGDOO¶LQFRQWURWUDOD
VWUXWWXUD
GL
0HGLFLQD
ULDELOLWDWLYD
GHOO¶$]LHQGD
2VSHGDOLHUR8QLYHUVLWDULD
GL
3DUPD
O¶,VWLWX]LRQH
%LEOLRWHFKHGHO&RPXQHGL3DUPDHO¶$VVRFLD]LRQH7UDXPL
±&DVD$]]XUUD
,O SURJHWWR KD SUHYLVWR O¶LVWLWX]LRQH GL XQD ELEOLRWHFD FRQ
XQD GRWD]LRQH LQL]LDOH GL FLUFD YROXPL
SHULRGLFDPHQWH ULQQRYDWD LQ EDVH DOOH ULFKLHVWH GHL
GHJHQWLHGHOOHORURIDPLJOLH,SD]LHQWLSRVRRQRSUHQGHUH
LQ SUHVWLWR L OLEUL GLUHWWDPHQWH GDOOD VDOD VRJJLRUQR H OHJJHUOL QHOOD SURSULD FDPHUD RSSXUH QHJOL VSD]L
FRPXQL GHO UHSDUWR ,Q DOFXQL JLRUQL GHOOD VHWWLPDQD L YRORQWDUL GHOOH GXH $VVRFLD]LRQL 7UDXPL ± &DVD
$]]XUUDH$OLFH$VVRFLD]LRQHORWWDLFWXVFHUHEUDOHFKHRSHUDQRGDDQQLDVWUHWWRFRQWDWWRFRQLOUHSDUWR
FRQWULEXLUDQQR DG DJHYRODUH PRPHQWL GL VRFLDOL]]D]LRQH H D IDYRULUH OD IUXL]LRQH GHO PDWHULDOH HVSRVWR
6DUDQQRLQROWUHRUJDQL]]DWHDWWLYLWjGLOHWWXUDSHUIDUVLFKHOHSHUVRQHULFRYHUDWHSRVVDQRWUDVFRUUHUHQHO
PLJOLRUH GHL PRGL ODORUR SHUPDQHQ]D LQ RVSHGDOH/¶LVWLWX]LRQH GHO VHUYL]LR VL EDVD HVVHQ]LDOPHQWH VXOOD
UDFFROWDGLGRQD]LRQL!
,O*LDUGLQRULDELOLWDWLYRGHOO¶2VSHGDOH
1HO FRUVR GHO OD UHDOL]]D]LRQH GHO *LDUGLQR
ULDELOLWDWLYRKDDYXWRXQQRWHYROHLPSXOVRHO¶DWWLYLWj
GL FRPXQLFD]LRQH VL q RULHQWDWD VLD D VXSSRUWR GHO
SURJHWWR FKH GHOOH UHODWLYH UDFFROWH IRQGL D VRVWHJQR
GHOODUHDOL]]D]LRQH
,O*LDUGLQRULDELOLWDWLYRVLFDUDWWHUL]]DLQIDWWLSHUFKpq
IUXWWRGLXQLPSHJQRFROOHWWLYRGDSDUWHGLQXPHURVH
UHDOWj GHOOD FLWWj H GDOOD SURYLQFLD GDOOH
DPPLQLVWUD]LRQL SXEEOLFKH DOOH DVVRFLD]LRQL GL
YRORQWDULDWR GDOOD 'LRFHVL DOOH VRFLHWj VSRUWLYH GD
D]LHQGHSULYDWHDVLQJROLFLWWDGLQL
,O VRVWHJQR FKH TXHVWL GLYHUVL VRJJHWWL KDQQR GDWR
DOOD UHDOL]]D]LRQH GHO *LDUGLQR ULDELOLWDWLYR q VWDWR
RJJHWWR GL FRPXQLFD]LRQH DO ILQH DQFKH GL
UHQGLFRQWDUH DOOD FLWWDGLQDQ]D OH VSHVH RJJHWWR GL
EHQHILFHQ]D /R VSD]LR YHUGH QHOO¶DUHD HVWHUQD GHO
SDGLJOLRQH %DUELHUL UDSSUHVHQWD XQD QRYLWj
QHOO¶DPELWRGHOOHFXUHVDQLWDULHLQFDPSRULDELOLWDWLYR
SHUFKpQRQqVRORXQDSDOHVWUDDOO¶DSHUWRSHULOUHFXSHURGHOOLYHOORGLDXWRQRPLDHGHOODTXDOLWjGLYLWD
GHLSD]LHQWLFRQGLVDELOLWjPRWRULDPDqDQFKHXQDPELHQWHLQFXLYHQJRQRULSURSRVWLJOLRVWDFROLFKH
QRUPDOPHQWH VL ULWURYDQR QHOOD UHDOWj FRPXQH 8QR VSD]LR LQ FXL OH SHUVRQH SRVVDQR VXSHUDUH OH
EDUULHUHSUHVHQWLQHOODYLWDTXRWLGLDQD
1HO O¶$]LHQGD 2VSHGDOLHUR8QLYHUVLWDULD GL 3DUPD KD GDWR
DYYLR D XQ SURJHWWR IRUPDWLYR VXOO¶DFFRJOLHQ]D RVSHGDOLHUD DOOH
GRQQHYLWWLPHGLYLROHQ]DDWWXDWRJUD]LHDGXQILQDQ]LDPHQWRGHO
GLSDUWLPHQWRGHOOH3DULRSSRUWXQLWjGHOOD3UHVLGHQ]DGHO&RQVLJOLR
GHL 0LQLVWUL SHU XQ WRWDOH GL HXUR FIU %GP /¶DWWLYLWj GL FRPXQLFD]LRQH VL q VYLOXSSDWD SHU WXWWR LO IRFDOL]]DQGRVL VXL PHVVDJJL LQHUHQWLOD UHDOL]]D]LRQH GHO SURJHWWR
HVXLGLYHUVLLQFRQWULSXEEOLFLUHDOL]]DWLQHOO¶DQQR
,O SURJHWWR KD UDSSUHVHQWDWR XQ¶RSSRUWXQLWj SHU O¶$]LHQGD SHU
UHDOL]]DUHFRQLOWHUULWRULRXQDUHWHGLVRVWHJQRDOOHGRQQHYLWWLPH
GL YLROHQ]D FRQ O¶RELHWWLYR GL IDFLOLWDUH OD IRUPXOD]LRQH GL XQD
ULFKLHVWD GL DLXWR H GL LQGLYLGXDUH SHUFRUVL DGHJXDWL D VRVWHJQR
GHOOHYLWWLPH
*OLLQFRQWUL
/¶LGHD VL q FRQFUHWL]]DWD TXLQGL DWWUDYHUVR O¶DWWXD]LRQH GL XQD
VHULH GL HYHQWL IRUPDWLYL LO SULPR GDO WLWROR ³'DOOD FXOWXUD GHOOD YLROHQ]D DOO¶HWLFD GHL VHQWLPHQWL XQR
VJXDUGRJHQHUDOHDOIHQRPHQR´ULYROWLLQSDUWLFRODUHDOSHUVRQDOHPHGLFRVDQLWDULRHDJOLRSHUDWRULVDQLWDUL
GHOO¶2VSHGDOHVFHOWLWUDTXHOOLDELWXDOPHQWHFRLQYROWLQHOO¶DVVLVWHQ]DDOOHGRQQHYLWWLPHGLYLROHQ]D
,OVHFRQGRLQFRQWUR³0HGLFLQDGHOOHGLIIHUHQ]HXQSHUFRUVRIUDLJHQHULHOHFXOWXUH´RUJDQL]]DWRGDO&8*
GL$]LHQGD86/H2VSHGDOHGL3DUPDVLqVYROWRO¶RWWRGLPDU]RLQRFFDVLRQHGHOODIHVWDGHOODGRQQD
,O WHPD GHOOD PHGLFLQD GL JHQHUH q VWDWR WUDWWDWR VHFRQGR PROWHSOLFL DVSHWWL GL PHGLFL HVSHUWL GHOOH GXH
$]LHQGHVDQLWDULHLOODYRUROHSDWRORJLHO¶DOLPHQWD]LRQHODJUDYLGDQ]DOHGRQQHVWUDQLHUHFRQO¶RELHWWLYR
GLHVSOLFLWDUHHIDUFRQRVFHUHOHGLIIHUHQ]HGLJHQHUHSHUPLJOLRUDUHODYLWDHODVDOXWHGLXRPLQLHGRQQH
1HOPHVHGLRWWREUHVLqVYROWRLOFRQYHJQRFRQFOXVLYRGHOSURJHWWRGLIRUPD]LRQHSHURSHUDWRULVDQLWDULHG
qVWDWDUDFFRQWDWDODSURFHGXUDGLDFFRJOLHQ]DLQWHUQDVFHOWDHDGRWWDWDDOO¶2VSHGDOHGL3DUPD/DJLRUQDWD
VLqFRQFOXVDFRQXQDWDYRODURWRQGDGDOWLWROR³/¶DWWLYD]LRQHGHOODUHWHSHUODSUHYHQ]LRQHHLOFRQWUDVWR
GHOODYLROHQ]D´FKHKDYLVWRDFRQIURQWRLGLYHUVLDWWRULFRLQYROWLQHOODUHWHGLVRVWHJQRDOODYLWWLPD
%ROOLQL5RVD
'RSROD YLWWRULD GHOO¶2VFDU GL %LODQFLR QHO FIU LO %LODQFLR GL
0LVVLRQH FDSLWROR QHO q DUULYDWR XQ DOWUR
LPSRUWDQWH
ULFRQRVFLPHQWR
SHU
O¶$]LHQGD
2VSHGDOLHUR
8QLYHUVLWDULD FRQ O¶DVVHJQD]LRQH GHL ³WUH %ROLQL 5RVD´ GD SDUWH
GHOOO¶2VVHUYDWRULR 1D]LRQDOH VXOOD VDOXWH GHOOD 'RQQD 21'$
/¶(QWH KD SUHPLDWR LO 0DJJLRUH GL 3DUPD FRQ LO PDVVLPR
ULFRQRVFLPHQWR D FXL SXz DVSLUDUH XQ¶D]LHQGD VDQLWDULD SHU L
VHUYL]L RIIHUWL H SHU O¶DOWR OLYHOOR GL DWWHQ]LRQH YHUVR OH SDWRORJLH
IHPPLQLOL
8Q RVSHGDOH D PLVXUD GL GRQQD q VWDWR LO PHVVDJJLR ODQFLDWR
GDOO¶$]LHQGDFRQWHVWXDOPHQWHDOODFRQVHJQDGHOSUHPLRSUHVVROD
VDOD SROLIXQ]LRQDOH GHOOD 3UHVLGHQ]D GHO &RQVLJOLR GHL 0LQLVWUL DO
GLUHWWRUH JHQHUDOH 8QD FRPXQLFD]LRQH FKH O¶XIILFLR VWDPSD KD
WHQXWR D OLYHOOR ORFDOH FRRUGLQDQGRVL FRQ O¶RVVHUYDWRULR 1D]LRQDOH
H FKH q VWDWD ULSUHVD GDL YDUL PHGLD /¶LQVHULPHQWR GHOO¶2VSHGDOH GL 3DUPD DOO¶LQWHUQR GHOOD UHWH GHOOH
VWUXWWXUH GHOO¶2VVHUYDWRULR 1D]LRQDOH VXOOD 6DOXWH GHOOD 'RQQD KD GDWR DYYLR D XQD VHULH GL LQL]LDWLYH GL
VHQVLELOL]]D]LRQL H GL SUHYHQ]LRQH VRSUDWWXWWR D FDUDWWHUH IHPPLQLOH FKH VL VYLOXSSHUDQQR QHO FRUVR GHO
,OQXPHURGL%ROOLQL5RVDGDDYLHQHDVVHJQDWRVXOODEDVHGLWUHFULWHULYDOXWDWLYLSUHVHQ]DGLVHUYL]L
QHOO¶DPELWR GHOOH VSHFLDOLWj GL PDJJLRU ULOHYR FOLQLFR HG HSLGHPLRORJLFR SHU OD SRSROD]LRQH IHPPLQLOH
DSSURSULDWH]]DGHOSHUFRUVRGLDJQRVWLFRWHUDSHXWLFRLQUHOD]LRQHDOOHHVLJHQ]HHDOOHFDUDWWHULVWLFKHSVLFR
ILVLFKHGHOODGRQQDSUHVHQ]DGLVHUYL]LSHUO"DFFRJOLHQ]DGHOODSD]LHQWHHSHUODWXWHODGHOODVXDGLJQLWj
1HOODFDQGLGDWXUDVRQRVWDWHSUHVHLQFRQVLGHUD]LRQHOHVSHFLDOLWjGLJLQHFRORJLDHRVWHWULFLDQHRQDWRORJLD
PHGLFLQD GHOOD ULSURGX]LRQH HQGRFULQRORJLD PDODWWLH H GLVWXUEL GHOO¶DSSDUDWR FDUGLRYDVFRODUH
UHXPDWRORJLD QHXURORJLD GLHWRORJLD H QXWUL]LRQH FOLQLFD GLDEHWHORJLD RQFRORJLD VHQRORJLD L VHUYL]L SHU
O¶DFFRJOLHQ]DHLOSURJHWWRD]LHQGDOHSHUFRQWUDVWDUHODYLROHQ]DVXOOHGRQQH
6LVWHPDGLUHOD]LRQLHVWUXPHQWLGLFRPXQLFD]LRQH
/¶DFFRJOLHQ]DRVSHGDOLHUDDOOHGRQQHYLWWLPHGLYLROHQ]D
8IILFLR6WDPSDHFRPXQLFD]LRQH
/¶$]LHQGD 2VSHGDOLHUR8QLYHUVLWDULD GL 3DUPD WUDPLWH LO SURSULR 8IILFLR
VWDPSD FXUD L FROOHJDPHQWL FRQ L PH]]L GL FRPXQLFD]LRQH GL PDVVD /D
IXQ]LRQH SULQFLSDOH q TXHOOD GL YHLFRODUH LO IOXVVR GHOOH LQIRUPD]LRQL LQWHUQH
YHUVR JOL RUJDQL GL LQIRUPD]LRQH DVVLFXUDQGR LO PDVVLPR JUDGR GL
WHPSHVWLYLWjWUDVSDUHQ]DHFKLDUH]]DGHOOHFRPXQLFD]LRQL
,SULQFLSDOLLQWHUORFXWRULVRQRLTXRWLGLDQLOHULYLVWHLVLWLZHEOHUDGLRHOHWY
1HO FRUVR GHO OH QRWL]LH SXEEOLFDWH VXO VLWR ZHE GHOO¶$]LHQGD
2VSHGDOLHUR8QLYHUVLWDULD GL 3DUPD ZZZDRSULW VRQR VWDWH LQ QHWWD FUHVFLWD ULVSHWWR DOOH SXEEOLFDWH QHO H OH GHO 1HO FRUVR GHO VRQR VWDWL LQYLDWL DOOD VWDPSD ORFDOH FLUFD FRPXQLFDWL ULJXDUGDQWL QHOOR VSHFLILFR O¶2VSHGDOH GHL %DPELQL GL 3DUPD PHQWUH VRQR VWDWH OH
QRWL]LHSUHVHQWDWHLQVHGHGLFRQIHUHQ]DVWDPSD3HUTXHOFKHULJXDUGDODUHWHLQWHUQDD]LHQGDOHLQWUDQHW
D]LHQGDOH VL FRQWDQR QHZV SXEEOLFDWH QHOO¶DQQR FRQWUR OH QRWL]LH GHO H OH GHO
*UDILFR$QGDPHQWRGLSXEEOLFD]LRQLGHOOHQRWL]LHFRQLSULQFLSDOLVWUXPHQWLD]LHQGDOL
Dati attività Ufficio Stampa
6LVWHPDGLUHOD]LRQLHVWUXPHQWLGLFRPXQLFD]LRQH
1HZVLQWUDQHW
1HZVVLWRZHE
&RPXQLFDWL
VWDPSD
%LODQFLRGL0LVVLRQH
1HO FRUVR GHO O¶$]LHQGD 2VSHGDOLHUR8QLYHUVLWDULD GL 3DUPD KD
SXEEOLFDWR LO VHVWR QXPHUR GHO %LODQFLR GL 0LVVLRQH UHODWLYR DOO¶DQQR 1HJOLXOWLPLDQQLLO%G0KDSUDWLFDPHQWHDEEDQGRQDWRODYHVWHFDUWDFHDH
WURYD VHPSUH SL VSD]LR QHO VLWR $]LHQGDOH /¶LGHD q TXHOOD GL IDU VL FKH
RJQLXWHQWHFKHSRVVDDSSURFFLDUVLDGXQGRFXPHQWRFRVuYDVWRDWWUDYHUVR
ODFUHD]LRQHGLSDJLQHZHEDSSRVLWHHGXQVLVWHPDGLLSHUWHVWLFKHSRVVDQR
FROOHJDUHO¶DUJRPHQWRGLLQWHUHVVHDOULVSHWWLYRFDSLWRORFKHORWUDWWD1HOOD
SDJLQD ZHE GHO %LODQFLR GL 0LVVLRQH WURYLDPR FRVu LO GRFXPHQWR
VXGGLYLVR LQ FDSLWROL H SHU RJQL FDSLWROR XQD SDJLQD ZHE LQWHUDWWLYD FKH
FRQWLHQH O¶LQWURGX]LRQH OD ULVSHWWLYD VXGGLYLVLRQH GHOOR VWHVVR LQ SDUDJUDIL
FRQ OD SRVVLELOLWj GL FROOHJDUVL GLUHWWDPHQWH DOOD SDUWH VFHOWD 6XO VLWR
ULPDQH LQROWUH KD GLVSRVL]LRQH OD SRVVLELOLWj GL YLVXDOL]]DUH LO %LODQFLR GL
0LVVLRQH FRPSOHWR LQ IRUPDWR SGI DQFK¶HVVR PLJOLRUDWR QHOOD QDYLJDELOLWj JUD]LH DOOD VXGGLYLVLRQH GHL
FDSLWROLHSDUDJUDILLPSRVWDWDDOO¶LQWHUQRGHLVHJQDOLEULHODULFHUFDSHUSDUROHFKLDYH
/DFRPXQLFD]LRQHLQWHJUDWDWUDD]LHQGHVDQLWDULH
3HUFRUVRHODERUDWRLQPRGRFRPXQHGDOOHGXH$]LHQGHVDQLWDULH
(¶SURVHJXLWRDQFKHQHOFRUVRGHOLOSHUFRUVRGLFRPXQLFD]LRQHLQWHJUDWRWUDLVHUYL]LFRPXQLFD]LRQH
GHOOHGXH$]LHQGHVDQLWDULHSDUPHQVL$OODEDVHGLTXHVWLSHUFRUVLYLqLQIDWWLO¶HVLJHQ]DGLLQWHUYHQLUHFRQ
VSHFLILFKHD]LRQLGLLQIRUPD]LRQHFRQJLXQWDSHULQIRUPDUHODFLWWDGLQDQ]DVXLQL]LDWLYHHGHYHQWLSURPRVVL
,FWXVULVSDUPLDWHPSRJXDGDJQDYLWD
/¶8IILFLR 6WDPSD QHO KD FRQWULEXLWR DOO¶RUJDQL]]D]LRQH GHOOD
FDPSDJQDGLFRPXQLFD]LRQH³,FWXVULVSDUPLDWHPSRJXDGDJQDYLWD´
YROWD DG LQIRUPDUH L FLWWDGLQL VXL VLQWRPL GL HVRUGLR GHOOD SDWRORJLD H
VXOFRUUHWWRPRGRGLUHDJLUHDWDOHHYHQWRLQIDWWLODVROHUWHFKLDPDWD
DO SXz ULGXUUH HYHQWL DYYHUVL JUDYL 8Q PHVVDJJLR DUULYDWR QHOOH
FDVH GL ROWUH IDPLJOLH SDUPLJLDQH DWWUDYHUVR O¶LQYLR WUDPLWH
SRVWD GHOOD EURFKXUH LQIRUPDWLYD H UDIIRU]DWR GDO SLDQR GL
FRPXQLFD]LRQHULYROWRDLFLWWDGLQLGL3DUPDHSURYLQFLD
/¶LQL]LDWLYD ILQDQ]LDWD GDOOD 5HJLRQH (PLOLD5RPDJQD q SDUWH GL XQR
VWXGLR GL ULFHUFD UHDOL]]DWR GDOO¶$]LHQGD 2VSHGDOLHUR8QLYHUVLWDULD GL
3DUPD VYROWR LQ FROODERUD]LRQH FRQ O¶$]LHQGD 86/ GL 3DUPD FKH KD
FRLQYROWRLQGLVWLQWHIDVLWXWWDODSRSROD]LRQHGHOOHSURYLQFHGL3DUPD
3LDFHQ]D5HJJLR(PLOLDH0RGHQD
/¶$]LHQGD KD DWWXDWR OD FRPXQLFD]LRQH DL PHGLD ORFDOL OD FRQIHUHQ]D
VWDPSDGLDYYLRGHOODFDPSDJQDHWXWWDO¶DWWLYLWjGLFRPXQLFD]LRQHDGHVVDFRQQHVVDFROODERUDQGRLQROWUH
DOODSLDQLILFD]LRQHHGLIIXVLRQHGHOODEURFKXUHLQIRUPDWLYDHGHLSRVWHULQGLYLGXDQGRLOXRJKLVWUDWHJLFLGL
PDJJLRUDIIOXVVRGLXWHQ]DDOO¶LQWHUQRGHOFRPSOHVVRRVSHGDOLHURHVXOWHUULWRULR/¶DWWLYLWjGHOO¶8IILFLRVLq
FRQFHQWUDWD VXOO¶RUJDQL]]D]LRQH SHU OD GLIIXVLRQH GHO YLGHR LQIRUPDWLYR DWWUDYHUVR L FLUFXLWL LQWHUQL
2VSHGDOLHUL GL 3DUPD H SURYLQFLD GLVSOD\ GHOOH IDUPDFLH VXO WHUULWRULR H GHOOH FLWWj LQWHUHVVDWH
/¶RUJDQL]]D]LRQH GHO ODYRUR KD FRQWHPSODWR OD UHDOL]]D]LRQH GL HYHQWL LQIRUPDWLYL QHOOD FLWWj XQ
DSSXQWDPHQWRRJQLPHVHSHUWXWWDODGXUDWDGHOODFDPSDJQDFRQO¶LVWDOOD]LRQHGLVWDQGHODSUHVHQ]DGL
SHUVRQDOH PHGLFR SHU OD FRQVHJQD GL PDWHULDOH XWLOH H SURQWR D ULVSRQGHUH DOOH GRPDQGH GHL FLWWDGLQL
%XRQD SDUWH GHOO¶DWWLYLWj GL FRPXQLFD]LRQH VL q LQFHQWUDWD LQROWUH VXOOD VXSHUYLVLRQH H PRQLWRUDJJLR GHL
SURFHVVL H GHL WHPSL GHOOD FDPSDJQD FRQ OD FROODERUD]LRQH GHJOL 8IILFL 6WDPSD GHOOH $]LHQGH 6DQLWDULH
GHOOHSURYLQFHFRLQYROWH
/¶REELHWWLYR SULPDULR GHO SURJHWWR q VWDWR TXHOOR GL SRUWDUH OD SRSROD]LRQH D FRQRVFHQ]D GHL VLQWRPL H
DJHYRODUH O¶DFFHVVR DOOH VWUXWWXUH RVSHGDOLHUH WUDPLWH LO FHUFDQGR GL DQGDUH D PLJOLRUDUH XQR GHL
SULQFLSDOL SUREOHPL QHOOD JHVWLRQH GHOO¶LFWXV FHUHEUDOH LO ULWDUGR GL DFFHVVR GHO SD]LHQWH DOOH VWUXWWXUH GL
HPHUJHQ]D1HOODUHDOWjORFDOHGL3DUPDHSLLQJHQHUDOHQHOODUHDOWjUHJLRQDOHVRORLOGHLSD]LHQWL
FRQ LFWXV LVFKHPLFR JLXQJH QHOOH VWUXWWXUH VDQLWDULH HQWUR XQ LQWHUYDOOR GL WHPSR LQIHULRUH DOOH GXH RUH
GDOO¶HVRUGLRVLULWLHQHTXLQGLFKHXQLQWHUYHQWRDGHJXDWRSRVVDFRQWULEXLUHDPLJOLRUDUHTXHVWRVFHQDULR
6LVWHPDGLUHOD]LRQLHVWUXPHQWLGLFRPXQLFD]LRQH
GDO 6HUYL]LR VDQLWDULR UHJLRQDOH FKH D OLYHOOR SURYLQFLDOH FRLQYROJRQR H LQWHJUDQR OH GXH $]LHQGH QHL
ULVSHWWLYL DPELWL Ê LO FDVR DG HVHPSLR GHOOH QXPHURVH FDPSDJQH GL LQIRUPD]LRQH SHU OD SUHYHQ]LRQH
UHDOL]]DWHQHOFRUVRGHOO¶DQQRGDOO¶$VVHVVRUDWRDOOH3ROLWLFKHSHUOD6DOXWHGHOOD5HJLRQH(PLOLD5RPDJQDH
FRQGLYLVH DOO¶LQWHUQR GHO *UXSSR FRPXQLFDWRUL SHU OD VDOXWH FRVWLWXLWR SUHVVR O¶8IILFLR FRPXQLFD]LRQH H
VWDPSD GHOOR VWHVVR $VVHVVRUDWR FXL SDUWHFLSDQR RSHUDWLYDPHQWH DQFKH L UHIHUHQWL GHOOD FRPXQLFD]LRQH
GHOOH GXH $]LHQGH ,Q TXHVWD VHGH YHQJRQR LQIDWWL DSSURIRQGLWH OH PRGDOLWj GL LPSOHPHQWD]LRQH D OLYHOOR
SURYLQFLDOHGHOOHFDPSDJQHUHJLRQDOLFRQXQUXRORDWWLYRGHLUHIHUHQWLFRPXQLFD]LRQHHVWDPSDD]LHQGDOL
GL SURSRVWD H ULFHUFD GHOOH PLJOLRUL VROX]LRQL 8Q HVHPSLR VRQR OH FDPSDJQH LQIRUPDWLYH VXJOL VFUHHQLQJ
RQFRORJLFL O¶HPHUJHQ]D FDOGR OD GRQD]LRQH GHO VDQJXH OD GRQD]LRQH H LO WUDSLDQWR GL RUJDQL /D
FRPXQLFD]LRQHLQWHJUDWDVLqVYLOXSSDWDLQROWUHLQVWUHWWRUDFFRUGRFRQOHD]LRQLGLFRPXQLFD]LRQHSUHYLVWH
GDOODSURJUDPPD]LRQHDQQXDOHGHOOD&RQIHUHQ]D7HUULWRULDOH6RFLDOHH6DQLWDULD&WVV
$OWUH LQL]LDWLYH GL FRPXQLFD]LRQH FRQJLXQWH VRQR VWDWH UHDOL]]DWH LQ DFFRUGR FRQ DOFXQH DVVRFLD]LRQL GL
YRORQWDULDWRORFDOHDGHUHQGRDFDPSDJQHQD]LRQDOL1DVWUR5RVDRORFDOLRSHULQWHUYHQLUHVXOODVWDPSD
SDUPHQVH FRQ FKLDULPHQWL R DSSURIRQGLPHQWL DQFKH VX ULFKLHVWD GHL FLWWDGLQL SHU HVHPSLR FRQ ULVSRVWH
FRQJLXQWHDOOH³/HWWHUHDO'LUHWWRUH´
,QWXWWLTXHVWLDPELWLJOL8IILFLFRPXQLFD]LRQHHVWDPSDGHOOHGXH$]LHQGHKDQQRFRQGLYLVRHLQWHJUDWROH
ULVSHWWLYH SURFHGXUH RSHUDWLYH UHDOL]]DQGR LQ PRGR FRQJLXQWR H WHPSHVWLYR LQ EDVH DOO¶RFFRUUHQ]D
PDWHULDOL H VWUXPHQWL GL FRPXQLFD]LRQH VSHFLILFL TXDOL FRPXQLFDWL H FRQIHUHQ]H VWDPSD ORFDQGLQH HG
RSXVFROL
,QILQH QHO q FRQWLQXDWD OD FROODERUD]LRQH RSHUDWLYD GHOOH GXH VWUXWWXUH GL FRPXQLFD]LRQH D]LHQGDOL
QHOO¶DPELWR GHO SURJHWWR GL ULFHUFD VFLHQWLILFR ³7ULDO FOLQLFR UDQGRPL]]DWR SHU YDOXWDUH O¶HIIHWWR GL XQD
VWUDWHJLDGLHGXFD]LRQHGHOODFRPXQLWjVXLWHPSLGLDFFHVVRRVSHGDOLHURLQFRUVRGLLFWXVDFXWR´3URJHWWR
(52, ILQDQ]LDWR GDOOD 5HJLRQH (PLOLD5RPDJQD QHOO¶DPELWR GHO 3URJUDPPD 5HJLRQH8QLYHUVLWj FKH YHGH O¶$]LHQGD 2VSHGDOLHUR8QLYHUVLWDULD GL 3DUPD TXDOH FDSRILOD H O¶$]LHQGD 8VO WUD OH XQLWj
RSHUDWLYH FRLQYROWH LQVLHPH DOOH $]LHQGH 8VO GL 3LDFHQ]D H 0RGHQD H OH $]LHQGH 2VSHGDOLHUH GL 5HJJLR
(PLOLDH0RGHQD
/D SHFXOLDULWj GHOOD FDPSDJQD GHOOD GXUDWD GL XQ DQQR VWD QHOOD SURJHWWD]LRQH GHOOR VWXGLR LQ FXL VL q
WHQXWR FRQWR GL DOFXQL HOHPHQWL FKH GRYUHEEHUR IDYRULUHO¶LPSDWWR SRVLWLYR GHOO¶LQWHUYHQWR ,Q SDUWLFRODUH
O¶LQL]LDWLYD q VWDWD VYLOXSSDWD VXOOD EDVH GL XQ¶DQDOLVL SUHOLPLQDUH GHL GHWHUPLQDQWL DQFKH SVLFRORJLFL GHO
ULWDUGR H VL q DYYDOVD GHOO¶HVSHULHQ]D GL SURIHVVLRQLVWL GHO VHWWRUH GHOOD FRPXQLFD]LRQH QHOOD VDOXWH LQ
SDUWLFRODUH GHO SURI 3HWHU 6FKXO] GLUHWWRUH GHOO¶,QVWLWXWH RI &RPPXQLFDWLRQ DQG +HDOWK GHOO¶8QLYHUVLWj GL
/XJDQR ,QILQH LO FRLQYROJLPHQWR ILQ GDOOH IDVH SUHOLPLQDUL GHOOR VWXGLR GHOO¶DVVRFLD]LRQH SHU OD ORWWD
DOO¶LFWXVFHUHEUDOH$/,&H,WDOLD2QOXVKDSHUPHVVRXQ¶LQWHUD]LRQHPDJJLRUHFRQODSRSROD]LRQH,OUXROR
DWWLYRGHOO¶$VVRFLD]LRQHqSURVHJXLWRGXUDQWHWXWWDODIDVHGHOODFDPSDJQDFRQWULEXHQGRDIDUFRQRVFHUHL
VLQWRPLGHOO¶LFWXVHDOODGLIIXVLRQHGHOO¶LQL]LDWLYDGLVHQVLELOL]]D]LRQH
/DFRPXQLFD]LRQHLQWHUQDD]LHQGDOH
/DFRPXQLFD]LRQHLQWHUQDKDFRPHGHVWLQDWDULHSURWDJRQLVWLJOLRSHUDWRULHLSURIHVVLRQLVWLGHOO¶$]LHQGDL
TXDOLGDOODFRQGLYLVLRQHGHOOHLQIRUPD]LRQLWUDJJRQREHQHILFLRSHUO¶RUJDQL]]D]LRQHGHOORURVWHVVRODYRUR
,OSURFHVVRGLFRPXQLFD]LRQHLQWHUQDDVVXPHULOHYDQ]DLQUDJLRQHGHOIDWWRFKHLOSHUVRQDOHGDXQDSDUWH
XVXIUXLVFHGHLPHVVDJJLFKHO¶$]LHQGDGLYXOJDHGDOO¶DOWUDQHGLYHQWDPH]]RGLGLIIXVLRQHYHUVRO¶HVWHUQR
,QROWUH OD SDUWHFLSD]LRQH H LO VHQVR GL DSSDUWHQHQ]D GHL GLSHQGHQWL VL ULIOHWWRQR LQ PRGR SRVLWLYR DQFKH
VXOO¶LPPDJLQHGHOO¶$]LHQGDSHUFHSLWDDOO¶HVWHUQR
6LVWHPDGLUHOD]LRQLHVWUXPHQWLGLFRPXQLFD]LRQH
,OVLWRLQWUDQHWD]LHQGDOH
/D ,QWUDQHW KD SURJUHVVLYDPHQWH DVVXQWR QHOO¶$]LHQGD XQ UXROR GL SULPR SLDQR H KD FRQVHQWLWR LO
VXSHUDPHQWR GHOOH GLIILFROWj OHJDWH DOOD
GLVORFD]LRQHGHLVHUYL]LHGHLUHSDUWLVX
XQ¶DUHD PROWR YDVWD JDUDQWHQGR
WHPSHVWLYLWj
H
FDSLOODULWj
GHOO¶LQIRUPD]LRQH
,QGLFDWRUH
TXDQWLWDWLYR GL TXHVWR FUHVFHQWH
XWLOL]]R GHOOD LQWUDQHW q UDSSUHVHQWDWR
DG HVHPSLR GDOO¶DXPHQWR GHO QXPHUR
GL ULFKLHVWH GL SXEEOLFD]LRQH GL FRUVL
FRQYHJQL
QRWL]LH
GL
LQWHUHVVH
SXEEOLFD]LRQL GL TXHVWLRQDUL SURFHGXUH
RSHUDWLYH GRFXPHQWL GL LQWHUHVVH
D]LHQGDOH 1HO FRUVR GHO OH
QRWL]LHSXEEOLFDWHQHOODKRPHSDJHVRQRVWDWHDIURQWHGHOOHGHO
/¶LQVHULPHQWR GHOOH QRWL]LH VLD QHOOD KRPH SDJH FKH QHOOH VH]LRQL LQWHUQH UDSSUHVHQWD OD SDUWH SL
SUHWWDPHQWHJLRUQDOLVWLFDGHOODLQWUDQHW,FRQWHQXWLDJJLRUQDWLTXDVLTXRWLGLDQDPHQWHHDFFRPSDJQDWLGD
XQ¶LPPDJLQH JUDILFD KDQQR UHVR LO VLWR YHUD H SURSULD ³YHWULQD´ GHOOH DWWLYLWj D]LHQGDOL 1HO VL q
UHJLVWUDWR XQ DXPHQWR GHOOH ULFKLHVWH GL SXEEOLFD]LRQH H XQD PDJJLRUH IUHTXHQ]D QHOO¶LQVHULPHQWR GHOOH
QRWL]LH GD SDUWH GHL VLQJROL VHUYL]L JUD]LH DQFKH DO VLVWHPD GL JHVWLRQH GHL FRQWHQXWL GHO SRUWDOH FKH
FRQVHQWHDGRJQLVWUXWWXUDDXWRQRPLDQHOODSXEEOLFD]LRQH1HOSRUWDOHD]LHQGDOHLQROWUHqGLVSRQLELOHOD
UDVVHJQD VWDPSD GHJOL DUWLFROL GL LQWHUHVVH VDQLWDULR FKH FRPSDLRQR VXL SULQFLSDOL TXRWLGLDQL ORFDOL H
QD]LRQDOL
*RYHUQRGHOODULFHUFD
HLQQRYD]LRQH
/D SURPR]LRQH GHOOD ULFHUFD q XQR GHL SULQFLSL IRQGDQWL
GHO 6LVWHPD 6DQLWDULR 5HJLRQDOH ,Q TXHVWR FDSLWROR
YHQJRQR LOOXVWUDWH OH D]LRQL SURPRVVH SHU IDYRULUH OD
SDUWHFLSD]LRQH DWWLYD DG DWWLYLWj GL ULFHUFD H
LQQRYD]LRQHFRPHLQL]LRGLXQSHUFRUVRFKHFRQGXFDDG
XQD SLHQD UHVSRQVDELOLWj GD SDUWH GHO VLVWHPD VDQLWDULR
SXEEOLFRQHOFDPSRGHOJRYHUQRGHOODULFHUFD
'LVHJXLWRVRQRLQGLYLGXDWLJOLDPELWLGLULIHULPHQWR
•
$WWLYLWjGHOO¶LQIUDVWUXWWXUDSHUODULFHUFDH
O¶LQQRYD]LRQH
•
6YLOXSSRGLXQDPELHQWHFXOWXUDOHIDYRUHYROH
•
*DUDQ]LHGLWUDVSDUHQ]D
*RYHUQRGHOODULFHUFDHLQQRYD]LRQH
/D ULFHUFD VFLHQWLILFD LQ TXDOVLDVL IRUPD ELRPHGLFD FOLQLFD HSLGHPLRORJLFD VL SRQH FRPH
RELHWWLYR XOWLPR LO PLJOLRUDPHQWR GHOOD VDOXWH 6XOOD VWUDGD YHUVR TXHVWR WUDJXDUGR WXWWDYLD
HVLVWRQRGLYHUVLRVWDFROLFKHSRVVRQRSUHFOXGHUQHLOVXFFHVVRILJHSRUWDUHTXLQGLDVSUHFR
GL ULVRUVH HG HQHUJLH VHQ]D RWWHQHUH UHDOL HIIHWWL VXOOD SUDWLFD FOLQLFD R VXOOD FRQRVFHQ]D 8QD
VHULHGLSDSHUSXEEOLFDWLQHOVXOODSUHVWLJLRVDULYLVWD7KH/DQFHW>³5HVHDUFK,QFUHDVLQJ
YDOXH UHGXFLQJ ZDVWH´@ VFULWWL GD HVSHUWL PRQGLDOL VX TXHVWL WHPL VXJJHULVFH VROX]LRQL SHU
ULGXUUHJOLVSUHFKLSUHVHQWLGXUDQWHWXWWRO¶DUFRGLUHDOL]]D]LRQHGLXQRVWXGLRGDOODVFHOWDGLXQ
TXHVLWR QRQ DGHJXDWR DOOD GHILQL]LRQH GL XQD PHWRGRORJLD QRQ FRUUHWWD ILQR DOOD PDQFDWD
SXEEOLFD]LRQH GHL ULVXOWDWL H D XQD LQVXIILFLHQWH FRPXQLFD]LRQH FRQ LO SXEEOLFR &RPH HYLGHQWH
QHOOD ILJXUD TXHVWL DVSHWWL VRQR VWUHWWDPHQWH FRQQHVVL FRPH JOL DQHOOL GL XQD FDWHQD H VRQR
WXWWLSXQWLFULWLFLGDWHQHUHVRWWRFRQWUROORDIILQFKpODULFHUFDVLDGDYYHURGLTXDOLWjHFRPSRUWL
XQUHDOHSD\EDFNLQWHUPLQLGLVDOXWH
)LJXUD)RQWLGLVSUHFKLSUHVHQWLGXUDQWHWXWWRO¶DUFRGLUHDOL]]D]LRQHGLXQRVWXGLR>&KDOPHUV
7KH/DQFHW@
,TXHVLWLVRQRULOHYDQWL
SHULFOLQLFLHLSD]LHQWL"
,OGLVHJQRHLPHWRGL
VRQRDSSURSULDWL"
/DSXEEOLFD]LRQH
FRPSOHWDGHLULVXOWDWLq
DFFHVVLELOH"
,OUHSRUWILQDOHq
LPSDU]LDOHH
XWLOL]]DELOH"
,TXHVLWLWUDWWDWLKDQQR
EDVVDSULRULWj
1RQYHQJRQRYDOXWDWLHVLWL
LPSRUWDQWL
,FOLQLFLHLSD]LHQWLQRQ
VRQRFRLQYROWLQHOOD
SLDQLILFD]LRQHGHOODULFHUFD
2OWUHLOGHJOLVWXGLq
SLDQLILFDWRVHQ]D
ULIHULPHQWLDUHYLVLRQL
VLVWHPDWLFKHGLHYLGHQ]H
JLjHVLVWHQWL
2OWUHLOGHJOLVWXGL
QRQSUHYHGHPLVXUH
DGHJXDWHSHUULGXUUHOH
IRQWLGLELDV²HV
DOORFD]LRQHDOWUDWWDPHQWR
VHQ]DPDVFKHUDPHQWR
2OWUHLOGHJOLVWXGL
QRQYLHQHSXEEOLFDWRQHOOD
YHUVLRQHFRPSOHWD
*OLVWXGLFRQULVXOWDWL
QHJDWLYLYHQJRQR
SXEEOLFDWLPHQR
IUHTXHQWHPHQWH
2OWUHLOGHJOL
LQWHUYHQWLFRQGRWWLQHJOL
VWXGLQRQYLHQHGHVFULWWR
VXIILFLHQWHPHQWH
2OWUHLOGHJOLHVLWL
SUHYLVWLQHLSURWRFROOLGL
VWXGLRQRQYLHQHULSRUWDWR
/DPDJJLRUSDUWHGHL
ULVXOWDWLGLQXRYLVWXGLQRQ
YLHQHLQWHUSUHWDWDQHO
FRQWHVWRGLXQD
YDOXWD]LRQHVLVWHPDWLFDGL
DOWUHHYLGHQ]HULOHYDQWL
,QTXHVWDVHULHGLDUWLFROLJOLDXWRULULEDGLVFRQRFKHPROWLSUREOHPLSRWUHEEHURHVVHUHDIIURQWDWL
WUDPLWH DGHJXDWL VLVWHPL UHJRODWRUL H GL JRYHUQDQFH GHOOD ULFHUFD FKH VH LPSOHPHQWDWL LQ
PDQLHUD HIILFLHQWH H QRQ FRPH PHUL VWUXPHQWL EXURFUDWLFL FRPH VSHVVR SXUWURSSR DYYLHQH
SRVVRQR RULHQWDUH LO SHUFRUVR GL UHDOL]]D]LRQH GHL SURJHWWL FRQ SDUWLFRODUH DWWHQ]LRQH DL SXQWL
SLFULWLFLGRYH qSLSUREDELOHFKH VLJHQHULQRJOLVSUHFKL ,QSDUWLFRODUHYHQJRQR HYLGHQ]LDWL
GXHLQWHUYHQWLYROWLDIDYRULUHO¶HVHFX]LRQHGLVWXGLGLTXDOLWjO¶DPSLDSDUWHFLSD]LRQHGLSD]LHQWL
D VWXGL FOLQLFL H OH DWWLYLWj VLVWHPDWLFKH GL PRQLWRUDJJLRYHULILFD GXUDQWH O¶HVHFX]LRQH GHOOR
VWXGLR
5HODWLYDPHQWH DO SULPR SXQWR XQD GHOOH D]LRQL UDFFRPDQGDWH q LO SRWHQ]LDPHQWR GHOOD
FRPXQLFD]LRQH GHOOD ULFHUFD ULYROWD DO SXEEOLFR ROWUH FKH DOOD FRPXQLWj VFLHQWLILFD VLD VXL
SURJHWWL LQ DWWR VLD VXL ULVXOWDWL GL VWXGL FRQFOXVL >*RGOHH %0- &KDOPHUV %0-@
/¶HVLJHQ]D GL WUDVSDUHQ]D QHOOD ULFHUFD RJJL q VRVWHQXWD FRQ YLJRUH GD ILJXUH DXWRUHYROL H
DVVRFLD]LRQL VFLHQWLILFKH FKH QHO KDQQR GDWR YLWD D XQ DSSHOOR LQWHUQD]LRQDOH SHU OD
UHJLVWUD]LRQH GHJOL VWXGL LQ IDVH GL DYYLR H OD GLVVHPLQD]LRQH GHL ULVXOWDWL >ZZZDOOWULDOVQHW@
6RQR LQROWUH LQ DWWR VYDULDWH LQL]LDWLYH SHU VWLPRODUH O¶LQWHUHVVH GHO SXEEOLFR VXL WHPL GHOOD
ULFHUFD DXPHQWDUH OD FRQVDSHYROH]]D GHOO¶LPSRUWDQ]D GL DWWXDUH VWXGL FOLQLFL H GHO UXROR
IRQGDPHQWDOH GHO SD]LHQWH $ OLYHOOR LQWHUQD]LRQDOH FLWLDPR WUD WDQWL LO SURJHWWR EULWDQQLFR
³,QYROYH´ LO SURJHWWR HXURSHR (&5$1 H LO VLWR ³7HVWLQJ7UHDWPHQWV´ FKH ULSRUWD PDWHULDOH
VSHFLILFDPHQWHVFULWWRSHUSD]LHQWLSURGRWWRGDHVSHUWLPRQGLDOLHWUDGRWWRLQGLYHUVHOLQJXH$
5LFHUFDHLQQRYD]LRQH
635(&2'(//$5,&(5&$
OLYHOORLWDOLDQRGLQRWHYROHULOLHYRqLOSURJHWWR3DUWHFLSDVDOXWHFRRUGLQDWRGDOWHDPGHOO¶,VWLWXWR
0DULR1HJULGL0LODQR
)LJXUD$OFXQHLQL]LDWLYHYROWHDVWLPRODUHO¶LQWHUHVVHGHOSXEEOLFRVXOODULFHUFD
5LFHUFDHLQQRYD]LRQH
3HU TXDQWR ULJXDUGD LO PRQLWRUDJJLR q RUPDL ULFRQRVFLXWD O¶LPSRUWDQ]D GL HIIHWWXDUH YHULILFKH
SHULRGLFKHQHOOHVHGLGHJOLVWXGLFOLQLFLFRQGRWWHGDSHUVRQDOHHVSHUWRSHUYHULILFDUHO¶DGHVLRQH
DO SURWRFROOR GL VWXGLR DOOH QRUPDWLYH YLJHQWL H DOOH *RRG &OLQLFDO 3UDFWLFH OLQHH JXLGD
LQWHUQD]LRQDOL LQWHVH D WXWHODUH OD VLFXUH]]D H L GLULWWL GHL VRJJHWWL LQ VWXGLR H JDUDQWLUH
O¶DIILGDELOLWjGHLGDWL/¶DWWXD]LRQHGLVLVWHPLGLPRQLWRUDJJLRDQFKHVHFRQPRGDOLWjYDULDELOLH
FRQGLYHUVLJUDGLGLLQWHQVLWjqRUPDLSUDWLFDFRPXQHQHOOHRUJDQL]]D]LRQLVDQLWDULH>%DNREDNL
&OLQLFDO7ULDOV0DFHILHOG&OLQLFDO7ULDOV@
/D5HJLRQH(PLOLD5RPDJQDqSDUWLFRODUPHQWHDWWHQWDHSURPXRYHODTXDOLWjHODWUDVSDUHQ]D
GHOODULFHUFDVYROWDGDOOH$]LHQGHVDQLWDULHGHO665/¶DYYLRGHOO¶$QDJUDIHGHOOD5LFHUFDQHO
KDUDSSUHVHQWDWRXQSDVVRLPSRUWDQWHLQTXHVWRVHQVRLQTXDQWROHLQIRUPD]LRQLFRVuUDFFROWH
FRVWLWXLVFRQRODEDVHVXFXLSRWHUDWWXDUHLQWHUYHQWLGLPRQLWRUDJJLRHGLIIXVLRQHGHJOLVWXGL,Q
SDUWLFRODUHQHOqVWDWRDYYLDWDXQDUHYLVLRQHGHOGDWDEDVH$5(5QHOO¶RWWLFDGLVXSSRUWDUH
QHOOHD]LHQGHO¶DWWLYLWjGLPRQLWRUDJJLRVFLHQWLILFRGHLSURJHWWL
/¶DWWHQ]LRQHGHOOD5(5VXTXHVWLWHPLULVDOHFRPXQTXHDPROWRWHPSRSULPD,O3URI$OHVVDQGUR
/LEHUDWL q LQIDWWL RUPDL DFFODPDWR D OLYHOOR LQWHUQD]LRQDOH FRPH LO IDXWRUH GHOOD WUDVSDUHQ]D D
EHQHILFLR GHOOD TXDOLWj GHOOD ULFHUFD H QHO ULVSHWWR GHL GLULWWL GHL SD]LHQWL XQ HGLWRULDOH DSSDUVR
VXO%0-QHOGHILQLVFHTXHVWRFRQFHWWRLO/LEHUDWL3ULQFLSOH>&KDOPHUV%0-@/¶HQIDVL
VXOODQHFHVVLWjGLGLVVHPLQD]LRQHVLULIOHWWHDQFKHQHOODJHVWLRQHGHOEXGJHWSUHYLVWDQHLEDQGL
GHO 3URJUDPPD GL 5LFHUFD 5HJLRQH8QLYHUVLWj FKH SUHPLDQR FRQ XQ ILQDQ]LDPHQWR H[WUD L
SURJHWWLLFXLULVXOWDWLYHQJRQRSXEEOLFDWLVXULYLVWHRSHQDFFHVVFLRqFRQVXOWDELOLJUDWXLWDPHQWH
RQOLQH,QROWUHOD5(5KDDYYLDWRQHOXQDLQGDJLQHSUHVVROH$]LHQGH6DQLWDULHSHUFHQVLUH
OD SURGX]LRQH VFLHQWLILFD DWWLQHQWH DL SURJHWWL ILQDQ]LDWL GDO VXGGHWWR 3URJUDPPD GL 5LFHUFD
5(58QLYHUVLWj 'DO O¶HOHQFR GHOOH SXEEOLFD]LRQL FRQ UHODWLYR DEVWUDFW q SXEEOLFDPHQWH
DFFHVVLELOHVXOODSDJLQDGH³/DQLXVOHWWHU´KWWSODQLXVOHWWHULWHULFHUFD
/¶$]LHQGD 2VSHGDOLHUR8QLYHUVLWDULD GL 3DUPD DFFRJOLH FRQ FRQYLQ]LRQH OH LQGLFD]LRQL IRUQLWH
GDOOD 5HJLRQH H GDOOD FRPXQLWj VFLHQWLILFD LQWHUQD]LRQDOH LQ PDWHULD GL TXDOLWj H WUDVSDUHQ]D
1HO LO SURFHVVR GL PLJOLRUDPHQWR GHOOD TXDOLWj GHOOD ULFHUFD JLj LQ FRUVR q VWDWR
SRWHQ]LDWR FRQ O¶DYYLR GHOOH DWWLYLWj GL PRQLWRUDJJLR GHJOL VWXGL SUHVVR OH XQLWj RSHUDWLYH H OD
UHDOL]]D]LRQH GL QXRYH 3URFHGXUH 2SHUDWLYH 6WDQGDUG 623 SHU OD ULFHUFD H LQWHJUDWR FRQ
LQL]LDWLYHDWWHDULFRQRVFHUH HYDORUL]]DUHLOUXRORDWWLYRGLFLWWDGLQLHSD]LHQWLQHOODULFHUFD HD
JDUDQWLUHORURLOGLULWWRGHOO¶DFFHVVRDJOLVWXGLFOLQLFL6LYHGDODVH]LRQHVXFFHVVLYDSHUGHWWDJOL
VXOOHVLQJROHDWWLYLWj
$WWLYLWjGHOO¶LQIUDVWUXWWXUDSHUODULFHUFDHO¶LQQRYD]LRQH
3HUOD825LFHUFDH,QQRYD]LRQHLOKDUDSSUHVHQWDWRXQDQQRGLJUDQGLRSSRUWXQLWj6RQR
LQIDWWLVWDWHLQWHQVLILFDWHWXWWHTXHOOHDWWLYLWjGLVXSSRUWRDOODULFHUFDHDLULFHUFDWRULDVHUYL]LR
GHOOD TXDOLWj H GHOO¶HIILFLHQ]D H PHJOLR GHILQLWH OH PRGDOLWj LQ FXL WDOH VXSSRUWR VL DWWXD ,O
FRQWULEXWR GHOOD VWUXWWXUD JUD]LH DOOH FRPSHWHQ]H LQ FRQWLQXR DJJLRUQDPHQWR FRQ IRUPD]LRQH
VSHFLILFDVSD]LDOXQJRWXWWRO¶DUFRGLUHDOL]]D]LRQHGHLSURJHWWLFRPHULDVVXQWRQHOODILJXUD
,Q SDUWLFRODUH SHU JOL VWXGL VSRQWDQHL LGHDWL H DWWXDWL GDL SURIHVVLRQLVWL GHOO¶$28 GL 3DUPD
YLHQHIRUQLWRVRVWHJQRPHWRGRORJLFRILQGDOODGHILQL]LRQHGHOSURWRFROORSHUODVWHVXUDGHOSLDQR
HFRQRPLFR SHU IDYRULUH O¶DWWXD]LRQH GHOOR VWXGLR LQ DGHVLRQH DO SURWRFROOR VFLHQWLILFR
FROODERUDQGR DOOD VWHVXUD GHOOD SXEEOLFD]LRQH VFLHQWLILFD H DOOD GLVVHPLQD]LRQH GHL ULVXOWDWL
$FFDQWRDTXHVWHDWWLYLWjOD82RIIUHFRVWDQWHPHQWHWUDLQLQJVXLIRQGDPHQWLGHOODPHWRGRORJLD
GHOODULFHUFD$OFXQHGLTXHVWHDWWLYLWjVFHOWHSHUULOHYDQ]DHLQQRYDWLYLWjVRQRGHVFULWWHQHOOH
VFKHGHRELHWWLYRDOODILQHGHOSDUDJUDIR
6LqLQROWUHSURVHJXLWRFRQO¶DWWXD]LRQHGHOOHD]LRQLSULRULWDULHFRQWHQXWHQHOOD'*5Q
GHOOXJOLRUHDOL]]DQGROHVHJXHQWLDWWLYLWjSULQFLSDOL
$]LRQH (¶ VWDWR UHGDWWR LO 3LDQR GHOOH $WWLYLWj GL 5LFHUFD JUD]LH DOOD VWUHWWD
FROODERUD]LRQH FRQ LSURIHVVLRQLVWLLQ SDUWLFRODUH FRQ L 5HIHUHQWL 'LSDUWLPHQWDOL GHOOD 5LFHUFD H
FRQLO%RDUGFIUVFKHGD³/HDWWLYLWjHLWHDPGLULFHUFDLO3LDQR´
$]LRQH $ IDYRUH GHOOD WUDVSDUHQ]D H WUDFFLDELOLWj GHOOD ULFHUFD DQFKH QHO q VWDWD
JDUDQWLWDO¶DGHVLRQHDOO¶$QDJUDIH UHJLRQDOHGHOOD5LFHUFD/D FROODERUD]LRQHWUDOD825LFHUFD H
,QQRYD]LRQH H L UHVSRQVDELOL VFLHQWLILFL GHL SURJHWWL KD DVVLFXUDWR O¶HVDXVWLYLWj H OD TXDOLWj GHL
GDWL LQVHULWL UHODWLYDPHQWH D WXWWL JOL VWXGL DYYLDWL QHO FIU OD VH]LRQH *DUDQ]LH GL
WUDVSDUHQ]D³$QDJUDIHGHOOD5LFHUFD´
5LFHUFDHLQQRYD]LRQH
)LJXUD$WWLYLWjGHOOD825LFHUFDH,QQRYD]LRQHFKHFRSURQRWXWWHOHIDVLGLDWWXD]LRQHGHOORVWXGLR
5LFHUFDHLQQRYD]LRQH
$]LRQHLO%RDUGSHUOD5LFHUFDH,QQRYD]LRQHQHOKDHVSOHWDWRODIXQ]LRQHGLYLJLODQ]D
VXOOH DWWLYLWj GL ULFHUFD LQ FRUVR SURPRVVR OD SDUWHFLSD]LRQH GHL SURIHVVLRQLVWL D EDQGL
LQWHUQD]LRQDOL FIU OD VH]LRQH ³&DSDFLWj GL DWWUD]LRQH GD SDUWH GHOOD $]LHQGD GL ULVRUVH
ILQDQ]LDULH³ H FROODERUDWR DOOH DWWLYLWj SHU OD UHDOL]]D]LRQH GHO &HQWUR &RPXQH GL 5LFHUFD FIU
VFKHGD³8QLUHOHIRU]HSHUPLJOLRUDUHODULFHUFD´
$]LRQH q VWDWD SUHGLVSRVWD H GLIIXVD OD UHSRUWLVWLFD UHODWLYD DOOH DWWLYLWj GL ULFHUFD H DOOH
SXEEOLFD]LRQL GHL SURIHVVLRQLVWL GHOOD $28 GL 3DUPD QHJOL DQQL FIU OD VH]LRQH ³*DUDQ]LHGLWUDVSDUHQ]D³5HSRUWLVWLFD´'DOO¶DQDOLVLGHLUHSRUWVLHYLQFHODFDSDFLWjGHOO¶$]LHQGD
GL IDUH ULFHUFD XWLOL]]DQGR WXWWD OD JDPPD GL DSSURFFL GLVSRQLELOL GDOOD ELRPHGLFD DOOD ULFHUFD
RUJDQL]]DWLYDHLOFRLQYROJLPHQWRGL82FKHLQSUHFHGHQ]DQRQVYROJHYDQRDWWLYLWjVFLHQWLILFD
FRPH OD 82 0HGLFLQD 5LDELOLWDWLYD H OD 82 2VWHWULFLD H *LQHFRORJLD HQWUDPEH YLQFLWULFL GL XQ
SURJHWWRILQDQ]LDWRGDOOD5(5
$]LRQHSHUSURPXRYHUHXQDULFHUFDGLTXDOLWjLQOLQHDFRQLUHTXLVLWLLQWHUQD]LRQDOLQHO
VRQR VWDWH GHILQLWH XOWHULRUL 623 D]LHQGDOL SHU OD 5LFHUFD ³0RQLWRUDJJLR GHOOD TXDOLWj GHJOL
VWXGL´ ³$XWRUL]]D]LRQH DOO¶DYYLR GHOOR VWXGLR´ ³$FTXLVL]LRQH GL EHQL H VHUYL]L´ ³*HVWLRQH GHO
IDUPDFR LQ VSHULPHQWD]LRQH´ /H 623 VRQR GRFXPHQWL FRQGLYLVL FKH UHJRODPHQWDQR OH GLYHUVH
DWWLYLWj DWWLQHQWL DOOD UHDOL]]D]LRQH GL XQR VWXGLR LQGLFDWL GDOOH OLQHH JXLGD GL EXRQD SUDWLFD
FOLQLFD FRPH SDUWH LQWHJUDQWH GL XQ VLVWHPD GL TXDOLWj HIILFDFH FIU OD VFKHGD ³6HPSOLILFDUH L
SURFHVVLHJDUDQWLUHODTXDOLWjGHJOLVWXGL´
81,5(/()25=(3(50,*/,25$5(/$5,&(5&$
5LVXOWDWLUDJJLXQWL
1HOqVWDWRUHGDWWRHVRWWRSRVWRDOOD)RQGD]LRQH&DULSDUPDLOSURJHWWRGLUHDOL]]D]LRQHGHO&HQWUR
&RPXQHGL5LFHUFD&&5XQ¶DUHDFRQFRPSHWHQ]HHWHFQRORJLHDOO¶DYDQJXDUGLDSHUORVYROJLPHQWRGL
VWXGL LQQRYDWLYL GL ULFHUFD ELRPHGLFD H FOLQLFD SUHYDOHQWHPHQWH QHOO¶DPELWR GHOOD 0HGLFLQD
3HUVRQDOL]]DWDOLQHDGLULFHUFDSULRULWDULDSHUO¶$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGL3DUPD
,O&&5VLDUWLFRODLQWUHDUHH
5,&(5&$',/$%25$725,2qXQDFRUHIDFLOLW\FHQWUDOHLQFXLVRQRFRQFHQWUDWHDOWHWHFQRORJLH
D VXSSRUWR GHOOH DWWLYLWj GL ULFHUFD FRQ ODERUDWRUL ELRPHGLFL FHUWLILFDWL H SHUVRQDOH TXDOLILFDWR
GRYHYHQJRQRJDUDQWLWLLOFRQWUROORGLTXDOLWjHO¶DWWLYLWjGLDXGLWGHOOHSUHVWD]LRQLHURJDWHDILQL
GLULFHUFDO¶DGHJXDWDFRQVHUYD]LRQHGHOPDWHULDOHELRORJLFRODWHQXWDGHOODGRFXPHQWD]LRQHH
GHOOHLQIRUPD]LRQLLQGLYLGXDOLVHFRQGROHQRUPDWLYHYLJHQWL
5,&(5&$ &/,1,&$ q XQ¶DUHD GHGLFDWD DOOD ULFHUFD VXL SD]LHQWL FKH KD FRPH VFRSR O¶RWWLPDOH
UHDOL]]D]LRQH GL VWXGL DWWUDYHUVR SHUFRUVL DG KRF SHU L VRJJHWWL LQ VSHULPHQWD]LRQH FRQ
SHUVRQDOHDGGHVWUDWRDOO¶HVHFX]LRQHGHOORVWXGLRWHPSLFRQJUXLSHUO¶LQIRUPD]LRQHHFRQXQD
HIILFLHQ]DRUJDQL]]DWLYDHGXQDLPSRVWD]LRQHVFLHQWLILFDDGHJXDWH
)250$=,21( 3(5 /$ 5,&(5&$ VSD]L GHGLFDWL DOOD IRUPD]LRQH VXOOD ULFHUFD SHU IDYRULUH OD
FUHVFLWD SURIHVVLRQDOH GHL JLRYDQL PHGLFL H OD ORUR FDSDFLWj GL DSSOLFDUH DL SD]LHQWL TXDQWR
DSSUHVRLQDPELWRVSHULPHQWDOH
,QROWUHVLVRQRWUDVIHULWLLQSURVVLPLWjGHO&&5O¶825LFHUFDH,QQRYD]LRQHDVXSSRUWRGHLULFHUFDWRULH
SHU OD JRYHUQDQFH GHOOH DWWLYLWj H LO &RPLWDWR (WLFR SHU IDYRULUH H UHQGHUH SL HIILFLHQWH O¶LWHU
DXWRUL]]DWLYR
,QWHUYHQWLLQIDVHGLVYLOXSSRRLQFRUVR
(YHQWXDOLSUREOHPDWLFKHULVFRQWUDWH
$ILQHDQQRqVWDWDDYYLDWDODULVWUXWWXUD]LRQHGHL 3HUODGHILQL]LRQHGHOUHJRODPHQWRFKHJDUDQWLVFDLO
ORFDOL GHGLFDWL DOO¶DUHD 5LFHUFD GL /DERUDWRULR H IXQ]LRQDPHQWR GHO &&5 RFFRUUH VWDELOLUH UHJROH
DOOD *HQHWLFD 0ROHFRODUH H OD UHGD]LRQH GHO FRPXQL FKH VLDQR ULVSRQGHQWL DOOH GLYHUVH QRUPH
SURJHWWR HVHFXWLYR UHODWLYR DOO¶DUHD GL 5LFHUFD YLJHQWLLQ2VSHGDOHHLQ8QLYHUVLWj
&OLQLFD
$FFDQWR DO UHJRODPHQWR SURSULR GHO &&5 RFFRUUHUj
(¶ VWDWR LQILQH SUHGLVSRVWR LQ FROODERUD]LRQH FRQ VWDELOLUHOHPRGDOLWjSHUO¶DPPLVVLELOLWjGHLSURJHWWL
LO %RDUG SHU OD 5LFHUFD LO UHJRODPHQWR SHU GL ULFHUFD VSRQVRUL]]DWL DQFKH DO ILQH GL SUHYHQLUH
O¶XWLOL]]R FRPXQH GL VSD]L H ULVRUVH XPDQH H OH FRQGL]LRQL FKH SRVVRQR JHQHUDUH FRQIOLWWL GL
WHFQRORJLFKH DQFKH FRQ O
8QLYHUVLWj FKH YHUUj LQWHUHVVH
SHUIH]LRQDWR GRSR O¶LQVHGLDPHQWR GHO QXRYR ,O &&5 VDUj D GLVSRVL]LRQH GL WXWWL L ULFHUFDWRUL
%RDUGQHO
GHOO¶$2835 GRYUDQQR SHUWDQWR HVVHUH LQGLYLGXDWH
OH UHVSRQVDELOLWj JHVWLRQH ULVRUVH FRRUGLQDPHQWR
HFFHWHUD DO ILQH GHO FRUUHWWR XWLOL]]R H GHO SLHQR
VIUXWWDPHQWRGHOOHSRWHQ]LDOLWj
5LFHUFDHLQQRYD]LRQH
(VLVWH RUPDL XQD IRUWH FRQVDSHYROH]]D FKH VROR DWWUDYHUVR OD FRQGLYLVLRQH GL VWUXPHQWD]LRQL GL DOWD
WHFQRORJLD H GL SHUVRQDOH DOWDPHQWH TXDOLILFDWR VL SRVVDQR VYLOXSSDUH ULFHUFKH GL EXRQD TXDOLWj FKH
FRQVHQWDQR GL WUDVODUH WHPSHVWLYDPHQWH QHOOD SUDWLFD FOLQLFD OH FRQRVFHQ]H DFTXLVLWH DWWUDYHUVR JOL
VWXGL VSHULPHQWDOL 0ROWH GHOOH WHFQRORJLH G¶DYDQJXDUGLD H GHOOH FRPSHWHQ]H VFLHQWLILFKH QHFHVVDULH
VRQR JLj SUHVHQWL QHOO¶$]LHQGD 2VSHGDOLHUR8QLYHUVLWDULD GL 3DUPD PD ULVXOWDQR GLVSHUVH LQ YDUL
ODERUDWRULHVWUXWWXUHSHULIHULFL6LqUDYYLVDWDTXLQGLODQHFHVVLWjGLXQRVIRU]RFRQJLXQWRWUD2VSHGDOH
H 8QLYHUVLWj YROWR D GDU FRUSR DG XQD VHGH XQLFD SHU DWWXDUH ULFHUFD GL DOWD TXDOLWj H DYHUH XQ
LPPHGLDWR LPSDWWR VXOOD UHDOWj ORFDOH 7DOH DSSURFFLR q LQ OLQHD FRQ JOL RULHQWDPHQWL GHOOD 5HJLRQH
(PLOLD 5RPDJQD LO FXL 3URJUDPPD GL 5LFHUFD 5HJLRQH8QLYHUVLWj ILQDQ]LD GD DQQL SURJHWWL LQWHJUDWL
YROWLDXQDSRWHQ]LDUHODFROODERUD]LRQHWUDVHUYL]LRVDQLWDULRHPRQGRDFFDGHPLFR
,1&25$**,$5(/$3$57(&,3$=,21('(,&,77$',1,$//$5,&(5&$75$0,7(/$&2081,&$=,21(
5LFHUFDHLQQRYD]LRQH
/D UHDOL]]D]LRQH GL VWXGL FOLQLFL SHUPHWWH O¶DYDQ]DPHQWR GHOOH FRQRVFHQ]H VFLHQWLILFKH H FRPSRUWD
YDQWDJJLSHUO¶LQGLYLGXRFKHYLSDUWHFLSDLQWHUPLQLGLTXDOLWjGHOO¶DVVLVWHQ]DULFHYXWDHGLVSRQLELOLWjGL
WUDWWDPHQWLLQQRYDWLYL/DOHWWHUDWXUDSHUzVRWWROLQHDODGLIILFROWjGLUHFOXWDPHQWRGHLSD]LHQWLVHFRQGR
XQD UHFHQWH UHYLVLRQH &RFKUDQH PHQR GHOOD PHWj GHJOL VWXGL UDJJLXQJH LO WDUJHW GL DUUXRODPHQWRH LO
GHL WULDO VXELVFH XQ VLJQLILFDWLYR ULWDUGR QHOO¶LQL]LR GHO UHFOXWDPHQWR >7UHZHHN &RFKUDQH
'DWDEDVH 6\VW 5HY@ 4XHVWR IHQRPHQR KD GLYHUVH FDXVH WUD FXL SDXUD GL HIIHWWL FROODWHUDOL
LPSRVVLELOLWjGLVFHJOLHUHLOWUDWWDPHQWRSHUWULDOUDQGRPL]]DWLHFRPXQLFD]LRQHFDUHQWHFRQLOPHGLFR
>/XVFKLQ %0& 0HG 5HV 0HWKRGRO@ (¶ FKLDUR FKH SHU SUHQGHUH GHFLVLRQL LQIRUPDWH FLUFD OD
SDUWHFLSD]LRQH D XQR VWXGLR H SHU HVVHUH UHDOPHQWH FRLQYROWL L FLWWDGLQL GHYRQR FRQRVFHUH OH
RSSRUWXQLWj GL ULFHUFD GLVSRQLELOL H VXFFHVVLYDPHQWH DFFHGHUH DL ULVXOWDWL GLULWWL VDQFLWL DQFKH GDOOD
&DUWD (XURSHD GHL 'LULWWL GHO 0DODWR 7XWWDYLD DQFRUD RJJL OH ULYLVWH SL DXWRUHYROL VRWWROLQHDQR LO
GLIILFLOH UHSHULPHQWR GL LQIRUPD]LRQL VXJOL VWXGL LQ FRUVR >*RGOHH DQG &KDOPHUV %0-@ H LO JUDYH
SUREOHPDGHOO¶XQGHUUHSRUWLQJGHLSURJHWWLFRQFOXVLVRORSHUFLUFDODPHWjGHLWULDOUHJLVWUDWLYHQJRQR
GLVVHPLQDWLLULVXOWDWL>&KDOPHUV%0-@/DILGXFLDGHLFLWWDGLQLQHOODULFHUFDLQ(XURSDqDOWDPD
QRQ LQFRQGL]LRQDWD OD WUDVSDUHQ]D GXUDQWH WXWWH OHIDVL GL UHDOL]]D]LRQH GHOODULFHUFD ULVXOWD HOHPHQWR
HVVHQ]LDOHSHUPDQWHQHUHYLYRTXHVWRSDWWRGLILGXFLDWUDULFHUFDWRUHHSD]LHQWH>/LEHUDWL%0-@
&LzGHYHDIILDQFDUVLDXQSURFHVVRGLFRPXQLFD]LRQHYROWRDIDUFRPSUHQGHUHVFRSLEHQHILFLHPHWRGL
GHOOD ULFHUFD SHU LQWHUYHQLUH VX WLPRUL H SUHFRQFHWWL QHL FRQIURQWL GHOOD SDUWHFLSD]LRQH D XQR VWXGLR
FOLQLFR
1HOO¶$]LHQGDKDSHUWDQWRSRVWRWUDLVXRLRELHWWLYLODSLDQLILFD]LRQHGLXQDVHULHGLLQL]LDWLYHYROWH
D LQFHQWLYDUH L SD]LHQWL DG DGHULUH DL WULDO FOLQLFL D UDIIRU]DUH OD ILGXFLD QHL FRQIURQWL GHOOD ULFHUFD H D
IDYRULUHOHSDULRSSRUWXQLWjGLDFFHVVRDJOLVWXGL
5LVXOWDWLUDJJLXQWL
*Lj GD WUH DQQL OD 82 5LFHUFD H ,QQRYD]LRQH H O¶8IILFLR 6WDPSD FROODERUDQR IDWWLYDPHQWH SHU OD
GLIIXVLRQH GHOOH DWWLYLWj GL ULFHUFD VXL VLWL LQWHUQHW H LQWUDQHW D]LHQGDOL H VXL PHGLD 1HO TXHVWD
LQWHJUD]LRQHVLqXOWHULRUPHQWHUDIIRU]DWDJUD]LHDOODSUHVHQ]DGLXQDILJXUDHVSHUWDLQFRPXQLFD]LRQH
RSHUDQWHLQHQWUDPEHOHVWUXWWXUHGHGLFDWDDJDUDQWLUHODGLIIXVLRQHPLUDWDGHLPHVVDJJLDVHFRQGDGHL
WDUJHW H FRQ L PH]]L DSSURSULDWL (¶ VWDWR SHUWDQWR SRVVLELOH LQWUDSUHQGHUH SDVVL FRQFUHWL YHUVR
O¶DWWXD]LRQH GL XQD VWUDWHJLD GL GLYXOJD]LRQH GLTXDQWR VL VWD IDFHQGR HGL TXDQWR JLj IDWWRLQ $]LHQGD
QHO FDPSR GHOOD ULFHUFD ,Q SULPR OXRJR q VWDWR GHILQLWR XQ SLDQR GL FRPXQLFD]LRQH YHUVR L FLWWDGLQL H
SRWHQ]LDOLFDQGLGDWLDOO¶DUUXRODPHQWRQHLWULDOFKHVDUjLPSOHPHQWDWRDSDUWLUHGDOHFRPSUHQGH
ODFUHD]LRQHVXOVLWRLQWHUQHWD]LHQGDOHGLXQDVH]LRQHVSHFLILFDSHUFLWWDGLQLSD]LHQWLHIDPLOLDUL/H
LQIRUPD]LRQL SXEEOLFDWH FRPSUHQGHUDQQR VLD PDWHULDOH YDOLGDWR VXOO¶LPSRUWDQ]D GHOOD ULFHUFD VLD
LQIRUPD]LRQL VXL SURJHWWL LQ FRUVR SHU IDU FRQRVFHUH OH RSSRUWXQLWj WHUDSHXWLFKH D SRWHQ]LDOL
FDQGLGDWL
GLIIXVLRQH QHL UHSDUWL GL PDWHULDOH LQIRUPDWLYR YDOLGDWR FRQ SDUWLFRODUH DWWHQ]LRQH DJOL DVSHWWL
UHODWLYL DOOD SDUWHFLSD]LRQH GL GRQQH DOOD ULFHUFD SHU FKLDULUH GXEEL H SUHFRQFHWWL FKH VSHVVR
RVWDFRODQRLOUHFOXWDPHQWRGHOOHSD]LHQWL
UHDOL]]D]LRQH GL LQFRQWUL FRQ L FLWWDGLQL YROWL DOOD SUHVHQWD]LRQH GL VLQJROL VWXGL LQ IDVH GL DYYLR
JHVWLWL GDL UHVSRQVDELOL VFLHQWLILFL H GDL ORUR FROODERUDWRUL ILQDOL]]DWL D LQIRUPDUH VXOOH VSHFLILFKH
RSSRUWXQLWj GL ULFHUFD H IDYRULUH LO UHFOXWDPHQWR LQVWDXUDQGR DQFKH XQ UDSSRUWR GLUHWWR WUD
ULFHUFDWRUHHFLWWDGLQR
,QWHUYHQWLLQIDVHGLVYLOXSSRRLQFRUVR
(YHQWXDOLSUREOHPDWLFKHULVFRQWUDWH
$O ILQH GL IDYRULUH O¶LPSOHPHQWD]LRQH GHOOD /D JUDQGH TXDQWLWj GL PDWHULDOH FUHDWR SHU
VWUDWHJLD GL FRPXQLFD]LRQH QHO OH DWWLYLWj DXPHQWDUH OD FRQVDSHYROH]]D VXOO¶LPSRUWDQ]D GHOOD
VRSUD GHVFULWWH VDUDQQR LQFOXVH QHJOL RELHWWLYL GL ULFHUFD SUHVHQWH VX VLWL DXWRUHYROL UHQGH
EXGJHW
QHFHVVDULD XQD DFFXUDWD VHOH]LRQH SHU LGHQWLILFDUH
1HO VL LQWHQGH LQROWUH GHILQLUH XQ SURJHWWR LFRQWHQXWLGDGLIIRQGHUH
ILQDOL]]DWRDYHULILFDUHO¶LPSDWWRGHOODVWUDWHJLDGL ,O UHSHULPHQWR GHOOH LQIRUPD]LRQL VXL SURJHWWL LQ
FRPXQLFD]LRQH VXOO¶HIIHWWLYD SDUWHFLSD]LRQH GHL DWWR ULFKLHGHUj ROWUH FKH OH IRQWL JLj XWLOL]]DWH SHU
SD]LHQWL DJOL VWXGL PLVXUDQGR LO WDVVR GL OD UHSRUWLVWLFD GHOOD ULFHUFD $QDJUDIH EDQFD GDWL
DUUXRODPHQWR SULPD H GRSR O¶LQWURGX]LRQH GHJOL ,6, HFFHWHUD DQFKH XQ DWWLYR FRQWULEXWR GD SDUWH
LQWHUYHQWL7DOHSURJHWWRqVWDWRSUHVHQWDWRDGXQ GHLSURIHVVLRQLVWL
&RQYHJQR RUJDQL]]DWR GDOO¶,VWLWXWR 0DULR 1HJUL GDO WLWROR ³*OL DPRUL GLIILFLOL ULFHUFD H
FRPXQLFD]LRQH´ILJXUD
5LFHUFDHLQQRYD]LRQH
)LJXUD3RVWHUSUHVHQWDWRDOFRQYHJQRGDOWLWROR³*OLDPRULGLIILFLOLULFHUFDHFRPXQLFD]LRQH´
6(03/,),&$5(,352&(66,(*$5$17,5(/$48$/,7¬'(*/,678',
8QSURWRFROORVFLHQWLILFDPHQWHULJRURVRHLOSDUHUHIDYRUHYROHGHO&RPLWDWR(WLFRQRQJDUDQWLVFRQRFKH
OR VWXGLR YHQJD FRQGRWWR QHO WRWDOH ULVSHWWR GHJOL VWDQGDUG LQWHUQD]LRQDOL H GHOOD OHJLVOD]LRQH YLJHQWH
1RQ VRQR UDUL DG HVHPSLR SUREOHPL QHOOD VRWWRVFUL]LRQH GHO FRQVHQVR LQIRUPDWR QHOOD WHQXWD GHOOD
GRFXPHQWD]LRQH R QHOOD VHJQDOD]LRQH GHJOL HYHQWL DYYHUVL 6HEEHQH VL WUDWWL JHQHUDOPHQWH GL DVSHWWL
QRQVRVWDQ]LDOLVRQRWXWWDYLDHOHPHQWLLPSRUWDQWLFKHFRQFRUURQRDOODTXDOLWjGHOODULFHUFDHDVVLFXUDQR
ODWXWHODGHLVRJJHWWLLQVWXGLRHFKHTXLQGLQRQSRVVRQRHVVHUHWUDVFXUDWL
3HU JXLGDUH L ULFHUFDWRUL QHOO¶HVHFX]LRQH GL VWXGL GL TXDOLWj ULGXFHQGR LO ULVFKLR GL TXHVWL HUURUL OD
,QWHUQDWLRQDO&RQIHUHQFHRQ+DUPRQLVDWLRQ,&+KDUHDOL]]DWROHOLQHHJXLGDGL%XRQD3UDWLFD&OLQLFD
*RRG&OLQLFDO3UDFWLFH*&3(¶SHUWDQWRLPSRUWDQWHFKHOH$]LHQGHVDQLWDULHPHWWDQRLQFDPSRD]LRQL
SHUSURPXRYHUHO¶DGHVLRQHDTXHVWHUDFFRPDQGD]LRQLFRPHOHYLVLWHGLYHULILFDGHOOHDWWLYLWjGLULFHUFD
LQ FRUVR D FXUD GL PRQLWRU HVSHUWL FRQ LQWHQWR QRQ YDOXWDWLYR PD GL VXSSRUWR SHU OD VROX]LRQH GL
HYHQWXDOLSUREOHPLRGLIILFROWj>%DNREDNL&OLQLFDO7ULDOV0DFHILHOG&OLQLFDO7ULDOV@
,QROWUH SHU VHPSOLILFDUH LO ODYRUR GHL ULFHUFDWRUL H DLXWDUOL DG DWWHQHUVL DJOL VWDQGDUG LQWHUQD]LRQDOL GL
TXDOLWj OH OLQHH JXLGD *&3 FRQVLGHUDQR LQGLVSHQVDELOH O¶XWLOL]]R GHOOH 3URFHGXUH 2SHUDWLYH 6WDQGDUG
623GRFXPHQWLFRQGLYLVLFRQWHQHQWLLVWUX]LRQLGHWWDJOLDWHSHUXQLIRUPDUHO¶DWWXD]LRQHGLXQDDWWLYLWj
GL ULFHUFD VSHFLILFD FKH FRQVHQWRQR GL VQHOOLUH JOL DVSHWWL EXURFUDWLFL DVVLFXUDQGR DO WHPSR VWHVVR OD
TXDOLWjLQRJQLPRPHQWRGHOSURFHVVRGLUHDOL]]D]LRQHGLXQRVWXGLR
/D$28GL3DUPDSHUVHJXHGDDQQLLOPLJOLRUDPHQWRGHOODTXDOLWjGHOODULFHUFDXQSDVVRLPSRUWDQWHLQ
TXHVWDGLUH]LRQHqVWDWRFRPSLXWRQHOFRQODFUHD]LRQHGHOOHSULPH623D]LHQGDOLSHUODULFHUFD
4XHVWR SURFHVVR FRQWLQXR GL SURGX]LRQH H DJJLRUQDPHQWR GL GRFXPHQWD]LRQH GL ULIHULPHQWR GHYH
WXWWDYLDDIILDQFDUVLDXQ¶D]LRQHGLVXSSRUWRLQORFRPLUDWDDOOHQHFHVVLWjGHOVLQJRORUHSDUWR
6XOOD EDVH GL TXHVWH FRQVLGHUD]LRQL QHO O¶$]LHQGD KD LVWLWXLWR XQ¶DWWLYLWj VLVWHPDWLFD GL
PRQLWRUDJJLR H VRVWHJQR DOOD ULFHUFD LQ FRUVR SHU ULOHYDUH WHPSHVWLYDPHQWH L SUREOHPL H LQWHUYHQLUH
SHU SRUYL ULPHGLR 7DOH DWWLYLWj SRWUj DYHUH ULSHUFXVVLRQL SRVLWLYH DQFKH VXOOD FXOWXUD GHOOD ULFHUFD GL
TXDOLWj GHL JLRYDQL ULFHUFDWRUL IDYRUHQGR OD FRQRVFHQ]D GHOOH QRUPDWLYH YLJHQWL VHQVLELOL]]DQGROL
VXOO¶LPSRUWDQ]DGLDGHULUYLHUHVSRQVDELOL]]DQGROLLQWDOVHQVR
5LFHUFDHLQQRYD]LRQH
5LVXOWDWLUDJJLXQWL
1HO q VWDWD DYYLDWD O¶DWWLYLWj GL YHULILFD GHOOH SURFHGXUH LQ DWWR SHU OD FRQGX]LRQH GL VWXGL FOLQLFL
VSRQWDQHL QRQ VSRQVRUL]]DWL /¶LGHQWLILFD]LRQH GHL UHSDUWL GD FXL SDUWLUH q DYYHQXWD WUDPLWH
O¶DWWULEX]LRQHGLXQULVNVFRUHWUDWWRGDOODOHWWHUDWXUDDRJQLVWXGLRLQDWWRHODGHILQL]LRQHGLXQDOLVWD
GL SULRULWj 'D OXJOLR VRQR VWDWH HIIHWWXDWH YLVLWH QHOOH 82 VHOH]LRQDWH FKH KDQQR FRLQYROWR L
FRPSRQHQWLGHOORVWDIILPSHJQDWLLQVWXGLFOLQLFL/HYLVLWHGLPRQLWRUDJJLRYHQJRQRDWWXDWHGDOPRQLWRU
D]LHQGDOH H GD XQ PRQLWRU HVSHUWR GL XQD $]LHQGD OHDGHU SHU OH DWWLYLWj GL VXSSRUWR DOOD ULFHUFD 3HU
RJQLYLVLWDYLHQHUHGDWWRXQUHSRUWFKHIRUQLVFHLOUHVRFRQWRGHJOLDVSHWWLYHULILFDWLHOHUDFFRPDQGD]LRQL
SHULOPLJOLRUDPHQWR
/H SUREOHPDWLFKH HPHUVH GXUDQWH OH YLVLWH DWWXDWH QHO KDQQR RIIHUWR DQFKH R VSXQWR SHU OD
GHILQL]LRQH GL XOWHULRUL 3URFHGXUH 2SHUDWLYH 6WDQGDUG 623 D]LHQGDOL SHU OD 5LFHUFD ³0RQLWRUDJJLR
GHOOD TXDOLWj GHJOL VWXGL´ ³$XWRUL]]D]LRQH DOO¶DYYLR GHOOR VWXGLR´ ³$FTXLVL]LRQH GL EHQL H VHUYL]L´
³*HVWLRQHGHOIDUPDFRLQVSHULPHQWD]LRQH´
/H 623 UDSSUHVHQWDQRSHUWDQWR VLD XQR VWUXPHQWR IRQGDPHQWDOH D VXSSRUWR GHO PRQLWRUDJJLR VLD XQ
LPSRUWDQWHSURGRWWRGHLULVXOWDWLGLWDOHDWWLYLWj
(¶ SURSULR OD VWUHWWD LQWHUD]LRQH WUD PRQLWRU H ULFHUFDWRUL FRQ XQ UXROR DWWLYR H SURSRVLWLYR GL TXHVWL
XOWLPL FKH KD SRUWDWR DG XQ PLJOLRUDPHQWR FRQWLQXR H FRQVHQWLWR OD IRUPD]LRQHHGXFD]LRQH GHL
SURIHVVLRQLVWL VSHFLDOPHQWH GL TXHOOL SL JLRYDQL VSHFLDOL]]DQGL GRWWRUDQGL ODXUHDQGL FKH KDQQR
SDUWHFLSDWRLQQXPHURVLJQLILFDWLYRDOOHDWWLYLWjGLYHULILFDFRQGRWWHQHOSURSULRUHSDUWRGLDIIHUHQ]D
,QWHUYHQWLLQIDVHGLVYLOXSSRRLQFRUVR
(YHQWXDOLSUREOHPDWLFKHULVFRQWUDWH
1HO VL SURVHJXLUj FRQ O¶HIIHWWXD]LRQH GHOOH 3HUPDQH LQ DOFXQL SURIHVVLRQLVWL OD SHUFH]LRQH GL
YLVLWH GL PRQLWRUDJJLR LQ ORFR DO ILQH GL RIIULUH TXHVWH DWWLYLWj TXDOH WHQWDWLYR GL FRQWUROOR
TXHVWDRSSRUWXQLWjDQFKHDGDOWULUHSDUWLFRLQYROWL SLXWWRVWRFKHGLVXSSRUWRSHULOPLJOLRUDPHQWRGHOOD
LQULFHUFD
TXDOLWj GHOOD ULFHUFD H GHOOD VLFXUH]]D GHL SD]LHQWL
6LSURYYHGHUjLQROWUHDOODUHDOL]]D]LRQHGLXOWHULRUL 2FFRUUHUj ULEDGLUH XOWHULRUPHQWH LO UHDOH VFRSR GL
623 ROWUH DOO¶DJJLRUQDPHQWR GL TXHOOH LQ YLJRUH TXHVWR ODYRUR H ULFRQRVFHUH D FKL DWWXD D]LRQL GL
FKH GHYH DYYHQLUH DOPHQR XQD YROWD DOO¶DQQR PLJOLRUDPHQWRO¶LPSHJQRSURIXVR
FRPHVWDELOLWRGDOUHODWLYRUHJRODPHQWR
/($77,9,7$¶(,7($0',5,&(5&$,/3,$12
/D ULFHUFD q LQGLVSHQVDELOH SHU OR VYLOXSSR VWUDWHJLFR GL XQ¶$]LHQGD VDQLWDULD (¶ SHUWDQWR LPSRUWDQWH
DWWXDUH XQD SURJUDPPD]LRQH FKH SDUWD GDOO¶LQGLYLGXD]LRQH H WUDFFLDELOLWj GHL SURJHWWL LQ FRUVR GHOOH
FRPSHWHQ]H DFTXLVLWH H GHOOH ULVRUVH GLVSRQLELOL SHU SRWHU DYYLDUH XQD GLVFXVVLRQH VXOOH SULRULWj
WHQHQGRFRQWRGHOOHDUHHGLPDJJLRUHFRPSHWHQ]DHGHOODQHFHVVLWjGLVWLPRODUHTXHOOHGRYHODULFHUFD
ULPDQH FDUHQWH ,Q TXHVW¶RWWLFD OD 5HJLRQH (PLOLD5RPDJQD ULFKLHGH DOOH $]LHQGH FRQ '*5 GHO
O¶HODERUD]LRQH GL XQ 3LDQR GHOOH DWWLYLWj GL 5LFHUFD H ,QQRYD]LRQH 7DOH GRFXPHQWR
GRYUHEEH IRUQLUH XQD GHVFUL]LRQH GHOOH DWWLYLWj SUHYLVWH LQFOXVL UD]LRQDOH H RELHWWLYL H FRQVHQWLUH OD
YDOXWD]LRQH GHOOH LPSOLFD]LRQL RUJDQL]]DWLYH H JHVWLRQDOL GHOOD ORUR LQWHJUD]LRQH FRQ O¶DWWLYLWj
DVVLVWHQ]LDOH
,Q FRQIRUPLWjFRQJOLRULHQWDPHQWLUHJLRQDOLQHOO¶$]LHQGDKDUHGDWWRSHUODSULPDYROWDLO3LDQR
GHOOH DWWLYLWj GL 5LFHUFD UHODWLYR DO ELHQQLR XQ ODYRUR UHVR SRVVLELOH GDOOD VWUHWWD
FROODERUD]LRQHWUDOD825LFHUFDH,QQRYD]LRQHHLSURIHVVLRQLVWL
,O 3LDQR VL q ULYHODWR XQR VWUXPHQWR IRQGDPHQWDOH SHU FRQRVFHUH OH DWWLYLWj LQ DWWR R LQ YLD GL
GHILQL]LRQH H L SULQFLSDOL WHDP FRLQYROWL ,Q SDUWLFRODUH q VWDWR SRVVLELOH DO &ROOHJLR GL 'LUH]LRQH
LGHQWLILFDUHOHVHLSULQFLSDOLOLQHHGLULFHUFDGHOO¶$]LHQGDHVHOH]LRQDUHOD0HGLFLQD3HUVRQDOL]]DWDTXDOH
DUHDGLULFHUFDSULRULWDULD
3HU SRWHU ULIOHWWHUH OD UDSLGD HYROX]LRQH GHOOD ULFHUFD LO GRFXPHQWR GHYH HVVHUH FRVWDQWHPHQWH
DJJLRUQDWR
5LFHUFDHLQQRYD]LRQH
5LVXOWDWLUDJJLXQWL
1HOqVWDWDUHDOL]]DWDODVHFRQGDYHUVLRQHGHO3LDQRSHUJOLDQQL/DGXUDWDWULHQQDOH
qVWDWDVFHOWDLQFRQVLGHUD]LRQHGHOODQDWXUDSOXULHQQDOHGLPROWHDWWLYLWjFRQRELHWWLYLULOHYDELOLDQFKHD
OXQJRWHUPLQH
$QFKH TXHVW¶DQQR O¶RELHWWLYR q VWDWR UDJJLXQWR JUD]LH DO SURILFXR FRLQYROJLPHQWR GHL SURIHVVLRQLVWLLQ
SDUWLFRODUH L 5HIHUHQWL 'LSDUWLPHQWDOL GHOOD 5LFHUFD FKH KDQQR FRRUGLQDWR LO ODYRUR GL UDFFROWD GHOOH
SURSRVWH SURYHQLHQWL GDL FROOHJKL GHO ORUR 'LSDUWLPHQWR WUDPLWH VFKHGD DSSRVLWD UHDOL]]DQGR FRVu L
3LDQL'LSDUWLPHQWDOL(¶SRLVHJXLWRLOODYRURGLVLQWHVLHDJJUHJD]LRQHGHOOHSURSRVWHGHL'LSDUWLPHQWL
GD SDUWH GHOOD 82 5LFHUFD H ,QQRYD]LRQH DO ILQH GL UHGLJHUH XQ GRFXPHQWR RPRJHQHR GL YDOHQ]D
D]LHQGDOH ,Q TXHVWD HGL]LRQH VRQR VWDWL XOWHULRUPHQWH YDORUL]]DWL L WHDP GL ULFHUFD SHU FLDVFXQD
SURSRVWD GL DWWLYLWj YHQJRQR LQIDWWL LQGLFDWL L QRPLQDWLYL GHL SURIHVVLRQLVWL FRLQYROWL H YLHQH GHVFULWWD
O¶HVSHULHQ]D DFTXLVLWD LQ DPELWR GL ULFHUFD FRQ UHODWLYH SXEEOLFD]LRQL ULOHYDQWL H DWWLQHQWL /H DWWLYLWj
VRQRVXGGLYLVHQHOOHOLQHHGLULFHUFDSULQFLSDOLLGHQWLILFDWHGDO&ROOHJLRGL'LUH]LRQHQHO
,OGRFXPHQWRILQDOHqVWDWRDSSURYDWRGDO&ROOHJLRGL'LUH]LRQHLQGDWDGLFHPEUHDVHJXLWRGL
SUHVDYLVLRQHHSUHVDG¶DWWRGDSDUWHGHO%RDUGGHOOD5LFHUFDLOQRYHPEUH
,QWHUYHQWLLQIDVHGLVYLOXSSRRLQFRUVR
,O3LDQR$]LHQGDOHSHUOHDWWLYLWjGL5LFHUFDDQQLqVWDWRDGRWWDWRGDO'LUHWWRUH*HQHUDOHLQ
GDWD DSULOH SUHYLR SDUHUH IDYRUHYROH IRUPXODWR GDO &RPLWDWR GL ,QGLUL]]R D]LHQGDOH LO PDU]R
FRPHULFKLHVWRGDOODVXGGHWWD'HOLEHUD5HJLRQDOH
,O 3LDQR VDUj DPSLDPHQWH GLIIXVR DQFKH WUDPLWH SXEEOLFD]LRQH LQWHJUDOH VXOOH SDJLQH LQWHUQHW
GHOO¶$]LHQGDGHGLFDWHDOODULFHUFDLQIDVHGLDJJLRUQDPHQWR
,O FRQWHQXWR q WUD O¶DOWUR XWLOL]]DWR FRPH SXQWR GL ULIHULPHQWR SHU VWLPRODUH LQ PRGR PLUDWR OD
SDUWHFLSD]LRQHDRSSRUWXQLWjGLILQDQ]LDPHQWRLQEDVHDOOHWHPDWLFKHHDOO¶H[SHUWLVHULOHYDWD
5LFHUFDHLQQRYD]LRQH
&DSDFLWjGLDWWUD]LRQHGDSDUWHGHOOD$]LHQGDGLULVRUVHILQDQ]LDULH
8QR GHL UHTXLVLWL IRQGDPHQWDOL SHU O¶HVHFX]LRQH GL ULFHUFD q OD GLVSRQLELOLWj GL IRQGL SHU
VRVWHQHUOD1HOFDVRGHJOLVWXGLQRQDILQLGLOXFURODFRVLGGHWWDULFHUFDQRSURILWODFDSDFLWjGL
DWWUDUUHILQDQ]LDPHQWLGLYHQWDDQFRUDSLSUHJQDQWHDFDXVDGHOOHULVRUVHVHPSUHSLVFDUVHD
GLVSRVL]LRQH H GHOO¶HOHYDWD FRQFRUUHQ]D SHU O¶DFTXLVL]LRQH GL IRQGL SXEEOLFL (¶ LPSHJQR
SULRULWDULR GHOOD $28 GL 3DUPD SHUWDQWR SURPXRYHUH OD SDUWHFLSD]LRQH GHL VXRL SURIHVVLRQLVWL
DOOH RSSRUWXQLWj GL ILQDQ]LDPHQWR HVLVWHQWL QRQ VROR GLIIRQGHQGROH PD DQFKH IRUQHQGR XQ
VXSSRUWR TXDOLILFDWR 1HO ULVXOWDQR GL SDUWLFRODUH ULOLHYR OH LQL]LDWLYH LQWUDSUHVH SHU
FRLQYROJHUH L SURIHVVLRQLVWL QHOOD ULFHUFD FRPXQLWDULD XQ VHWWRUH DOWDPHQWH FRPSHWLWLYR PD
ULFFRGLRSSRUWXQLWjFKHWHDPFRPSHWHQWLSRVVRQRVIUXWWDUH$WDOILQHO¶$]LHQGDKDRUJDQL]]DWR
ZRUNVKRSGLEUDLQVWRUPLQJGRYHLFRPSRQHQWLGHO%RDUGD]LHQGDOHSHUODULFHUFDHGHVSHUWLLQ
PDWHULD GL ULFHUFD FRPXQLWDULD KDQQR PHVVR D GLVSRVL]LRQH OD ORUR H[SHUWLVH IRUQHQGR
LQGLFD]LRQL XWLOL DOOD IRUPXOD]LRQH GHOOH SURSRVWH LQGLFDQGR L EDQGL SL DSSURSULDWL D FXL
VRWWRSRUOH H VXJJHUHQGR SRVVLELOL DJJUHJD]LRQL FRQ DOWUL JUXSSL /D PDJJLRUH DWWHQ]LRQH DOOD
ULFHUFD LQWHUQD]LRQDOH KD ULFKLDPDWR LQROWUH O¶HVLJHQ]D GL SRUWDUH DOOD OXFH OH HVSHULHQ]H
DFTXLVLWH LQ SDVVDWR GDL SURIHVVLRQLVWL GHOO¶$]LHQGD PDL FHQVLWH H QRQ SDUWLFRODUPHQWH
YDORUL]]DWH $ WDO ILQH q VWDWD HIIHWWXDWD LQ $]LHQGD XQD LQGDJLQH YROWD D FRQRVFHUH
O¶HVSHULHQ]D GHL SURIHVVLRQLVWL QHOO¶DPELWR GHOOD ULFHUFD FRPXQLWDULD H LO ORUR LQWHUHVVH D
FRVWLWXLUHXQQHWZRUNGLHVSHUWLDVXSSRUWRGLSURSRQHQWLDEDQGLHXURSHL/HULVSRVWHRWWHQXWH
KDQQR SHUPHVVR GL GLVSRUUH GL XQ GDWDEDVH GL HVSHUWL FKH SRWUDQQR IRUQLUH XQ FRQWULEXWR
LPSRUWDQWH SHU FRQTXLVWDUH ILQDQ]LDPHQWL LQWHUQD]LRQDOL ,QILQH TXDOH XOWHULRUH LQFHQWLYR
O¶$]LHQGD KD DYYLDWR XQD FROODERUD]LRQH FRQ XQ
DJHQ]LD VSHFLDOL]]DWD QHOOD HURJD]LRQH GL
VXSSRUWRQHOO
DPELWRGHOODULFHUFDHXURSHDFKHRIIULUjDLULFHUFDWRULGHOOD$28FKHORGHVLGHUDQR
XQ YDOLGR DLXWR LQ WXWWH OH IDVL GL UHDOL]]D]LRQH GHO ORUR SURJHWWR 4XHVWD VROX]LRQH SRWUj
LQFRUDJJLDUH OD SDUWHFLSD]LRQH GHL SURIHVVLRQLVWL D EDQGL GL ULFHUFD FRPXQLWDULD VSHVVR
RVWDFRODWD GD WLPRUL UHODWLYL DOO
HFFHVVLYR FDULFR EXURFUDWLFR H DOOD FRPSOHVVLWj GHOO
LWHU GD
VHJXLUH
$ OLYHOOR QD]LRQDOH H UHJLRQDOH DQFKH QHO OD ULFHUFD QR SURILW GHOO¶$]LHQGD KD VDSXWR
JXDGDJQDUHFRQVLGHUHYROLILQDQ]LDPHQWLJUD]LHDULFHUFDWRULGLWDOHQWR6LVRWWROLQHDFKHTXHVWR
PHULWR q DQGDWR VLD D SURIHVVLRQLVWL JLj DIIHUPDWL FKH GD DQQL VYROJRQR FRQ VXFFHVVR OD ORUR
PLVVLRQHGLULFHUFDWRULVLDDFROOHJKLSLJLRYDQLFKHLQWUDSUHQGRQRFRQHQWXVLDVPRODULFHUFD
LQDPELWLLQQRYDWLYLHDOWDPHQWHSURPHWWHQWLFRPHODPHGLFLQDSHUVRQDOL]]DWD
7UD L SULPL VL VRWWROLQHD O¶DYYLR GHL YDUL SURJHWWL FKH FRPSRQJRQR L GXH 3URJUDPPL 6WUDWHJLFL
FRRUGLQDWLULVSHWWLYDPHQWHGDO'LUHWWRUHGHOOD820DODWWLH,QIHWWLYHHG(SDWRORJLDGDOWLWROR´$
7DLORUHG DSSURDFK WR WKH LPPXQHPRQLWRULQJ DQG FOLQLFDO PDQDJHPHQW RI YLUDO DQG
DXWRLPPXQHGLVHDVH´HGDO'LUHWWRUHGHOOD82&DUGLRORJLDGDOWLWROR³&DUGLRYDVFXODUJHQHWLFV
IURP EHQFK WR EHGVLGH´ ILQDQ]LDWL GDO 3URJUDPPD 5HJLRQH8QLYHUVLWj $UHD ³5LFHUFD,QQRYDWLYD´SHUXQLPSRUWRFRPSOHVVLYRGLFLUFDPLOLRQLGLHXUR
7UDLJLRYDQLULFHUFDWRULFKHKDQQRSDUWHFLSDWRDOODULJRURVDVHOH]LRQHGHO3URJUDPPDGLULFHUFD
5HJLRQH8QLYHUVLWj *LRYDQL 5LFHUFDWRUL GHOOD $28 FRPSOHVVLYDPHQWH LQ 5(5
XQELRORJRFKH RSHUDSUHVVROD82*HQHWLFD0HGLFDKDRWWHQXWRXQILQDQ]LDPHQWRLPSRUWDQWH
SHU XQR VWXGLR DOWDPHQWH LQQRYDWLYR GHGLFDWR DOOH YDVFXOLWL $1&$DVVRFLDWH PDODWWLH
DXWRLPPXQL UDUH SDUWLFRODUPHQWH JUDYL ,O SURJHWWR GDO WLWROR ³3HUVRQDOL]]DUH OD WHUDSLD FRQ
5LWX[LPDE QHOOH YDVFXOLWL $1&$DVVRFLDWH XQ DSSURFFLR JHQHWLFR HG LPPXQRORJLFR´ PLUD DG
LQGDJDUH L IDWWRUL JHQHWLFL FKH GHWHUPLQDQR OD ULVSRVWD DOOD WHUDSLD FRQ O¶RELHWWLYR XOWLPR GL
VRPPLQLVWUDUH LO WUDWWDPHQWR VROR D SD]LHQWL FKH UHDOPHQWH QH EHQHILFHUDQQR RWWLPL]]DQGRQH
O¶XWLOL]]RHGHYLWDQGRDJOLDOWULLSRVVLELOLHIIHWWLFROODWHUDOLGHOIDUPDFR
,QILQH VL VHJQDOD LO SURJHWWR GL XQD JLRYDQH ULFHUFDWULFH DIIHUHQWH DOOD 82 &OLQLFD H 7HUDSLD
0HGLFDYLQFLWULFHGHOEDQGRPLQLVWHULDOH5LFHUFD)LQDOL]]DWD*LRYDQL5LFHUFDWRUL
SURSRQHQWLGHOOD$28FRPSOHVVLYDPHQWHLQ,WDOLDGDOWLWROR³6WHPFHOOG\VIXQFWLRQDQG
LWV UHYHUVDO LQ GLDEHWHV DVVRFLDWHG PXOWLRUJDQ SDWKRORJ\´ /R VWXGLR PLUD D LGHQWLILFDUH
DOWHUD]LRQLIXQ]LRQDOLQHOOHFHOOXOHVWDPLQDOLFRQVHJXHQWLDGLDEHWHPHOOLWRHLOORUROHJDPHFRQOD
IUHTXHQWH LQVRUJHQ]D GL PDODWWLH FDUGLRYDVFRODUL LQ SD]LHQWL GLDEHWLFL DO ILQH GL LGHQWLILFDUH
QXRYHVWUDWHJLHWHUDSHXWLFKHSHUULGXUUHRHOLPLQDUHJOLHIIHWWLQHJDWLYLGHOGLDEHWHVXOFXRUHH
DOWULRUJDQL
2OWUHDVWXGLILQDQ]LDWLFRQIRQGLSXEEOLFLO¶$28GL3DUPDQHOKDDYYLDWRSURJHWWLFRQ
VSRQVRU SULYDWR LO GHL SURJHWWL DYYLDWL QHO 6L ULPDQGD DOOD VH]LRQH ³$WWLYLWjGLULFHUFD´GHOFDSLWRORSHUXOWHULRULGHWWDJOL
*UDILFR'LVWULEX]LRQHGHLSURJHWWLDYYLDWLSHUIRQWHGLILQDQ]LDPHQWRDQQR
)LQDQ]LDPHQWLSULYDWL
)LQDQ]LDPHQWLSXEEOLFL
6HQ]DILQDQ]LDPHQWR
&RQVLGHUDQGR L SURJHWWL FKH KDQQR ULFHYXWR XQ ILQDQ]LDPHQWR DG KRF GD XQR VSRQVRU JUDILFR
QHOODTXRWDPDJJLRUHGLLQYHVWLPHQWLqVWDWDSXEEOLFDSHULOGHJOLLPSRUWL
*UDILFR'LVWULEX]LRQHGHJOLLPSRUWLILQDQ]LDWLSHUIRQWHGLILQDQ]LDPHQWRDQQR
)LQDQ]LDPHQWLSULYDWL
)LQDQ]LDPHQWLSXEEOLFL
,ILORQLGLULFHUFDJUDILFRFKHKDQQRDWWLUDWRSLILQDQ]LDPHQWLVLDSXEEOLFLFKHSULYDWLQHJOL
XOWLPLWUHDQQLVRQR³7XPRULLQFOXVDOHXFHPLD´³&DUGLRYDVFRODUH´H³,QIH]LRQL´
5LFHUFDHLQQRYD]LRQH
*UDILFR'LVWULEX]LRQHGHJOLLPSRUWLILQDQ]LDWLSHUDUHDWHPDWLFDDQQL
,PSRUWLLQPLJOLDLDGL¼
7XPRULLQFOXVDOHXFHPLD
&DUGLRYDVFRODUH
,QIH]LRQL
$SSDUDWRUHVSLUDWRULR
$VSHWWLJHQHUDOLUHODWLYLDOODVDOXWHHGDOEHQHVVHUH
,QILDPPD]LRQHHVLVWHPDLPPXQLWDULR
2FFKLR
0HWDEROLVPRHDWWLYLWjHQGRFULQD
1HXURORJLD
&HUHEURYDVFRODUH
&DYRRUDOHHDSSDUDWRGLJHUHQWH
$SSDUDWRPXVFRORVFKHOHWULFR
6DOXWHGHOODULSURGX]LRQHHJUDYLGDQ]D
'LVWXUELFRQJHQLWL
&XWHHGHUPD
6DOXWHPHQWDOH
5HQLHDSSDUDWRXURJHQLWDOH
2UHFFKLR
(PDWRORJLD
1RWDVRQRULSRUWDWHOHSULPH$UHH7HPDWLFKH
)RQWHFODVVLILFD]LRQH$UHHWHPDWLFKH+HDOWK5HVHDUFK&ODVVLILFDWLRQ6\VWHP
3URVSHWWLYD GL LQGXEELR LQWHUHVVH q TXHOOD GHOO¶XWLOL]]R HIIHWWXDWR GHL IRQGL RWWHQXWL PHGLDQWH
O¶DWWLYLWjGLULFHUFDLQWHUPLQLGLULVRUVHXPDQH
5LFHUFDHLQQRYD]LRQH
8WLOL]]RDSSURSULDWRGHOOHLQQRYD]LRQL
/¶RELHWWLYR ILQDOH GHOOD ULFHUFD FRQGRWWD LQ RVSHGDOH q LO PLJOLRUDPHQWR GHOOD VDOXWH
/¶LQWURGX]LRQH QHOOD SUDWLFD GHL ULVXOWDWL GHOOD ULFHUFD QRQ q XQ SURFHVVR DXWRPDWLFR PD
ULFKLHGH O¶DWWXD]LRQH GL PRGDOLWj H VWUDWHJLH ,Q TXHVWR VHQVR O¶LQQRYD]LRQH H LO FDPELDPHQWR
GHOOD SUDWLFD FRVWLWXLVFRQR LO IUXWWR WDQJLELOH GHJOL VIRU]L IDWWL H FRQIHULVFRQR LO JLXVWR PHULWR
DOO¶LPSHJQRGHLULFHUFDWRUL3HUWDOHPRWLYROD5HJLRQH(PLOLD5RPDJQDGDDQQLLQYHVWHULVRUVH
LQ PRGR HTXLOLEUDWR WUD OD ULFHUFD VSHULPHQWDOH H TXHOOD FRVLGGHWWD GL JRYHUQR FOLQLFR YROWD D
RWWLPL]]DUH O¶XWLOL]]R GL LQWHUYHQWL JLj GLPRVWUDWL HIILFDFL R FKH QHFHVVLWDQR GL HVVHUH
XOWHULRUPHQWHYHULILFDWLLQXQFRQWHVWRUHDOH/¶$28GL3DUPDLQDFFRUGRFRQTXHVWRDSSURFFLR
VRVWLHQH LQ XJXDO PLVXUD OH GXH WLSRORJLH GL ULFHUFD FRQVDSHYROH GHOOD ORUR QDWXUDOH H
QHFHVVDULD LQWHJUD]LRQH SDUWLFRODUPHQWH LPSRUWDQWH LQ XQ RVSHGDOH XQLYHUVLWDULR 'D GLYHUVL
DQQL YHQJRQR LQIDWWL DYYLDWL QXPHURVL VWXGL GL JRYHUQR FOLQLFR FRRUGLQDWL GD SURIHVVLRQLVWL
GHOO¶$]LHQGDLQSDUWLFRODUHVWXGLILQDQ]LDWLGDO3URJUDPPDGL5LFHUFD5HJLRQH8QLYHUVLWjDUHD
³5LFHUFDSHULOJRYHUQRFOLQLFR´'LVHJXLWRYHQJRQRULSRUWDWLFRQXQDEUHYHGHVFUL]LRQHLGXH
SURJHWWLDYYLDWLQHOHQWUDPELGHGLFDWLDOODJHVWLRQHGLSDWRORJLHRQFRORJLFKHDYDQ]DWHH
VXFFHVVLYDPHQWHXQDJJLRUQDPHQWRGHOOHDWWLYLWjUHODWLYHDVHLSURJHWWLLQFRUVRQHOWXWWL
HRWWRILQDQ]LDWLGDOOD5HJLRQH(PLOLD5RPDJQD
678',2 5$1'20,==$72 08/7,&(175,&2 ', &21)52172 75$ (5/27,1,% (
0212&+(0,27(5$3,$ 1(/ 75$77$0(172 ', 7(5=$ /,1($ '(/ 78025(
32/021$5( 121 $ 3,&&2/( &(//8/( 16&/& &21 (*)5 121087$72 2
6&2126&,872
%$&.*5281'
1HOOD SUDWLFD FOLQLFD FLUFD XQ WHU]R GHL SD]LHQWL FRQ WXPRUH SROPRQDUH QRQ D SLFFROH FHOOXOH
16&/& DYDQ]DWR VRQR FDQGLGDWL D WHUDSLD GL WHU]D OLQHD $WWXDOPHQWH VROR XQ IDUPDFR
O
LQLELWRUHGL(*)5HUORWLQLEqUHJLVWUDWRLQVHFRQGDHWHU]DOLQHDVXOODEDVHGLXQRVWXGLRFKHQH
KDGLPRVWUDWRXQEHQHILFLRPHGLRGLFLUFDPHVLLQVRSUDYYLYHQ]DULVSHWWRDOSODFHER5HFHQWL
VWXGL KDQQR PHVVR LQ GXEELR O¶HIILFDFLD GL HUORWLQLE LQ VHFRQGD OLQHD LQ SD]LHQWL FRQ WXPRUH
(*)5 ZLOGW\SH H VXJJHULUHEEHUR XQ¶LQIHULRULWj ULVSHWWR DOOD FKHPLRWHUDSLD FRQ GRFHWD[HO 3HU
TXHVWR PRWLYR O¶XVR GL HUORWLQLE VL VWD SURJUHVVLYDPHQWH VSRVWDQGR YHUVR OD WHU]D OLQHD (¶
YHURVLPLOHWXWWDYLDFKHXWLOL]]DQGRIDUPDFLFKHPLRWHUDSLFLFRPHJHPFLWDELQDRYLQRUHOELQDVL
SRVVDQRRWWHQHUHLQWHU]DOLQHDULVXOWDWLVLPLOLRVXSHULRULFRQWRVVLFLWjFRQWHQXWHHFRQXQFRVWR
PROWRLQIHULRUH
2%,(77,9,
9DOXWDUH O¶HIILFDFLD GL XQD FKHPLRWHUDSLD JHPFLWDELQD R YLQRUHOELQD ULVSHWWR D HUORWLQLE QHO
WUDWWDPHQWRGLSD]LHQWLFRQ16&/&DYDQ]DWR(*)5ZLOGW\SHRVFRQRVFLXWRLQSURJUHVVLRQH
GRSR OLQHH GL FKHPLRWHUDSLD LQ WHUPLQL GL VRSUDYYLYHQ]D JOREDOH HQGSRLQW SULPDULR ,
WUDWWDPHQWL YHUUDQQR LQROWUH FRQIURQWDWL LQ WHUPLQL GL TXDOLWj GL YLWD WRVVLFLWj H FRVWL HQG
SRLQWVVHFRQGDUL
0(72',
, SD]LHQWL YHUUDQQR UDQGRPL]]DWL DG XQR GHL EUDFFL GL WUDWWDPHQWR FRQ XQ UDSSRUWR GL $VVXPHQGR XQD VRSUDYYLYHQ]D PHGLDQD GL PHVL QHO EUDFFLR FRQ HUORWLQLE HG XQ LQFUHPHQWR
SDULDPHVLQHOEUDFFLRVSHULPHQWDOHFRQFKHPLRWHUDSLDXQDSRWHQ]DGHOO¶HGXQHUURUH
GL WLSR , GHO VDUDQQR QHFHVVDUL SD]LHQWL SHU EUDFFLR GL WUDWWDPHQWR GD UHFOXWDUH QHO
FRUVRGHOORVWXGLRHGDVHJXLUHSHUPHVLGLIROORZXS
75$6)(5,%,/,7$¶'(,5,68/7$7,$/&217(6726$1,7$5,25(*,21$/(
4XDORUDTXHVWRVWXGLRULVXOWDVVHSRVLWLYRQHGHULYHUHEEHXQFDPELDPHQWRGHOODSUDWLFDFOLQLFD
FRQXQPLJOLRUDPHQWRGHOO¶DVSHWWDWLYDGLYLWDGLSD]LHQWLFRQXQDSDWRORJLDQHRSODVWLFDDGDOWR
LPSDWWRHGXQULVSDUPLRLQWHUPLQLGLULVRUVHHFRQRPLFKHSHUOD5(5
9$/87$=,21( '(//
()),&$&,$ '(/ 02'(//2 $66,67(1=,$/( 6,08/7$1(286
&$5( 1(/ 0,*/,25$0(172 '(//$ 48$/,7$
', 9,7$ '(, 3$=,(17, $))(77, '$
1(23/$6,(0$/,*1(678',2&/,1,&2&21752//$72(5$1'20,==$72
%$&.*5281'
, SD]LHQWL DIIHWWL GD WXPRUL PDOLJQL LQ VWDGLR DYDQ]DWR LQ WUDWWDPHQWR RQFRORJLFR DWWLYR
ODPHQWDQR PROWHSOLFL VLQWRPL FKH FRQGL]LRQDQR QHJDWLYDPHQWH OD TXDOLWj GHOOD YLWD H OD
VRSUDYYLYHQ]D OD WHUDSLD VLQWRPDWLFRSDOOLDWLYD YLHQH VSHVVR SUHVFULWWD WDUGLYDPHQWH QHO
FRUVR GHOOD PDODWWLD (YLGHQ]H VFLHQWLILFKH DQFRUD SUHOLPLQDUL H OLPLWDWH D SD]LHQWL FRQ
FDUFLQRPD SROPRQDUH QRQ D SLFFROH FHOOXOH 16&/& DYDQ]DWR GLPRVWUDQR FKH O¶LQWHJUD]LRQH
SUHFRFHHVLPXOWDQHD6LPXOWDQHRXV&DUHGHOOHFXUHSDOOLDWLYHFRQOHWHUDSLHRQFRORJLFKHDWWLYH
FKHPLRWHUDSLD WHUDSLH ELRORJLFKH UDGLRWHUDSLD PLJOLRUD OD 4XDOLWj GHOOD 9LWD 4R/ O
XPRUH
OD6RSUDYYLYHQ]D*OREDOH26HO¶DSSURSULDWH]]DGHL7UDWWDPHQWLGL)LQH9LWD(R/&V
2%,(77,9,
/¶RELHWWLYRSULQFLSDOHGHOSURJHWWRqGLPRVWUDUHLQXQFRQWHVWRUHDOHFKHOD6LPXOWDQHRXV&DUH
PLJOLRUD OD 4R/ GHL SD]LHQWL DIIHWWL GD YDULH QHRSODVLH PDOLJQH DYDQ]DWH LQ WUDWWDPHQWR
RQFRORJLFRDWWLYR2ELHWWLYLVHFRQGDULYDOXWD]LRQHGHOO¶DSSURSULDWH]]DGHOO¶(R/&VHGHOO¶26
5LFHUFDHLQQRYD]LRQH
5LFHUFDHLQQRYD]LRQH
0(72',
6WXGLRFOLQLFRUDQGRPL]]DWRPXOWLFHQWULFRLQFLHFRDJUXSSLSDUDOOHOLSHUFRPSDUDUHO¶HIIHWWRGL
GXH PRGHOOL DVVLVWHQ]LDOL SUHVD LQ FDULFR RQFRORJLFD VWDQGDUG DVVRFLDWD DOOD SUHVD LQ FDULFR
SUHFRFH H VLPXOWDQHD GD SDUWH GL XQ¶HTXLSH GHGLFDWD DOOH FXUH VLQWRPDWLFRSDOOLDWLYH EUDFFLR
VSHULPHQWDOHSUHVDLQFDULFRRQFRORJLFDVWDQGDUGGHOSD]LHQWHEUDFFLRGLFRQWUROOR
75$6)(5,%,/,7$¶'(,5,68/7$7,$/&217(6726$1,7$5,25(*,21$/(
/¶HQG SRLQW SULPDULR q LO PLJOLRUDPHQWR GHOOD TXDOLWj GHOOD YLWD GRSR VHWWLPDQH
GDOO¶LQWHUYHQWR PLVXUDWR FRQ )$&7* )XQFWLRQDO $VVHVVPHQW RI &KURQLF 7KHUDS\*HQHUDO
4XDORUD L ULVXOWDWL GHOOD ULFHUFD IRVVHUR SRVLWLYL TXHVWR PRGHOOR DVVLVWHQ]LDOH SRWUHEEH HVVHUH
DGRWWDWRLQDOWUHUHDOWjFRQXQEHQHILFLRQRQVRORGLWLSRFOLQLFRSHULOSD]LHQWHPDDQFKHGLWLSR
RUJDQL]]DWLYRHGHFRQRPLFRSHULOVLVWHPDVDQLWDULR
81$ 675$7(*,$ %$6$7$ 68//¶(9,'(1=$ 3(5 5,'855( ,/ 7$662 ', 3$57,
&(6$5(,678',2',,03/(0(17$=,21(
%$&.*5281'
1RQRVWDQWH OD GLVSRQLELOLWj GL UDFFRPDQGD]LRQL EDVDWH VX HYLGHQ]H VFLHQWLILFKH (%0 VL
UHJLVWUD DQFRUD XQD FRQVLGHUHYROH YDULDELOLWj GHOOD IUHTXHQ]D GL SDUWL FRQ WDJOLR FHVDUHR 7&
VLDWUDGLYHUVHDUHHJHRJUDILFKHVLDWUDFHQWULGLIIHUHQWLRVSHGDOLFOLQLFKHSULYDWH1HOLQ
(PLOLD5RPDJQDLOWDVVRGL7&qVWDWRGHOFRQ3DUPDDOH5LPLQLDO'DLGDWLGL
XQDPHWDDQDOLVLODVWUDWHJLDGL³$XGLWDQG)HHGEDFN´ULVXOWDWUDOHSLHIILFDFLQHOULGXUUHL7&
VHQ]DLQGLFD]LRQH
2%,(77,9,
2ELHWWLYRSULPDULR
9DOXWDUHO¶HIILFDFLDGLXQDVWUDWHJLDGL$XGLWDQG)HHGEDFN$)SHUIDYRULUHO¶LPSOHPHQWD]LRQH
GL OLQHH JXLGD QD]LRQDOL /* PLVXUDWD LQ WHUPLQL GL ULGX]LRQH GHL SDUWL FHVDUHL HQG SRLQW
SULPDULR
2ELHWWLYLVHFRQGDUL
LGHQWLILFDUHRVWDFROLHEDUULHUHDOO¶LPSOHPHQWD]LRQHGHOOH/*
PLVXUDUH O¶DGHVLRQH DG RJQL UDFFRPDQGD]LRQH GHOOD /* DWWUDYHUVR O¶XWLOL]]R GL XQ VHW GL
LQGLFDWRUL
0(72',
6WXGLR TXDVLVSHULPHQWDOH LQ FXL LO WUHQG GL 7& YLHQH DQDOL]]DWR QHO EUDFFLR DWWLYR FRQ OD
VWUDWHJLD H QHO EUDFFLR GL FRQWUROOR RVSHGDOL GHOOD 5(5 VHQ]D VWUDWHJLD SULPD H GRSR
O¶LPSOHPHQWD]LRQH GL $) 6L DWWHQGH XQ GHFUHPHQWR GHO WDVVR GL 7& SDUL DO SHUWDQWR
RFFRUUHPRQLWRUDUHSDUWLFRQ7&QHOEUDFFLRDWWLYRVLDSULPDVLDGXUDQWHODVWUDWHJLD,O
SHULRGRWRWDOHGLLQWHUYHQWRVDUjFRPSUHVRWUDPHVL
5,68/7$7,
$O SURJHWWR DGHULVFRQR WXWWH OH 82 GL 2VWHWULFLD H *LQHFRORJLD SXEEOLFKH GHOOD SURYLQFLD GL
3DUPD 1HO SULPR DQQR GL DWWLYLWj VL VRQR VYROWL PHHWLQJ DYYLR HGL]LRQL WUDLQLQJ H
DYDQ]DPHQWR (¶ VWDWD 5HDOL]]DWD XQD &5) HOHWWURQLFD RQOLQH VLWR ZHE GHGLFDWR FRQ OD
JHVWLRQHGLWXWWHOHXWHQ]HFRQOHGLYHUVHYLVWHSHUSURMHFWPDQDJHUFOLQLFRVWDWLVWLFRHFFHGq
VWDWRFUHDWRHPHVVRDSXQWRLO5HSRUWGLIHHGEDFNDJJLRUQDWRDXWRPDWLFDPHQWHDOWHUPLQHGL
RJQLVHGXWDGL$XGLW6LVRQRVYROWLLQFRQWULGL$XGLWSHUXQWRWDOHGL7&DQDOL]]DWLSDULD
FRQXQDPHGLDGL7&QRQDGHUHQWLDOOHLQGLFD]LRQLGHOOH/*SDULDO
75$6)(5,%,/,7$¶'(,5,68/7$7,$/&217(6726$1,7$5,25(*,21$/(
/D GHILQL]LRQH GL /LQHH *XLGD SXz HVVHUH XQ XWLOH VWUXPHQWR SHU PHGLFL H DPPLQLVWUDWRUL
VDQLWDUL SHU PLJOLRUDUH OD TXDOLWj GHOO¶DVVLVWHQ]D H UD]LRQDOL]]DUH O¶XWLOL]]R GHOOH ULVRUVH
3XUWURSSRQRQqVXIILFLHQWHOD³VHPSOLFH´SXEEOLFD]LRQHGLIIXVLRQHGLGRFXPHQWLSHUPRGLILFDUHL
FRPSRUWDPHQWL PD VRQR QHFHVVDULH VWUDWHJLH FKH VWLPRODQR DWWLYDPHQWH LO PHGLFR D SUHQGHUH
LQ FRQVLGHUD]LRQH H DG DGRWWDUH QHOOD SURSULD SUDWLFD OH FRQRVFHQ]H VFLHQWLILFKH GLVSRQLELOL
4XHVWR VWXGLR LQWHQGH SHUWDQWR YHULILFDUH O¶DSSOLFDELOLWj QHO QRVWUR FRQWHVWR H O¶LPSDWWR GHOOD
VWUDWHJLD LQ WHUPLQL GL ULGX]LRQH GHL WDJOL FHVDUHL 6H L ULVXOWDWL VDUDQQR SRVLWLYL OD VXD
JHQHUDOL]]DELOLWj DG DOWUL FRQWHVWL UHJLRQDOLQD]LRQDOL q DVVLFXUDWD GDO FDUDWWHUH SUDJPDWLFR
GHOORVWXGLRGDOODSUHVHQ]DGLWUHRVSHGDOL³UDSSUHVHQWDWLYL´HGDOODWLSRORJLDGLLQWHUYHQWRFKH
ULFKLHGHODUDFFROWDGLXQVHWPLQLPRGLLQIRUPD]LRQLHODUHDOL]]D]LRQHGLLQFRQWULSHULRGLFL
/R VWXGLR SURGXUUj LQROWUH LQIRUPD]LRQL LPSRUWDQWL SHU OD 5HJLRQH UHODWLYH DJOL RVWDFROL H DOOH
EDUULHUHLQFRQWUDWLGDLSURIHVVLRQLVWLQHOO¶DSSOLFD]LRQHGHOOHUDFFRPDQGD]LRQL
75,$/ &/,1,&2 5$1'20,==$72 3(5 9$/87$5( /¶())(772 ', 81$ 675$7(*,$ ',
('8&$=,21('(//$&2081,7¬68,7(03,',$&&(662263('$/,(52,1&2562',
,&786$&872
%$&.*5281'
/¶LFWXV FHUHEUDOH q XQD SDWRORJLD PROWR IUHTXHQWH H SRWHQ]LDOPHQWH IDWDOH R FDXVD GL JUDYL
GLVDELOLWj SHUPDQHQWL 5LWDUGL QHOO¶LQWHUYHQWR LQ IDVH DFXWD SRVVRQR SUHFOXGHUH O¶HVHFX]LRQH GL
WUDWWDPHQWLGLSURYDWDHIILFDFLDFRPHODWURPEROLVLLQWUDYHQRVDHLQWUDDUWHULRVDFKHSRVVRQR
HVVHUH VRPPLQLVWUDWL VROR QHOOH SULPH RUH GDOO¶LQVRUJHQ]D GHOO¶HSLVRGLR , ULWDUGL VRQR VSHVVR
FDXVDWL GDO QRQ WHPSHVWLYR ULFRUVR DL VHUYL]L GL VRFFRUVR GD SDUWH GHO SD]LHQWH R GL FKL q
SUHVHQWH DO PRPHQWR GHOO¶LFWXV 4XHVWR FRPSRUWDPHQWR LQDGHJXDWR VHPEUD HVVHUH FRUUHODWR
QRQ VROR DOOD FRQRVFHQ]D GHOOD SDWRORJLD LQ TXHVWLRQH PD VRSUDWWXWWR DOOD SHUFH]LRQH GHOOD
JUDYLWj GHL VLQWRPL (VLVWRQR HYLGHQ]H FKH GLPRVWUDQR FRPH O¶HGXFD]LRQH GHL FLWWDGLQL SRVVD
DYHUHXQUXRORLPSRUWDQWHDLILQLGHOODSUHYHQ]LRQH
2%,(77,9,
,O SURJHWWR LQWHQGH VSHULPHQWDUH SHU OD SULPD YROWD LQ ,WDOLD XQD VWUDWHJLD VWDQGDUGL]]DWD GL
HGXFD]LRQH GHOOD SRSROD]LRQH YROWD D PRGLILFDUH LO FRPSRUWDPHQWR LQ SUHVHQ]D GL VLQWRPL
ULFRQGXFLELOL D LFWXV YHULILFDQGRQH JOL HIIHWWL LQ WHUPLQL GL ULGX]LRQH GHO ULWDUGR GL
RVSHGDOL]]D]LRQHHGHOO¶HVLWRFOLQLFRGHLSD]LHQWL
0(72',
/D FDPSDJQD HGXFD]LRQDOH ULYROWD DL FLWWDGLQL UHDOL]]DWD GD XQ HVSHUWR LQ FRPXQLFD]LRQH
VDQLWDULDVXOODEDVHGHOODOHWWHUDWXUDHGHOO¶DQDOLVLGHOODVLWXD]LRQHORFDOHYHUUjDSSOLFDWDQHOOH
3URYLQFH UHJLRQDOL SDUWHFLSDQWL DOOR VWXGLR LQ WHPSL GLYHUVL /¶HIIHWWR GHOO¶LQWHUYHQWR YHUUj
PLVXUDWR WUDPLWH FRQIURQWR FRQ OD XVXDO FDUH LQVLHPH GL LQL]LDWLYH VSRQWDQHH H QRQ
VWDQGDUGL]]DWHGLGLYHUVHLVWLWX]LRQL
5,68/7$7,
6RQR VWDWH DWWXDWH OH GXH VXUYH\ SUHYLVWH QHO SURJHWWR XQD VXO JUDGR GL FRQRVFHQ]D GHL
VLQWRPL GL LFWXV VX XQ FDPSLRQH GHOOD SRSROD]LRQH WDUJHW DQDOLVL GHO FRQWHVWR H XQD VXL
GHWHUPLQDQWLGHOULWDUGRGLRVSHGDOL]]D]LRQHLQXQFDPSLRQHGLSD]LHQWLULFRYHUDWLSUHVVROH82
FRLQYROWH QHOOR VWXGLR ,Q HQWUDPEH OH LQGDJLQL q VWDWR XWLOL]]DWR XQ TXHVWLRQDULR WUDWWR GDOOD
OHWWHUDWXUD SHU TXDQWR FRQFHUQH O¶LQGDJLQH FRQRVFLWLYD q VWDWD DWWXDWD OD YDOLGD]LRQH
WUDQVFXOWXUDOHVHJXHQGRODPHWRGRORJLDGL%HDWRQ,QPHULWRDOO¶DQDOLVLGHOFRQWHVWRVRQR
VWDWLUDFFROWLTXHVWLRQDULLFXLULVXOWDWLVRQRVWDWLRJJHWWRLQRFFDVLRQHGLLQFRQWULGHO7HDP
GL5LFHUFDDOILQHGLVYLOXSSDUHLOPHVVDJJLRHGXFD]LRQDOHVFHJOLHUHLSURGRWWLGHOODFDPSDJQDH
L FDQDOL GL GLIIXVLRQH /¶LQGDJLQH VXL SD]LHQWLFDUHJLYHU q VWDWD DWWXDWD QHL VHL 2VSHGDOL
FRLQYROWLSHUXQSHULRGRGLWUHPHVLPDU]RPDJJLR6RQRVWDWLLQWHUYLVWDWLSD]LHQWL
ULFRYHUDWL FRQVHFXWLYDPHQWH SHU VRVSHWWR GL LFWXV 3HU OD UDFFROWDYDOLGD]LRQH GHL GDWL q VWDWD
XWLOL]]DWD XQD H&5) FUHDWD DG KRF GDOOD 82 5LFHUFD H ,QQRYD]LRQH FKH KD FXUDWR DQFKH LO
WUDLQLQJGHLULOHYDWRUL'DOXJOLRDVHWWHPEUHFRQO¶DLXWRGHOO¶$JHQ]LDFKHVLqDJJLXGLFDWDLO
EDQGRSHUODUHDOL]]D]LRQHGHOODFDPSDJQDVLqSURFHGXWRDOODFUHD]LRQHGHLSURGRWWLHGXFDWLYL
EURFKXUH SRVWHU H ILOPDWR FKH VRQR VWDWL YDOXWDWL GD SLFFROL FDPSLRQL GL SRSROD]LRQH IRFXV
JURXSFRRUGLQDWLGDXQDSVLFRORJDHVSHUWDLQFRPXQLFD]LRQHDOILQHGLDUULYDUHDOODYHUVLRQH
ILQDOH GHL SURGRWWL ,QILQH q VWDWD SLDQLILFDWD OD FDPSDJQD QHOOD TXDWWUR SURYLQFH FRQ
GHVFUL]LRQH GHL WHPSL H GHL OXRJKL GL GLVWULEX]LRQH GHL SURGRWWL H GHOOH PRGDOLWj GL ULQIRU]R
SHULRGLFR GHO PHVVDJJLR HGXFDWLYR VHFRQGR TXDQWR JLj SUHYLVWR QHO SURWRFROOR RULJLQDOH /D
5LFHUFDHLQQRYD]LRQH
5LFHUFDHLQQRYD]LRQH
IDVHVSHULPHQWDOHKDDYXWRLQL]LRDGDJRVWRFRQODUDFFROWDGHLGDWLDOEDVHOLQHPHVL
VHFRQGRLOGLVHJQRVWHSSHGZHGJHHFRQODVHTXHQ]DUDQGRPJHQHUDWD
75$6)(5,%,/,7$¶'(,5,68/7$7,$/&217(6726$1,7$5,25(*,21$/(
/D SDUWHFLSD]LRQH DOOR VWXGLR GL SURYLQFLH H LO GLVHJQR XWLOL]]DWR FKH FRQVHQWH O¶DFFHVVR
DOO¶LQWHUYHQWRGLWXWWHHSHUPHWWHUjGLWUDVIHULUHLULVXOWDWLDODUJKLVWUDWLGHOODSRSROD]LRQHHD
GLIIHUHQWLFRQWHVWLRUJDQL]]DWLYL,OWLSRGLVWUDWHJLDVSHULPHQWDWDFRPSRUWDODVWDQGDUGL]]D]LRQH
GL DOFXQL DVSHWWL IRQGDPHQWDOL PD SHUPHWWH XQD FHUWD IOHVVLELOLWj ORFDOH QHOOD IDVH GL
LPSOHPHQWD]LRQHLOFKHJDUDQWLVFHXQXOWHULRUHHOHPHQWRGLJHQHUDOL]]DELOLWjDGLYHUVLFRQWHVWL
,QWDOVHQVRODVWUDWHJLDVSHULPHQWDWDVHHIILFDFHSRWUHEEHHVVHUHGLIIXVDDOO¶LQWHUDUHJLRQHR
DGDOWULFRQWHVWL1D]LRQDOLUDSSUHVHQWDQGRXQYHURHSURSULR³SURGRWWR´HGXFDWLYR
*29(51$1&( '(/ 3$=,(17( ',$%(7,&2 5,&29(5$72 ,1 6(77,1* $66,67(1=,$/,
12163(&,$/,67,&,
%$&.*5281'
,O GLDEHWH q XQD FRQGL]LRQH PROWR IUHTXHQWH WUD L SD]LHQWL ULFRYHUDWL /D QHFHVVLWj GL GHJHQ]D
RVSHGDOLHUDqLPSXWDELOHVRORLQPLQRUSDUWHDGHYHQWLPHWDEROLFLDFXWLHLQPLVXUDPDJJLRUHD
FRQGL]LRQL JHVWLWH LQ UHSDUWL QRQ VSHFLDOLVWLFL SHU OD FXUD GHO GLDEHWH 3RLFKp OD SUHVHQ]D GL
GLDEHWH VL DVVRFLD DG XQ DXPHQWDWR ULVFKLR GL FRPSOLFDQ]H SHJJLRUD OD SURJQRVL DOOXQJD OD
GHJHQ]D PHGLD H GHWHUPLQD XQ LQFUHPHQWR VLJQLILFDWLYR GHL FRVWL DVVLVWHQ]LDOL q HVVHQ]LDOH
JDUDQWLUHODJHVWLRQHRWWLPDOHGLTXHVWLVRJJHWWLLQVHWWLQJQRQVSHFLDOLVWLFL1RQRVWDQWHTXHVWD
FRQVDSHYROH]]D DG RJJL QRQ HVLVWRQR SURFHGXUH VWDQGDUGL]]DWH GL JHVWLRQH GHO SD]LHQWH
GLDEHWLFRLQUHJLPHGLULFRYHURRVSHGDOLHUR
2%,(77,9,
/¶RELHWWLYR GHO SURJHWWR q LPSOHPHQWDUH XQ PRGHOOR GL ³EHVW SUDFWLFH´ ULJXDUGDQWH OD JHVWLRQH
GHO
SD]LHQWHGLDEHWLFRULFRYHUDWRVXOODEDVHGLOLQHHJXLGDQD]LRQDOLHLQWHUQD]LRQDOL
*OL HIIHWWL GHOO¶LQWHUYHQWR YHUUDQQR YDOXWDWL VX RXWFRPH FOLQLFL WUD FXL UDJJLXQJLPHQWR GHO
FRPSHQVRJOLFHPLFRGXUDWDGLGHJHQ]DFRPSOLFDQ]H
0(72',
6LWUDWWDGLXQRVWXGLRUDQGRPL]]DWRDFOXVWHUGRYHLUHSDUWLYHQJRQRDVVHJQDWLDGDWWXDUHXQ
LQWHUYHQWR IRUPDWLYR R DOOD SUDWLFD URXWLQDULD ,O SURJHWWR SUHYHGH OD FUHD]LRQH GL XQ
SURFHVVRGLFXUDHGLLQGLFDWRULGLDSSURSULDWH]]DJHVWLRQDOHGHOSD]LHQWHGLDEHWLFRULFRYHUDWR
ODSURPR]LRQHGLXQSHUFRUVRIRUPDWLYRVWUXWWXUDWRGHOSHUVRQDOHPHGLFRHGLQIHUPLHULVWLFR
QRQ VSHFLDOLVWLFR FRQ LPSOHPHQWD]LRQH GHJOL VWDQGDUG GL FXUD GHO GLDEHWH LQ GLYHUVL VHWWLQJ
DVVLVWHQ]LDOLDXGLWFOLQLFRFRQGRWWRGDSHUVRQDOHHVWHUQRDOUHSDUWRSHUYHULILFDUHO¶DGHVLRQH
D LQGLFDWRUL GL HIILFDFLD H DSSURSULDWH]]D JHVWLRQDOH /D YDOXWD]LRQH GHOO¶DGHVLRQH YHUUj
HIIHWWXDWDXWLOL]]DQGRXQRVWUXPHQWRFUHDWRQHOO¶DPELWRGHOSURJHWWR³SHUIRUPDQFHVFRUH´
5,68/7$7,
$OSURJHWWRDGHULVFRQR$]LHQGHVDQLWDULHGHOOD5(5
$O DSULOH q VWDWD FRPSOHWDWD H FRQGLYLVD OD OLVWD GL LQGLFDWRUL GL EHVW SUDFWLFH SHU OD
YDOXWD]LRQHGHOO¶DSSURSULDWH]]DGHOODJHVWLRQHGHOSD]LHQWHGLDEHWLFRULFRYHUDWRHGqWHUPLQDWD
ODUDFFROWDGHLGDWLSHUODUHDOL]]D]LRQHGHOORVWXGLRILQDOL]]DWRDOODYDOLGD]LRQHGHOSHUIRUPDQFH
VFRUH5LJXDUGRO¶DWWXD]LRQHGHOSHUFRUVRIRUPDWLYRKDDYXWROXRJRODFRQGLYLVLRQHHUDFFROWD
GHO PDWHULDOH GLGDWWLFR H VRQR VWDWL SURJUDPPDWL JOL LQFRQWUL GL IRUPD]LRQH GHO SHUVRQDOH
VDQLWDULRQHLUHSDUWLGLLQWHUYHQWR3HUODUDFFROWDGDWLqVWDWDPHVVDDSXQWROD&5)HOHWWURQLFD
SHU LO FDULFDPHQWR GHOOH FDUWHOOH DFFHVVLELOH RQOLQH (¶ VWDWR LQILQH GLVHJQDWR OR VWXGLR
UDQGRPL]]DWRSHUYDOXWDUHO¶HIILFDFLDGHOO¶LQWHUYHQWRIRUPDWLYR
75$6)(5,%,/,7$¶'(,5,68/7$7,$/&217(6726$1,7$5,25(*,21$/(
/¶DSSOLFD]LRQHGHOPRGHOORGL³EHVWSUDFWLFH´VXSD]LHQWLQRQVHOH]LRQDWLHLQXQ¶DPSLDJDPPD
GL VHWWLQJ DVVLVWHQ]LDOL ³UHDOL´ OR UHQGH IDFLOPHQWH HVSRUWDELOH DG DOWUH UHDOWj UHJLRQDOL /D
FUHD]LRQH GL XQ PRGHOOR JHVWLRQDOH HG RUJDQL]]DWLYR UHJLRQDOH SHUPHWWHUj GL PLQLPL]]DUH OD
YDULDELOLWjGHOO¶DVVLVWHQ]DHGLXQLIRUPDUHODJHVWLRQHGHOODSDWRORJLDRWWHQHQGRXQDPDJJLRUH
HIILFDFLDHGHIILFLHQ]DGHOULFRYHURGHOSD]LHQWHPLJOLRUDQGRQHJOLHVLWL
3URGRWWR SDUWLFRODUPHQWH LQQRYDWLYR GHO SURJHWWR q LO SHUIRUPDQFH VFRUH VWUXPHQWR FKH
JUD]LHDOODVXDVHPSOLFLWjSRWUjHVVHUHIDFLOPHQWHWUDVIHULELOHDWXWWHOH$]LHQGHFKHLQWHQGDQR
YDOXWDUH O
DSSURSULDWH]]D GHOOD JHVWLRQH FOLQLFD GHO SD]LHQWH GLDEHWLFR ULFRYHUDWR H OD UHDOH
LPSOHPHQWD]LRQHGHOOHOLQHHJXLGD
)$50$&2*(120,&$ '(/ &/23,'2*5(/ 1(/ 75$77$0(172 '(//( 6,1'520,
&2521$5,&+($&87(
%$&.*5281'
,O FORSLGRJUHO q XQ IDUPDFR DQWLDJJUHJDQWH DPSLDPHQWH XWLOL]]DWR QHL SD]LHQWL FRQ VLQGURPH
FRURQDULFDDFXWDWXWWDYLDqFDUDWWHUL]]DWRGDXQ
DPSLDYDULDELOLWjGLULVSRVWDHGLRFFRUUHQ]DGL
FRPSOLFDQ]H GHWHUPLQDWH GD YDULDQWL JHQHWLFKH VFRSHUWH GL UHFHQWH $WWXDOPHQWH VRQR
GLVSRQLELOLQXRYLIDUPDFLDQWLDJJUHJDQWLLOFXLHIIHWWRQRQqLQIOXHQ]DWRGDOOHYDULDQWLJHQHWLFKH
PD FKH KDQQR XQ FRVWR VLJQLILFDWLYDPHQWH SL HOHYDWR ULVSHWWR DO FORSLGRJUHO /H OLQHH JXLGD
FDUGLRORJLFKHQRQFRQWHQJRQRLQGLFD]LRQLSUHFLVHVXOPLJOLRUHWUDWWDPHQWRGDXWLOL]]DUHLQEDVH
DOOHFDUDWWHULVWLFKHGHOVLQJRORSD]LHQWH
2%,(77,9,
/R VWXGLR LQWHQGH WHVWDUH QHL SD]LHQWL FRQ VLQGURPH FRURQDULFD DFXWD OD IDWWLELOLWj H O
XWLOLWj
FOLQLFD GHOOD VFHOWD GHOOD WHUDSLD DQWLDJJUHJDQWH SLDVWULQLFD EDVDWD VXOOH FDUDWWHULVWLFKH
JHQHWLFKH GHO SD]LHQWH ,Q SDUWLFRODUH VL YDOXWHUj VH OD VWUDWHJLD VLD LQ JUDGR GL ULGXUUH OH
FRPSOLFDQ]H WURPERWLFKH HR HPRUUDJLFKH FRUUHODWH DOO
XWLOL]]R GHOOD GXSOLFH WHUDSLD
DQWLDJJUHJDQWHSLDVWULQLFDQHLSD]LHQWLFRQVLQGURPHFRURQDULFDDFXWD
0(72',
6WXGLR SURVSHWWLFR PXOWLFHQWULFR UDQGRPL]]DWR GRYH SD]LHQWL RVSHGDOL]]DWL SHU VLQGURPH
FRURQDULFDDFXWDYHUUDQQRDVVHJQDWLDOEUDFFLRDWWLYRFRQO¶HVHFX]LRQHGHOLOWHVWJHQHWLFRRDO
EUDFFLR GL FRQWUROOR FRQ VRPPLQLVWUD]LRQH GHOOD WHUDSLD DQWLDJJUHJDQWH VHFRQGR OD URXWLQDULD
SUDWLFDFOLQLFD
5,68/7$7,
$OSURJHWWRSDUWHFLSDQRFHQWULGL&DUGLRORJLDGHOOD5HJLRQH(¶VWDWRVYLOXSSDWRORVWUXPHQWR
GL JHQRWLSL]]D]LRQH LQ JUDGR GL IRUQLUH L ULVXOWDWL LQ PHQR GL RUH /D VXD UHDOL]]D]LRQH KD
ULFKLHVWRSLWHPSRGHOSUHYLVWRLQTXDQWRVLqGHFLVRGLVHPSOLILFDUHDOPDVVLPRODPHWRGLFD
SHUUHQGHUHO¶XWLOL]]RSRVVLELOHDQFKHGDSHUVRQDOHQRQVSHFLDOL]]DWR$FDXVDGLTXHVWRULWDUGR
ROWUH D IDWWRUL RUJDQL]]DWLYL H D SUREOHPL FRQ O¶DSSURYD]LRQH GHO SURJHWWR SUHVVR XQR GHL
&RPLWDWL(WLFLFRLQYROWLO¶DUUXRODPHQWRqLQL]LDWRVRORSUHVVROD$28GL3DUPD(¶VWDWDSHUWDQWR
ULFKLHVWDDOOD5HJLRQHXQDSURURJDGHOORVWXGLR
75$6)(5,%,/,7$¶'(,5,68/7$7,$/&217(6726$1,7$5,25(*,21$/(
6H OR VWXGLR GDUj ULVXOWDWL SRVLWLYL LO WHVW JHQHWLFR GL VHPSOLFH XWLOL]]R DO OHWWR GHO SD]LHQWH
SRWUj HVVHUH HVHJXLWR URXWLQDULDPHQWH LQ WXWWL L VRJJHWWL FRQ VLQGURPH FRURQDULFD DFXWD SHU
LQGLUL]]DUH LO FOLQLFR QHOOD VFHOWD GHO IDUPDFR DQWLDJJUHJDQWH 4XHVWD QXRYD VWUDWHJLD
WHUDSHXWLFDFRQVHQWLUHEEHGLULVSDUPLDUHFRQVLGHUHYROLULVRUVHHFRQRPLFKHULGXFHQGRVLDLFRVWL
GHOOH RVSHGDOL]]D]LRQL SHU OH FRPSOLFDQ]H WURPERWLFKH HR HPRUUDJLFKH VLD L FRVWL UHODWLYL DL
IDUPDFLDQWLDJJUHJDQWLLQTXDQWRSHUPHWWHUHEEHGLOLPLWDUHO
XVRGHLQXRYLIDUPDFLSLFRVWRVL
VRORQHLSD]LHQWLFKHUHDOPHQWHQRQEHQHILFLDQRGHOFORSLGRJUHO
5LFHUFDHLQQRYD]LRQH
5LFHUFDHLQQRYD]LRQH
$//($1=$ 3(5 /$ 35(9(1=,21( 6(&21'$5,$ &$5',29$6&2/$5( ,1 (0,/,$
520$*1$678',2&/,1,&25$1'20,==$72',&21)5217275$81352*5$00$
67587785$72,17(16,92,1)(50,(5,67,&2(75$77$0(172$%,78$/(
%$&.*5281'
/H PDODWWLH FDUGLRYDVFRODUL UDSSUHVHQWDQR OD SULQFLSDOH FDXVD GL PRUWDOLWj H PRUELGLWj LQ
(XURSD 1HL SD]LHQWL FRQ VLQGURPH FRURQDULFD DFXWD q VWDWR GLPRVWUDWR FKH OD SUHYHQ]LRQH
VHFRQGDULD H SURJUDPPL GL ULDELOLWD]LRQH GHJOL VWLOL GL YLWD VRQR LQ JUDGR GL ULGXUUH
VLJQLILFDWLYDPHQWH PRUELGLWj H PRUWDOLWj /H /LQHH JXLGD LQWHUQD]LRQDOL GL &DUGLRORJLD LQGLFDQR
FRPH SULRULWj DVVROXWD O¶LPSOHPHQWD]LRQH GL SURJUDPPL GL HGXFD]LRQH VDQLWDULD YROWL DOOD
PRGLILFD GHOOR VWLOH GL YLWD HG DOOD ULGX]LRQH GHL IDWWRUL GL ULVFKLR XQLWDPHQWH DO FRQWUROOR
GHOO
DGHUHQ]DWHUDSHXWLFDDWWXDOPHQWHSHUzQRQHVLVWRQRSURJUDPPLVWUXWWXUDWLGLSUHYHQ]LRQH
VHFRQGDULDFRRUGLQDWLGDILJXUHSURIHVVLRQDOLGHGLFDWHHGDSSRVLWDPHQWHIRUPDWH
2%,(77,9,
/R VWXGLR VL SURSRQH GL WHVWDUH SHU OD SULPD YROWD LQ ,WDOLD XQ SURJUDPPD LQIHUPLHULVWLFR
VWUXWWXUDWR GL SUHYHQ]LRQH VHFRQGDULD VX XQD YDVWD SRSROD]LRQH GL SD]LHQWL FRQ VLQGURPH
FRURQDULFDDFXWDDGDOWRULVFKLRYDOXWDQGRQHO
HIILFDFLDFOLQLFDVXOODSRSROD]LRQHODIDWWLELOLWjH
O
LPSDWWRVXOVLVWHPDVDQLWDULRUHJLRQDOH*OLHIIHWWLYHUUDQQRPLVXUDWLVLDLQWHUPLQLGLEHQHILFL
VXJOL HQGSRLQW VXUURJDWL ULGX]LRQH GHL IDWWRUL GL ULVFKLR FRQYHQ]LRQDOL H DGHUHQ]D DOOD WHUDSLD
IDUPDFRORJLFD SUHVFULWWD VLD LQ WHUPLQL GL EHQHILFL FOLQLFL ULGX]LRQH GHJOL HYHQWL DYYHUVL
PDJJLRULFDUGLRYDVFRODUL
0(72',
3D]LHQWL FRQ VLQGURPH FRURQDULFD DFXWD YHUUDQQR UDQGRPL]]DWL DOO¶LQVHULPHQWR LQ XQ 3HUFRUVR
VWUXWWXUDWRLQIHUPLHULVWLFRGLSUHYHQ]LRQHVHFRQGDULD336,RDOWUDWWDPHQWRDELWXDOH
,O336,qXQSURJUDPPDJHVWLWRGDSHUVRQDOHLQIHUPLHULVWLFRFHQWUDOPHQWHIRUPDWRVWUXWWXUDWR
LQXQDVHULHGLYLVLWHLQGLYLGXDOLSHULRGLFKHGDOSHULRGRSUHGLPLVVLRQHILQRDPHVLGRSROD
GLPLVVLRQH /D VXD LQWURGX]LRQH YHUUj SUHFHGXWD GD XQD IDVH IRUPDWLYD GHO SHUVRQDOH
LQIHUPLHULVWLFR FRPSUHQGHQWH VWUDWHJLH FRPXQLFDWLYH YROWH D PLJOLRUDUH O¶DGHVLRQH WHUDSHXWLFD
HDOODPRGLILFDGHJOLVWLOLGLYLWDQRFLYL
5,68/7$7,
$OORVWXGLRSDUWHFLSDQRFHQWULGLFDUGLRORJLDUHJLRQDOLROWUHDO6HWWRUH)RUPD]LRQHGHOOD$28
GL 3DUPD $ RWWREUH HUDQR VWDWL DUUXRODWL SD]LHQWL FRQ XQ WDVVR GL DUUXRODPHQWR LQ
FUHVFLWD GRSR XQD IDVH GL URGDJJLR VL ULWLHQH FKH QHL SURVVLPL PHVL VL SRWUj JDUDQWLUH XQ
DUUXRODPHQWR GL SD]LHQWL DOOD VHWWLPDQD SHU FHQWUR (¶ LQROWUH SUHYLVWD O¶DGHVLRQH GL
XQ¶XOWHULRUHXQLWjGL&DUGLRORJLD
6RQRVWDWHHIIHWWXDWHWUHVHVVLRQLIRUPDWLYHGLWUHJLRUQDWHFLDVFXQDFRLQYROJHQGRLQIHUPLHUL
GHOOH 8QLWj 2SHUDWLYH FRLQYROWH SURYHQLHQWL VLD GDO VHWWLQJ RVSHGDOLHUR VLD WHUULWRULDOH 6RQR
VWDWHDIILQDWHOHFRQRVFHQ]HSHUODSUHVDLQFDULFRPXOWLGLPHQVLRQDOHGHOSD]LHQWHFRQ6LQGURPH
&RURQDULFD $FXWD YROWD DOOD ULGX]LRQH GHO SURILOR GL ULVFKLR GHO SD]LHQWH (¶ VWDWD
VXFFHVVLYDPHQWH HVHJXLWD XQD VHVVLRQH IRUPDWLYD DJJLXQWLYD ULYROWD DOOD 8QLWj 2SHUDWLYD LQ
SURFLQWR GL HQWUDUH QHOOR VWXGLR (¶ VWDWR LQILQH SUHGLVSRVWR PDWHULDOH LQIRUPDWLYR DJJLRUQDWR
FRQOHSLUHFHQWLFRQRVFHQ]HVFLHQWLILFKHLQDPELWRGLSUHYHQ]LRQH
3HU OH 8QLWj 2SHUDWLYH GRYH LO SURJHWWR q JLj LQ IDVH GL DWWXD]LRQH q VWDWD FUHDWD XQD UHWH
PXOWLGVFLSOLQDUH LQ FXL L YDUL VSHFLDOLVWL UXRWDQR DWWRUQR DO SD]LHQWH DO ILQH GL RWWLPL]]DUH LO
FRQWUROOR GHL IDWWRUL GL ULVFKLR 7DOH UHWH LQWHUDPHQWH JHVWLWD GDJOL LQIHUPLHUL VXOOD EDVH GHJOL
VWUXPHQWL DFTXLVLWL GXUDQWH LO SURFHVVR IRUPDWLYR SHUPHWWH O¶LQWHJUD]LRQH DQFKH FRQ JOL
LQIHUPLHULGHOWHUULWRULRRSHUDQWLQHLQXFOHLGL&XUH3ULPDULH
75$6)(5,%,/,7$¶'(,5,68/7$7,$/&217(6726$1,7$5,25(*,21$/(
,O SURJHWWR VSHULPHQWHUj SHU OD SULPD YROWD XQ SURJUDPPD GL UHWH DVVLVWHQ]LDOH
PXOWLGLVFLSOLQDUH LQWHJUDWD WUD 2VSHGDOH H 7HUULWRULR FKH SRWUHEEH GLYHQLUH XQ PRGHOOR GL
ULIHULPHQWR SHU LO 6LVWHPD 6DQLWDULR UHJLRQDOH H QD]LRQDOH ,QROWUH JUD]LH DQFKH DOOD VXD
FRPSRQHQWH IRUPDWLYD OR VWXGLR SHUPHWWHUj GL SRWHQ]LDUH OH FRPSHWHQ]H GLVWLQWLYH GHO
SHUVRQDOHLQIHUPLHULVWLFRQHOODJHVWLRQHHGXFDWLYDGHOSD]LHQWHFRQVLQGURPHFRURQDULFDDFXWD
$335235,$7(==$ ', 5,&29(52 5,$%,/,7$7,92 ,1 5(*,0( ', '(*(1=$ 1(//$
5(*,21( (0,/,$ 520$*1$ ,03$772 ', 81 6,67(0$ $/7(51$7,92 ', &2',),&$
68//¶,1$335235,$7(==$,1(&&(662(68,&267,'(//$5(*,21(
%$&.*5281'
,Q ,WDOLD OH DWWLYLWj GL ULDELOLWD]LRQH RVSHGDOLHUD VRQR FODVVLILFDWH PHGLDQWH XQ VLVWHPD GL
FRGLILFD FKH FRQVLGHUD OD GLDJQRVL GHOOD SDWRORJLD FKH KD RULJLQDWR OD GLVDELOLWj HG LO WHPSR
LQWHUFRUVR GDOO¶HYHQWR LQGLFH 1RQ VRQR FRQVLGHUDWL IDWWRUL LQ JUDGR GL GHWHUPLQDUH LO UHDOH
IDEELVRJQRGLSUHVWD]LRQLFOLQLFRULDELOLWDWLYHHLOOLYHOORDVVLVWHQ]LDOHQHFHVVDULR&LzQRQVHPSUH
JDUDQWLVFHXQULPERUVRHTXRHSURSRU]LRQDWRDOOHULVRUVHHIIHWWLYDPHQWHLPSLHJDWH
2%,(77,9,
,O SURJHWWR LQWHQGH PLJOLRUDUH O
DSSURSULDWH]]D GL HURJD]LRQH GHL VHUYL]L GHL UHSDUWL GL
ULDELOLWD]LRQH LQWHQVLYD QHOOD 5(5 DWWUDYHUVR O
LQWURGX]LRQH GL XQR VWUXPHQWR FRQGLYLVR SHU OD
YDOXWD]LRQHGHOODFRPSOHVVLWjFOLQLFD
0(72',
6WXGLR RVVHUYD]LRQDOH SURVSHWWLFR GL YDOLGD]LRQH 1HOOD SULPD IDVH GHOOR VWXGLR VDUj DWWXDWR
O¶DGDWWDPHQWR
WUDQVFXOWXUDOH
GL
XQD
VFDOD
GL
FODVVLILFD]LRQH
LQWHUQD]LRQDOH
&RQWHPSRUDQHDPHQWH XQ SDQHO LQGLSHQGHQWH GL HVSHUWL FRQIURQWDQGR FULWHUL GL ULFRYHUR
DGRWWDWL GDL FHQWUL SDUWHFLSDQWL FRQ OD OHWWHUDWXUD GHILQLUj VHFRQGR OD PHWRGRORJLD GHO 'HOSKL
3DQHO XQ DOJRULWPR FOLQLFR JROG VWDQGDUG GL DSSURSULDWH]]D GL ULFRYHUR LQ PHGLFLQD
ULDELOLWDWLYD/DULOHYD]LRQHGHLGDWLQHFHVVDULDOORVWXGLRDYYHUUjLQGRSSLRFLHFR VLDLOPHGLFR
FKH WUDWWD LO SD]LHQWH VLDLO ULOHYDWRUH LJQRUHUDQQR O¶DOJRULWPR ,O QXPHUR GL ULFRYHUL WUDWWDWLLQ
XQDQQRQHLUHSDUWLLQVWXGLRFLUFDULVXOWDDGHJXDWRSHUDVVLFXUDUHXQDSRWHQ]DGHO
HXQ¶DOIDGHO
5,68/7$7,
(¶ VWDWR HIIHWWXDWR O¶DGDWWDPHQWR WUDQVFXOWXUDOH GHOOR VWUXPHQWR ³5HKDELOLWDWLRQ &RPSOH[LW\
6FDOH([WHQGHG´VHJXHQGRODPHWRGRORJLDLQGLFDWDLQOHWWHUDWXUD6RQRVWDWLHIIHWWXDWLDQFKH
FRQWUROOL GL IDFH YDOLGLW\ H DIILGDELOLWj LQWHUQD GHOOD YHUVLRQH LWDOLDQD H SXEEOLFDWL L ULVXOWDWL GHO
ODYRUR 6RQR VWDWL LQROWUH LGHQWLILFDWL PHGLDQWH PHWRGR 'HOSKL L FULWHUL GL ULFRYHUR LQ
ULDELOLWD]LRQH LQWHQVLYD (¶ VWDWR DQFKH HIIHWWXDWR XQ FRUVR GL IRUPD]LRQH ULYROWR DL PHGLFL
ILVLDWUL UDSSUHVHQWDWLYL GL WXWWH OH VWUXWWXUH SDUWHFLSDQWL FRPSUHQGHQWH XQ¶HVHUFLWD]LRQH
VXOO¶XWLOL]]RGHOOHWUHVFDOHGLYDOXWD]LRQHLPSLHJDWHQHOORVWXGLR/HGLVFRUGDQ]HQHOO¶DWWULEX]LRQH
GHJOLVFRUHHPHUVHSHUODVFDOD&,56&XPXODWLYH,OQHVV5DWLQJ6FDOHKDQQRUHVRQHFHVVDULR
PRGLILFDUHORVWUXPHQWRXWLOL]]DWRHO¶HVHFX]LRQHGLXQVHFRQGRLQFRQWURIRUPDWLYR
75$6)(5,%,/,7$¶'(,5,68/7$7,$/&217(6726$1,7$5,25(*,21$/(
,O SURJHWWR SXU ULFRSUHQGR XQ LQWHUYDOOR WHPSRUDOH UHODWLYDPHQWH EUHYH IRUQLVFH XQ PRGHOOR
VFLHQWLILFDPHQWH YDOLGDWR GL ULIHULPHQWR RJJHWWLYR HG XQLIRUPH SHU OD VFHOWD GHO VHWWLQJ
ULDELOLWDWLYR
, FHQWUL SDUWHFLSDQWL VRQR XQD TXRWD LPSRUWDQWH GHL UHSDUWL FKH RSHUDQR QHOOD 5(5
UDSSUHVHQWDWLYL GHOOD UHDOWj YDULHJDWD DWWXDOPHQWH SUHVHQWH H L SD]LHQWL LQ VWXGLR VRQR WXWWL
TXHOOL GHOOD SUDWLFD FOLQLFD FLz GRYUHEEH JDUDQWLUH OD JHQHUDOL]]DELOLWj GHL ULVXOWDWL /¶LQFOXVLRQH
GHL GLUHWWRULUHIHUHQWL GHOOH 82 SDUWHFLSDQWL QHOOD IDVH GL GHILQL]LRQH GHO TXHVWLRQDULR GD
VRWWRSRUUHDOSDQHOGLHVSHUWLSHUODGHILQL]LRQHGHOO¶DOJRULWPRFRQVHQWHLOFRLQYROJLPHQWRDWWLYR
GHOOHSDUWLLQFDXVDILQGDOO¶LGHD]LRQHFLzGRYUHEEHIDYRULUQH VXFFHVVLYDPHQWHLOWUDVIHULPHQWR
QHOODSUDWLFDFOLQLFDFRUUHQWH
5LFHUFDHLQQRYD]LRQH
6YLOXSSRGLXQDPELHQWHFXOWXUDOHIDYRUHYROH
$FFHVVLELOLWjDOODLQIRUPD]LRQHHGRFXPHQWD]LRQHVFLHQWLILFD
9DORUL]]DUHHGLIIRQGHUHOHHVSHULHQ]HQHOODULFHUFDHLULVXOWDWLRWWHQXWLVRQRD]LRQLFUXFLDOLSHU
PLJOLRUDUH FRVWDQWHPHQWH O¶DVVLVWHQ]D RIIHUWD GDOOD QRVWUD $]LHQGD PD DQFKH PH]]L SHU
FRLQYROJHUHLSURIHVVLRQLVWLSLJLRYDQLHVWLPRODUOLDSDUWHFLSDUHDQFK¶HVVLDJOLVWXGL3HUTXHVWL
PRWLYL OD 82 5LFHUFD H ,QQRYD]LRQH PHWWH D GLVSRVL]LRQH GD DQQL VXL VLWL LQWHUQHW H LQWUDQHW
D]LHQGDOLLQIRUPD]LRQLUHODWLYHDOODSURGX]LRQHVFLHQWLILFDHDLSURJHWWLLQFRUVRFIU&DS
SURQWDPHQWH FRQVXOWDELOL GDL SURIHVVLRQLVWL /D SURGX]LRQH H SXEEOLFD]LRQH GHL UHSRUW ULFKLHGH
XQ FRQVLGHUHYROH LPSHJQR H LO FRVWDQWH FRLQYROJLPHQWR GHL ULFHUFDWRUL WXWWDYLD OH PRWLYD]LRQL
FKH DQLPDQR TXHVWR LPSHJQR H L ULVXOWDWL RWWHQXWL JLXVWLILFDQR H SUHPLDQR JOL VIRU]L /H
QXPHURVH RVVHUYD]LRQL SRVLWLYH SHUYHQXWH GDL SURIHVVLRQLVWL VXJJHULVFRQR O¶LPSDWWR GHOOD
GLIIXVLRQH GHOOH LQIRUPD]LRQL VXOOD ULFHUFD LQ $]LHQGD VLD FRPH ULFRQRVFLPHQWR GHO PHULWR VLD
FRPHVWLPRORGHOO¶LQWHUHVVHGHLFROOHJKLQRQDWWLYDPHQWHFRLQYROWL
$WWLYLWjGLIRUPD]LRQHGHOSHUVRQDOH
8Q¶$]LHQGD VDQLWDULD FKH SRQH OD ULFHUFD WUD OH VXH DWWLYLWj IRQGDPHQWDOL GHYH VDSHU DWWXDUH
LQWHUYHQWL YROWL D FUHDUH OH FRQGL]LRQL DGHJXDWH SHU VYLOXSSDUH SRWHQ]LDUH H YDORUL]]DUH LO
SRWHQ]LDOHGLFRPSHWHQ]HHULVRUVHFKHSRVVLHGH
3HU OD FUHD]LRQH H LO FRQVROLGDPHQWR GL DELOLWj H FRPSHWHQ]H PHWRGRORJLFKH GD DQQL OD $28
DWWXD LQL]LDWLYH GL IRUPD]LRQH DOOD ULFHUFD SLDQLILFDWH FRQ LQ PHQWH LQ SDUWLFRODUH L JLRYDQL
SURIHVVLRQLVWLPDXWLOLDQFKHDLSLHVSHUWLSHUDSSURIRQGLUHVSHFLILFKHWHPDWLFKH1HOVL
q WHQXWD OD VHFRQGD (GL]LRQH GHO 3URJUDPPD IRUPDWLYR ³0HWRGRORJLD GHOOD ULFHUFD XQD JXLGD
SHU FRPLQFLDUH´ XQD VHULH GL EUHYL FRUVL GHGLFDWL DJOL HOHPHQWL IRQGDPHQWDOL GHOOD ULFHUFD
/¶LQL]LDWLYDULSHWXWDDVHJXLWRGHOOHQXPHURVHULFKLHVWHSHUYHQXWHGRSRODSULPDHGL]LRQHVLq
GLPRVWUDWDFDSDFHGLFRQFLOLDUHLELVRJQLIRUPDWLYLGHLSURIHVVLRQLVWLFRQOHUHVWUL]LRQLGLWHPSR
LPSRVWH GDO QRWHYROH FDULFR GL ODYRUR DVVLVWHQ]LDOH JUD]LH DOOD EUHYH GXUDWD GHL PLQLFRUVL
PDVVLPRRUHHDOODSRVVLELOLWjGLIUHTXHQWDUHVRORJOLHYHQWLGLLQWHUHVVH1HOVLVRQR
VYROWL PLQLFRUVL FKH KDQQR IRUPDWR FRPSOHVVLYDPHQWH SURIHVVLRQLVWL 7XWWL JOL HYHQWL
KDQQRRWWHQXWRYDOXWD]LRQLGLJUDGLPHQWRPROWRHOHYDWHGDSDUWHGHLGLVFHQWLPLVXUDWHWUDPLWH
TXHVWLRQDULR(&0FRPHPRVWUDODWDEHOODVHJXHQWHWDEHOODLQIDWWLLJLXGL]LPHGLIRUPXODWL
VXXQDVFDODGDDVRQRVWDWLVHPSUHVXSHULRULD
7DEHOOD&RUVR³0HWRGRORJLDGHOODULFHUFDXQDJXLGDSHUFRPLQFLDUH´HGL]LRQHQXPHUR
GLSDUWHFLSDQWLHYDORULPHGLGLJUDGLPHQWR
5LFHUFDHLQQRYD]LRQH
7RWSDUWHFLSDQWL
5LOHYDQ]DDUJRPHQWL
4XDOLWjHGXFDWLYD
(IILFDFLDGHOO
HYHQWR
0HWRGRORJLDGHOOD
5LFHUFDXQDJXLGDSHU
FRPLQFLDUH
3HU ULVSRQGHUH DOOH HVLJHQ]H GL IRUPD]LRQH SL DYDQ]DWD QHO q VWDWD DYYLDWD OD
SLDQLILFD]LRQHGHO0DVWHUGLVHFRQGROLYHOOR³0HGLFLQDH%LRVWDWLVWLFDIRQGDPHQWLGLPHWRGRORJLD
GHOOD ULFHUFD´ UHDOL]]DWR FRQ O¶8QLYHUVLWj GL 3DUPD H SURPRVVR GDO *2,5& *UXSSR 2QFRORJLFR
,WDOLDQRGL5LFHUFD&OLQLFDFKHKDDQFKHIDYRULWRODSDUWHFLSD]LRQHVWDQ]LDQGRXQDTXRWDGHOOD
WDVVD GL LVFUL]LRQH D SURIHVVLRQLVWL DIIHUHQWL D XQ FHQWUR GHOOD UHWH *2,5& /¶HYHQWR q DOOD
WHU]DHGL]LRQHHVVHQGRVWDWRHIIHWWXDWRFRQVXFFHVVRQHJOLDQQLSDVVDWLGDOOD$28GL3DUPDLQ
FROODERUD]LRQH FRQ $]LHQGH VDQLWDULH GHOOD 5HJLRQH JUD]LH DL ILQDQ]LDPHQWL GHO 3URJUDPPD
GL5LFHUFD5HJLRQH8QLYHUVLWjDUHD
6HPSUH QHO OD 82 5LFHUFD H ,QQRYD]LRQH FRQ LO VXSSRUWR GHO %RDUG GHOOD 5LFHUFD KD
RUJDQL]]DWR GXH ZRUNVKRS GHGLFDWL DOOD ULFHUFD FRPXQLWDULD DL TXDOL KDQQR SDUWHFLSDWR DQFKH
ILJXUH DXWRUHYROL FRQ HVSHULHQ]D SUHVVR OD &RPPLVVLRQH HXURSHD *OL HYHQWL KDQQR ULVFRVVR
PROWR LQWHUHVVH H SDUWHFLSD]LRQH JUD]LH DO WDJOLR SUHWWDPHQWH SUDJPDWLFR H IRFDOL]]DWR DOOD
GLVFXVVLRQHGHOOHVLQJROHSURSRVWHSUHVHQWDWHGDLULFHUFDWRULVWHVVL
3HU SRWHU VXSSRUWDUH H DVVLVWHUH L ULFHUFDWRUL QHOOH GLYHUVH IDVL GL UHDOL]]D]LRQH GL XQR VWXGLR
GDQGR FRVu XQ XOWHULRUH LPSXOVR DOOH DWWLYLWj GL ULFHUFD QHOO¶$]LHQGD L SURIHVVLRQLVWL GHOOD 82
5LFHUFDH,QQRYD]LRQHLQWUDSUHQGRQRUHJRODUPHQWHDORURYROWDWUDLQLQJPLUDWRDVHFRQGDGHOOH
ORUR FRPSHWHQ]H H DUHH GL VSHFLDOL]]D]LRQH ,Q SDUWLFRODUH QHO FRPSRQHQWL GHOOD 82
KDQQR VHJXLWR FRUVL H ZRUNVKRS GHGLFDWL DOOH RSSRUWXQLWj RIIHUWH GDO SURJUDPPD GL
ILQDQ]LDPHQWR HXURSHR +RUL]RQ H DOOD SURJHWWD]LRQH LQ DPELWR FRPXQLWDULR 8Q¶DOWUD
SURIHVVLRQLVWD GHOOD 6WUXWWXUD KD LQL]LDWR D IUHTXHQWDUH XQ 0DVWHU GL ,, OLYHOOR LQ 6WDWLVWLFD
0HGLFD H *HQRPLFD DOO¶8QLYHUVLWj GL 3DYLD DO ILQH GL IRUQLUH XQ VXSSRUWR TXDOLILFDWR SHU
O¶HVHFX]LRQHGLULFHUFDLQFDPSRJHQHWLFRXQDPELWRLQFXLOD$28YDQWDULFHUFDWRULDXWRUHYROLH
FKH VL SUHYHGH VDUj XOWHULRUPHQWH SRWHQ]LDWR FRQ O¶DYYLR GHOOH DWWLYLWj GHO &&5 FIU VFKHGD
³8QLUHOHIRU]HSHUPLJOLRUDUHODULFHUFD´
&ROODERUD]LRQLFRQDOWUH$]LHQGHGHOOD5HJLRQH(PLOLD5RPDJQD
1HJOL XOWLPL WUH DQQL OH SXEEOLFD]LRQL LQ HVWHQVR DUWLFROL SURGRWWH GDL SURIHVVLRQLVWL
GHOO¶$]LHQGDVRQRVWDWHFRQXQWUHQGLQLQFUHPHQWRQHOWUDTXHVWHHPHUJRQR
HODERUDWLFLUFDVXLQFROODERUD]LRQHFRQDOWUHD]LHQGHGHOOD5HJLRQH(PLOLD5RPDJQD
&RPHPRVWUDWRQHOODWDEHOODVHJXHQWHWDEHOODODPDJJLRUHFROODERUD]LRQHqFRQOHD]LHQGH
GHOOD SURYLQFLD GL %RORJQD GHOOD SURYLQFLD GL 5HJJLR (PLOLD H 0RGHQD OH DOWUH
SURYLQFHVRQRDOGLVRWWRGHO
%RORJQD
5HJJLR(PLOLD
0RGHQD
)HUUDUD
3LDFHQ]D
)RUOu
5DYHQQD
5LPLQL
&HVHQD
1XPHURDUWLFROL
LQ
VXOWRWDOHGHJOL
FROODERUD]LRQH DUWLFROLGHOO¶$28GL
3DUPD
/H WUH DUHH WHPDWLFKH SUHYDOHQWL JUDILFR GHL DUWLFROL FRQ FXL O¶$]LHQGD 2VSHGDOLHUR
8QLYHUVLWDULD GL 3DUPD FROODERUD FRQ DOWUH $]LHQGH GHOOD 5HJLRQH (PLOLD 5RPDJQD VRQR
2QFRORJLD&KLUXUJLDH&DUGLRORJLD
5LFHUFDHLQQRYD]LRQH
7DEHOOD$UWLFROLLQFROODERUD]LRQHFRQDOWUHD]LHQGHGHOOD5HJLRQH(PLOLD5RPDJQD
*UDILFR $UHH WHPDWLFKH SUHYDOHQWL GHJOL DUWLFROL LQ FROODERUD]LRQH FRQ DOWUH D]LHQGH GHOOD
5HJLRQH(PLOLD5RPDJQD
2QFRORJLD
& KLUXUJLD
$UHDSUHYDOHQWH
6LVWHPD& DUGLRYDVFRODUH
1HXURVFLHQ]H1HXURORJLD
5DGLRORJLD0HGLFLQD1XFOHDUH
6LVWHPD5HVSLUDWRULR
(PDWRORJLD
*DVWURHQWURORJLD(SDWRORJLD
0HGLFLQD*HQHUDOH0HGLFLQD,QWHUQD
,PPXQRORJLD
VXOWRWDOHGHJOLDUWLFROLLQFROODERUD]LRQH
)RQWHGLFODVVLILFD]LRQH$UHHWHPDWLFKH,6,:HERI.QRZOHGJH
6YLOXSSR GL SURJHWWL GL ULFHUFD H LQQRYD]LRQH LQ UHWH FRQ DOWUH LVWLWX]LRQL H
VWUXWWXUHVDQLWDULHLQWHUQD]LRQDOL
1HOO¶XOWLPRWULHQQLROHFROODERUD]LRQLWUDO¶$28GL3DUPDHGHQWLHLVWLWXWLGLULFHUFDQD]LRQDOLHG
LQWHUQD]LRQDOLSHUODVWHVXUDGLSXEEOLFD]LRQLVRQRVWDWHSURILFXHFRPHHYLGHQWHGDLDUWLFROL
SXEEOLFDWLLQUHWH
, FHQWUL LQWHUQD]LRQDOL FRQ FXL VL q LQWHUDJLWR PDJJLRUPHQWH VRQR OD )UDQFLD GHOOH
SXEEOLFD]LRQL JOL 6WDWL 8QLWL OD 6SDJQD H O¶,QJKLOWHUUD SHU PDJJLRUL GHWWDJOL VL
ULQYLDDO&DSLWRORVH]LRQH
/HDUHHSUHYDOHQWLGHOOHSXEEOLFD]LRQLVFULWWHFRQFROODERUDWRULLQWHUQD]LRQDOLULVXOWDQRHVVHUHOD
&DUGLRORJLDHO¶(PDWRORJLDULVSHWWLYDPHQWHDOHJUDILFR
*UDILFR $UHH WHPDWLFKH SUHYDOHQWL GHJOL DUWLFROL FKH SUHVHQWDQR DOPHQR XQD FROODERUD]LRQH
LQWHUQD]LRQDOHDQQL
6LVWHPD& DUGLRYDVFRODUH
$UHDSUHYDOHQWH
5LFHUFDHLQQRYD]LRQH
(PDWRORJLD
& KLUXUJLD
7HFQRORJLD(0HGLFLQD'L/DERUDWRULR
0HGLFLQD*HQHUDOH0HGLFLQD,QWHUQD
1HXURVFLHQ]H1HXURORJLD
2QFRORJLD
(QGRFULQRORJLD0HWDEROLVPR
5DGLRORJLD0HGLFLQD1XFOHDUH
*DVWURHQWHURORJLD(SDWRORJLD
VXOWRWDOHGHJOLDUWLFROLLQFROODERUD]LRQH
)RQWHGLFODVVLILFD]LRQH$UHHWHPDWLFKH,6,:HERI.QRZOHGJH
(¶ LPSRUWDQWH LQROWUH VRWWROLQHDUH OH FROODERUD]LRQL LQVWDXUDWH QHO FRQ FHQWUL GL ULFHUFD
HXURSHL QHOO¶DPELWR GHL SURJHWWL ILQDQ]LDWL FRQ LO 9,, 3URJUDPPD 4XDGUR LO SULQFLSDOH
VWUXPHQWRILQDQ]LDULRGHOOD8QLRQH(XURSHD/¶HOHYDWDFRPSHWLWLYLWjHODULJLGLWjGHLSURFHVVLGL
YDOXWD]LRQH UHQGRQR O¶RWWHQLPHQWR GL ILQDQ]LDPHQWL FRPXQLWDUL XQ¶LPSUHVD SDUWLFRODUPHQWH
ORGHYROH2OWUHDOO¶LPSRUWDQWHFRQWULEXWRHFRQRPLFRDEHQHILFLRGHOO¶$]LHQGDODSDUWHFLSD]LRQHD
SURJHWWL HXURSHL FRQVHQWH GL FRVWUXLUH H UDIIRU]DUH QHWZRUN PXOWLSURIHVVLRQDOL LQWHUQD]LRQDOL
JDUDQWHQGR OR VFDPELR H OD FRQGLYLVLRQH GL FRQRVFHQ]H H FRPSHWHQ]H WUD L WHDP H TXLQGL
DXPHQWDQGRLOSUHVWLJLRHO¶DXWRUHYROH]]DGHOO¶$28GL3DUPD
'LVHJXLWRSUHVHQWLDPREUHYHPHQWHWUHSURJHWWLHXURSHLLQDWWRQHOQHOQRVWURRVSHGDOH
+(3$&87(
/¶LQIH]LRQHGDYLUXVGHOO¶HSDWLWH&+&9qHVWUHPDPHQWHGLIIXVDHWHQGHDFURQLFL]]DUHLQXQD
HOHYDWLVVLPDSHUFHQWXDOHGLFDVLYDULDELOLGDODOO¶DVHFRQGDGHOOHPRGDOLWjFRQFXLYLHQH
FRQWUDWWDVLSXzDVVRFLDUHDJUDYLFRPSOLFDQ]HFRPHODFLUURVLHO¶HSDWRFDUFLQRPD8QDYROWD
FURQLFL]]DWD OH WHUDSLH VRQR HIILFDFL VROR QHO GHL FDVL PHQWUH VH WUDWWDWD GXUDQWH OD
IDVHDFXWDO¶LQIH]LRQHYLHQHGHEHOODWDQHOGHLSD]LHQWL5LVXOWDSHUWDQWRIRQGDPHQWDOH
GLDJQRVWLFDUHHTXLQGLWUDWWDUHODPDODWWLDSUHFRFHPHQWHLGHQWLILFDQGRDOORVWHVVRWHPSRTXHL
SD]LHQWL FKH ULVROYHUDQQR VSRQWDQHDPHQWH O¶LQIH]LRQH HYLWDQGR ORUR XQD WHUDSLD FRVWRVD H
JUDYDWD GD LPSRUWDQWL HIIHWWL FROODWHUDOL 3XUWURSSR XQ¶DPSLD SHUFHQWXDOH GL VRJJHWWL FRQ
LQIH]LRQHGD+&9qDVLQWRPDWLFDQHOODIDVHDFXWDHQRQULFHYHXQDGLDJQRVLWHPSHVWLYD
$OODOXFHGLTXHVWHFRQVLGHUD]LRQLqVWDWRLGHDWRLOSURJHWWR+HSD&XWHILQDQ]LDWRQHOO¶DPELWRGHO
6HWWLPR3URJUDPPD4XDGURFRRUGLQDWRGDOO¶8QLYHUVLWjGL0RQDFRDOTXDOHFROODERUDO¶82
0DODWWLH,QIHWWLYHHG(SDWRORJLDGHOOD$28GL3DUPDFRQLOUXRORVSHFLILFRGLFRRUGLQDUHJOLVWXGL
GL LPPXQRORJLD FHOOXODUH ,O SURJHWWR VL SRQH O¶RELHWWLYR GL LQFUHPHQWDUH LO WDVVR GL
LGHQWLILFD]LRQHGLFDVLGLHSDWLWH&LQIDVHDFXWDVWXGLDUHLIDWWRULFKHLQIOXHQ]DQRLOFRQWUROORH
OD SHUVLVWHQ]D GHO YLUXV SRQHQGR TXLQGL OH EDVL FRQFHWWXDOL SHU OR VYLOXSSR GL QXRYH WHUDSLH
DQWLYLUDOLLQGLYLGXDUHELRPDUNHUGLULVROX]LRQHVSRQWDQHDGHOO¶LQIH]LRQHHPLJOLRUDUHODJHVWLRQH
FOLQLFDGHLSD]LHQWLFRQHSDWLWH&LQIDVHDFXWD
1HO FRUVR GHO SULPR DQQR GHO SURJHWWR VRQR VWDWH PHVVH D SXQWR QHO ODERUDWRULR GHOO¶82 GL
0DODWWLH ,QIHWWLYH HG (SDWRORJLD OH PHWRGLFKH PROHFRODUL QHFHVVDULH SHU YDOXWDUH VX FDPSLRQL
ELRORJLFL GL SD]LHQWL FKH VYLOXSSDQR LQIH]LRQL FURQLFKH FDUDWWHUL]]DWL GDOOD SUHVHQ]D GL EDVVL
QXPHUL GLOLQIRFLWL YLUXVVSHFLILFLO¶HVSUHVVLRQH GL VSHFLILFL JHQL H PLFUR51$ UHJRODWRUL FRUUHODWL
DOOD GHILFLWDULD ULVSRVWD LPPXQLWDULD SURWHJJHQWH WLSLFD GL WDOL SD]LHQWL 1HO FRUVR GHO VHFRQGR
DQQR VRQR VWDWL LGHQWLILFDWL PHGLDQWH WDOL DSSURFFL VSHULPHQWDOL GLIIHUHQ]H VLJQLILFDWLYH
QHOO¶HVSUHVVLRQH GL VSHFLILFKH YLH LQWUDFHOOXODUL GL UHJROD]LRQH GHOOH IXQ]LRQL OLQIRFLWDULH LQ
SD]LHQWLFRQLQIH]LRQHDFXWDHGLIIHUHQWHHYROX]LRQHGHOODVWHVVDYHUVRODJXDULJLRQHRYHUVROD
FURQLFL]]D]LRQH,QSDUWLFRODUHVRQRVWDWLLGHQWLILFDWLJHQLHVSUHVVLLQPRGRDOWHUQDWLYRLQIDVH
SUHFRFHGLLQIH]LRQHGDFKLJXDULVFHHGDFKLFURQLFL]]D(VSHULPHQWLGLYDOLGD]LRQHVLDDOLYHOOR
PROHFRODUHFKHDOLYHOORLPPXQRORJLFRVRQRDWWXDOPHQWHLQFRUVRSHUYDOXWDUHVHWDOLJHQLHOH
SURWHLQH GD HVVL FRGLILFDWH SRVVDQR UDSSUHVHQWDUH EHUVDJOL PROHFRODUL GD XWLOL]]DUH D VFRSR
GLDJQRVWLFRSHUXQDSUHGL]LRQHSUHFRFHGHOO¶HYROX]LRQHGHOO¶HSDWLWH
3DUWLFLSDQW1R
3DUWLFLSDQW1DPH
&RXQWU\
/080XQLFK
*HUPDQ\
/XGZLJ0D[LPLOLDQV8QLYHUVLW\±0XQLFK
,QVHUP7UDQVIHUW
0HGL]LQLVFKH+RFKVFKXOH+DQQRYHU
)XQGDFLRQSDUDOD,QYHVWLJDFLRQ0HGLFD$SOLFDGD
8QLYHUVLWpGH*HQqYH
7KH8QLYHUVLW\RI%LUPLQJKDP
,PSHULDO &ROOHJH RI 6FLHQFH 7HFKQRORJ\ DQG
0HGLFLQH
,QVWLWXW 1DWLRQDO GH OD 6DQWp HW GH OD 5HFKHUFKH
0pGLFDOH
0RVDLTXHV'LDJQRVWLFV*P%+60(
+ROGLQJ &RPSDQ\ )RU %LRORJLFDO 3URGXFWV DQG
9DFFLQHV
,7
)UDQFH
0++DQQRYHU
*HUPDQ\
8QLYHUVLWDHWV.OLQLNXP)UHLEXUJ
8./)5
*HUPDQ\
$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGL3DUPD
$=263$
,WDO\
),0$
6SDLQ
81,*(
6ZLW]HUODQG
8R%
8QLWHG.LQJGRP
,PSHULDO
8QLWHG.LQJGRP
,QVHUP
)UDQFH
026
*HUPDQ\
9$&6(5$
(J\SW
3DUWLFLSDQW6KRUW1DPH
5LFHUFDHLQQRYD]LRQH
3URJHWWR+HSD&XWHFROODERUD]LRQLFRQ$]LHQGHLVWLWXWLGHOO¶8QLRQH(XURSHD
3DUWLFLSDQW1R
3DUWLFLSDQW1DPH
1DWLRQDO/LYHU,QVWLWXWH0HQRXIL\D8QLYHUVLW\
1DWLRQDO5HVHDUFK&HQWHU
+RVSLFHV&DQWRQDX[&+89/DXVDQQH
8QLYHUVLWDHW]X.RHOQ±8QLYHUVLWDHWV.OLQLNXP
,QVWLWXW3DVWHXU'X0DURF
3DUWLFLSDQW6KRUW1DPH
&RXQWU\
1/,
(J\SW
15&
(J\SW
/&+89
6ZLW]HUODQG
8../
*HUPDQ\
,30
0RURFFR
)5$,/20,&
/¶LQYHFFKLDPHQWRFRVWDQWHGHOODSRSROD]LRQHSUHYLVWRQHLSURVVLPLGHFHQQLVDUjDFFRPSDJQDWR
GD XQ FRQVLGHUHYROH QXPHUR GL VRJJHWWL DIIHWWL GD SDWRORJLH H GLVDELOLWj GL YDULR JHQHUH /D
GLVDELOLWjqGLVROLWRSUHFHGXWDGDXQDFRQGL]LRQHGHQRPLQDWD³IUDJLOLWj´GDOO¶LQJOHVH³IUDLOW\´
FKH FRPSUHQGH FDPELDPHQWL DVVRFLDWL DG LQYHFFKLDPHQWR VWLOH GL YLWD H PDODWWLH FURQLFKH $O
ILQHGLSUHGLVSRUUHLQWHUYHQWLHIILFDFLGLSROLWLFDVDQLWDULDqGLHVWUHPDLPSRUWDQ]DSUHYHQLUHOD
GLVDELOLWjLQTXDQWRXQUHFXSHUR IXQ]LRQDOHGDTXHVWDFRQGL]LRQHqLPSUREDELOH6WXGLUHFHQWL
VRWWROLQHDQRO¶RSSRUWXQLWjGLLPSOHPHQWDUHO¶DWWXDOHGHILQL]LRQHFOLQLFDGLIUDJLOLWjLQWHUPLQLGL
SUHYLVLRQH GHO ULVFKLR YDOLGLWj GLDJQRVWLFD H VLJQLILFDWR SURJQRVWLFR H LQGLYLGXDQR YDOXWD]LRQL
LQQRYDWLYHHGLQWHJUDWHFRQFULWHULFOLQLFLHELRPDUFDWRUL
1HO *HQQDLR q VWDWR DWWLYDWR SUHVVR O¶82 GL 'LDJQRVWLFD (PDWRFKLPLFD LO 3URJHWWR
)5$,/20,&ILQDQ]LDWRGDOOD&RPXQLWj(XURSHDFKHSUHYHGHODSDUWHFLSD]LRQHFROODERUDWLYDGL
*UXSSL GL 5LFHUFD SURYHQLHQWL GD SL GL GLYHUVL 3DHVL (XURSHL ,O 3URJHWWR GL GXUDWD
TXLQTXHQQDOH q YROWR DOOD ULFHUFD LGHQWLILFD]LRQH H YDOLGD]LRQH FOLQLFD GL PDUFDWRUL ELRORJLFL
SUHGLWWLYLGL³IUDLOW\´LQWHVDFRPHGHFDGLPHQWRIXQ]LRQDOHQHOO¶DQ]LDQR'XUDQWHO¶DQQRD
VHJXLWR GL DOFXQL PHHWLQJ LQWHUQD]LRQDOL SURJUDPPDWL GDO &HQWUR &RRUGLQDWRUH GHO 3URJHWWR
6HUYLFLR 0DGULOHQR GH 6DOXG H GL QXPHURVL FRQWDWWL IUD L GLYHUVL SDUWQHU q VWDWR GHILQLWR XQ
SDQQHOORLQWHJUDWRGLGLIIHUHQWLELRPDUFDWRULFKHLOODERUDWRULRGL3DUPDHVHJXLUjVXFDPSLRQLGL
FRRUWL HXURSHH GXUDQWH OD IDVH GHOOR VWXGLR SUHYLVWD QHOO¶DQQR 4XHVWR SDQQHOOR
FRPSUHQGHUj PDUFDWRUL IORJLVWLFL GHOO¶LPPXQLWj LQQDWD GHOO¶DXWRLPPXQLWj RUPRQDOL H
SDUDPHWULELRFKLPLFLOHJDWLDOODSUHGL]LRQHGLULVFKLRFDUGLRYDVFRODUH
$OO¶$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGL3DUPDqDIILGDWRLOUXRORGL3DUWQHUVFLHQWLILFRQFRQ
5HVSRQVDELOH6FLHQWLILFRLO'LUHWWRUHGHOOD82'LDJQRVWLFD(PDWRFKLPLFD
/DYDOLGD]LRQHGDSDUWHGLTXHVWR&RQVRU]LR,QWHUQD]LRQDOHGL5LFHUFDGLXQSURILORLQWHJUDWRGL
GLIIHUHQWLELRPDUFDWRULGLODERUDWRULRHFOLQLFLVLWUDGXUUjLQXQDVLJQLILFDWLYDULFDGXWDFOLQLFDHG
HFRQRPLFD VXL 6LVWHPL 6DQLWDUL LQ WHUPLQL GL QXRYL PRGHOOL SUHGLWWLYL GLDJQRVWLFL H SURJQRVWLFL
DSSOLFDELOL LQ DPELWR FOLQLFRDVVLVWHQ]LDOH SHU OD SUHYHQ]LRQH GHOOD IUDJLOLWj H GHO GHFOLQR
IXQ]LRQDOHQHOO¶DQ]LDQR
3URJHWWR)5$,/20,&FROODERUD]LRQLFRQ$]LHQGHLVWLWXWLGHOO¶8QLRQH(XURSHD
5LFHUFDHLQQRYD]LRQH
3DUWLFLSDQW1R
3DUWLFLSDQW1DPH
3DUWLFLSDQW6KRUW1DPH
6HUYLFLR0DGULOHQRGH6DOXG
:RUOG+HDOWK2UJDQL]DWLRQ
/LIH/HQJWK6/
/LIH/HQJWK
6SDLQ
<+<RXKHDOWK$%
<RX+HDOWK
6ZHGHQ
(YHUF\WH*0%+
(YHUF\WH
$XVWULD
6LVWHPDV*HQRPLFRV6/
0RVDLTXHV'LDJQRVWLFV*0%+
,QQRYDFLRQ 'HVDUUROOR < 7UDVIHUHQFLD GH
7HFQRORJLD6$
1LFKH6FLHQFH7HFKQRORJ\/7'
6(50$6
6SDLQ
:+2
6ZLW]HUODQG
6*
6SDLQ
0RVDLTXHV
*HUPDQ\
,'(75$
6SDLQ
167
8QLWHG.LQJGRP
8QLYHUVLW\RI%HGIRUGVKLUH
,'23
8QLWHG.LQJGRP
8QLYHUVLGDG$XWRQRPDGH0DGULG
8$0
6SDLQ
&HQWUH+RVSLWDOLHU8QLYHUVLWDLUHGH7RXORXVH
,QVWLWXW 1DWLRQ GH OD6DQWH HW GH OD5HFKHUFKH
0HGLFDOH,16(50
,VWLWXWR1D]LRQDOHGL5LSRVRH&XUDSHU$Q]LDQL
,15&$
$]LHQGD6DQLWDULDGL)LUHQ]H
&+87
)UDQFH
,16(50
)UDQFH
,15&$
,WDO\
$6)
,WDO\
&RXQWU\
3DUWLFLSDQW1R
3DUWLFLSDQW1DPH
3DUWLFLSDQW6KRUW1DPH
$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGL3DUPD
8QLYHUVLWDHW,QQVEUXFN
&DUGLII0HWURSROLWDQ8QLYHUVLW\
)ULHGULFK6FKLOOHU8QLYHUVLWDHW-HQD
8QLYHUVLWDWGH9DOHQFLD
&RXQWU\
$2835
,WDO\
8,%.
$XVWULD
&08QLY
8QLWHG.LQJGRP
-HQD
*HUPDQ\
89
6SDLQ
25$02'
/¶RQFRORJLD FOLQLFD VWD VXEHQGR XQD SURIRQGD WUDVIRUPD]LRQH UHVD SRVVLELOH GDOOD UHFHQWH
DFTXLVL]LRQHGLVRILVWLFDWHDSSDUHFFKLDWXUHGLGLDJQRVWLFDSHULPPDJLQLGLQXRYHPHWRGLFKHGL
DQDOLVL ELRPROHFRODUH H GL WHVW JHQRPLFL ILQDOL]]DWL DOOD VFRSHUWD GL ELRPDUNHU SUHGLWWLYL GL
DOJRULWPL PDWHPDWLFL H VWDWLVWLFL SHU OD PRGHOOD]LRQH GHOOD PDODWWLD H SHU OD VLPXOD]LRQH GHOOD
VXD HYROX]LRQH FOLQLFD GL SRWHQWL VWUXPHQWL LQIRUPDWLFL QHFHVVDUL SHU LO GDWD PLQLQJ H O¶DQDOLVL
GHL GDWL HWHURJHQHL GLVSRQLELOL LQ JUDQGL GDWDVHW 3DUDOOHODPHQWH L FOLQLFL QHOOD ORUR DWWLYLWj
TXRWLGLDQDULVHUYDQRVHPSUHSLLPSRUWDQ]DDOODSLDQLILFD]LRQHGHOWUDWWDPHQWRGLRJQLVLQJROR
SD]LHQWHDGHJXDWDPHQWHVXSSRUWDWRGDXQDPRGHOOD]LRQHSUHGLWWLYDODGGRYHJLjGLVSRQLELOH,O
SURJHWWR HXURSHR 2UD0RG SURJHWWR WULHQQDOH FRILQDQ]LDWR GDOOD 8( FRQ GDWD GL LQL]LR
VLLQVHULVFHSHUIHWWDPHQWHLQTXHVWR VFHQDULRLOSURJHWWRPLUDLQIDWWLDYHLFRODUH
GLUHWWDPHQWH OD WHFQRORJLD H OH VFRSHUWH VFLHQWLILFKH GDOOD ULFHUFD QHOOD SUDWLFD FOLQLFD
VYLOXSSDQGR XQ DPELHQWH ,&7 QXRYR PRGXODUH H LQWHJUDWR LQ JUDGR GL VXSSRUWDUH L
SURIHVVLRQLVWL QHOOD JHVWLRQH GL DVSHWWL FKLDYH QHOOD FXUD GHL SD]LHQWL DIIHWWL GD FDQFUR RUDOH ,O
SURJHWWR VL IRFDOL]]D VXOOD LQWHJUD]LRQH GL GDWL HSLGHPLRORJLFL H FOLQLFL GL OLQHH JXLGD
LQWHUQD]LRQDOL FKH UHJRODQR OH FROODERUD]LRQL VFLHQWLILFKH PXOWLGLVFLSOLQDUL H GL WHFQRORJLH
DOO
DYDQJXDUGLD FRPSUHVL OD PRGHOOD]LRQH OD VLPXOD]LRQH LQ VLOLFR H LO VXSSRUWR GHFLVLRQDOH
YROWR D SUHGLUH OD FRPSDUVD GL UHFLGLYH QHL SD]LHQWL DIIHWWL GD FDQFUR RUDOH JLj WUDWWDWL
FKLUXUJLFDPHQWH ,Q WDO PRGR 2UD0RG VRGGLVID OH SL XUJHQWL QHFHVVLWj FOLQLFKH H VRFLDOL OD
VFHOWD GHOOH PLJOLRUL RS]LRQL FOLQLFKH SHU TXDQWR ULJXDUGD LO WUDWWDPHQWR H LO IROORZXS OD
ULGX]LRQH GHOOH PRUELOLWj SRVWWUDWWDPHQWR H O¶DEEDWWLPHQWR GHL FRVWL SHU LO VLVWHPD VDQLWDULR
QD]LRQDOH %DVDWR VXL ULVXOWDWL GL XQ SUHFHGHQWH SURJHWWR HXURSHR ,&7 1HRPDUN
FRRUGLQDWRGDOOD$28GL3DUPD2UD0RGFRPELQHUjXQPRGHOORSUHGLWWLYRVYLOXSSDWRDSDUWLUH
GD GDWL HWHURJHQHL UDFFROWL H JHVWLWL QHO UHSRVLWRU\ GHO VLVWHPD VWUXPHQWL LQIRUPDWLFL SHU LO
VXSSRUWRGHFLVLRQDOHHODVLPXOD]LRQHLQVLOLFRXQD.QRZOHGJH$VVLVWHG9LVXDOL]DWLRQLQWHUDWWLYD
SHUIHWWDPHQWH LQ OLQHD FRQ LO SDUDGLJPD GHO 3D]LHQWH 'LJLWDOH XQ DPELHQWH GL ODYRUR
FROODERUDWLYRSHUVXSSRUWDUHLOSURFHVVRGHFLVLRQDOHPXOWL±GLVFLSOLQDUHXQDVRILVWLFDWDVXLWHSHU
O
DQDOLVLGHOOHLPPDJLQLGLDJQRVWLFKHXQGLVSRVLWLYRGLHVWUD]LRQHT57±3&5HODERQFKLSSHU
LO ULOHYDPHQWR UDSLGR SUHFLVR H TXDQWLWDWLYR GHL PDUFDWRUL JHQRPLFL LQFOXVL QHO PRGHOOR
1HOO¶DPELWRGHOSURJHWWRHXURSHRXQRVWXGLRFOLQLFRDGKRFFRQGRWWRLQTXDWWURRVSHGDOLSLORWD
HXURSHLPLUHUjDGLPRVWUDUHLWDQJLELOLEHQHILFLFOLQLFLRIIHUWLGD2UD0RG
3DUWLFLSDQW1R
3DUWLFLSDQW1DPH
3DUWLFLSDQW6KRUW1DPH
&RXQWU\
8QLYHUVLWjGHJOL6WXGLGL3DUPD
81,35
,WDO\
)UDXQKRIHU *HVHOOVFKDIW =XU )RHUGHUXQJ GHU
$QJHZDQGWHQ)RUVFKXQJ(9
)UDXQKRIHU
*HUPDQ\
670LFURHOHFWURQLFV65/
67,WDO\
,WDO\
67,&+7,1*98980&
980&
7KH1HWKHUODQGV
9HOWL .DLQRWRPHV (SL[HLULVHLV $QRQLPL (WDLUHLD
.HIDODLRX(SL[HLULPDWLNRQ
6LPPHWR[RQNDL(SHQGLVHRQ
9&,
*UHHFH
21(721(765/
2QH7R1HW
,WDO\
+(,15,&++(,1(81,9(56,7$(7
'8(66(/'25)
8'86
*HUPDQ\
7(.12/2*,$1787.,086.(6.86977
977
)LQODQG
5LFHUFDHLQQRYD]LRQH
3URJHWWR2UD0RGFROODERUD]LRQLFRQ$]LHQGHLVWLWXWLGHOO¶8QLRQH(XURSHD
*DUDQ]LHGLWUDVSDUHQ]D
$QDJUDIHGHOOD5LFHUFD
$ JDUDQ]LD GHOOD WUDVSDUHQ]D H WUDFFLDELOLWj GHOOD ULFHUFD OD $28 KD DGHULWR DQFKH QHO DOO¶$QDJUDIH UHJLRQDOH GHOOD 5LFHUFD $5(5 IRUQHQGR WXWWH OH LQIRUPD]LRQL ULFKLHVWH H
DVVLFXUDQGR OD TXDOLWj GHL GDWL UDFFROWL /¶LQVHULPHQWR H OD YDOLGD]LRQH GHL FRQWHQXWL QHO
GDWDEDVH$5(5VRQRVWDWLDFXUDGHOOD825LFHUFDH,QQRYD]LRQHFKHKDGDSSULPDLQGLYLGXDWR
JOL VWXGL HOHJJLELOL SDUWHQGR GDOOD GRFXPHQWD]LRQH GHO &RPLWDWR (WLFR UHSHULWR OH LQIRUPD]LRQL
QHFHVVDULH GDL GRFXPHQWL GLVSRQLELOL UHODWLYL DL VLQJROL VWXGL H LQILQH ULFKLHVWR FRQIHUPD DL
FRRUGLQDWRUL VFLHQWLILFL ,Q WDO PRGR VRQR VWDWH JDUDQWLWH TXDOLWj H FRPSOHWH]]D GHOOH
LQIRUPD]LRQL ULOHYDWH SHU WXWWL L SURJHWWL GL ULFHUFD DYYLDWL QHO ,O SURGRWWR GL TXHVWR
ODYRURFRQVHQWHODFRQRVFHQ]DGHOOHDWWLYLWjGLULFHUFDLQFRUVRQHOQRVWURRVSHGDOHHFRVWLWXLVFH
ODEDVHGDFXLSDUWLUHSHUGLIIRQGHUHHFRPXQLFDUHODULFHUFDVHFRQGROHPRGDOLWjVRSUDGHVFULWWH
FIUVH]LQH$WWLYLWjGHOO¶LQIUDVWUXWWXUDSHUODULFHUFDHO¶LQQRYD]LRQH
5LFHUFDHLQQRYD]LRQH
5HSRUWLVWLFD
&RPH QHJOL DQQL SUHFHGHQWL DQFKH QHO VRQR VWDWL GLIIXVL VXL VLWL LQWHUQHW H LQWUDQHW
D]LHQGDOLLUHSRUWWULPHVWUDOLUHODWLYLDOOHSXEEOLFD]LRQLGHLSURIHVVLRQLVWLGHOOD$28,OODYRURKD
ULFKLHVWRXQ¶DWWLYLWjFRVWDQWHGLLQWHUURJD]LRQHGHOOHEDQFKHGDWL,6,H3XE0HGHGLYHULILFDGHOOH
LQIRUPD]LRQLSHUHYLWDUHHUURULHRPLVVLRQLRPRQLPLHDWWULEX]LRQHDOOD82HUUDWDHFFHWHUD
(¶ VWDWR LQROWUH UHDOL]]DWR LO YROXPH FRQWHQHQWH OD UHSRUWLVWLFD DWWLYLWjGL ULFHUFD H SURGX]LRQH
VFLHQWLILFDGHLSURIHVVLRQLVWLGHOO¶$]LHQGDUHODWLYDDJOLDQQL&RPHQHOOHSUHFHGHQWL
HGL]LRQLLOYROXPHqFRPSRVWRGDXQDVH]LRQHGHGLFDWDDOOHSXEEOLFD]LRQLVFLHQWLILFKHHXQDDL
SURJHWWL GL ULFHUFD VXGGLYLVH SHU 'LSDUWLPHQWR H 6WUXWWXUH &RPSOHVVH , UHSRUW FRQWHQJRQR
JUDILFLHWDEHOOHFRVWUXLWLXWLOL]]DQGRXQVHWGLLQGLFDWRULGHVXQWLGDOODOHWWHUDWXUD VFHOWLSHUOD
ORUR IDFLOLWj GL UHSHULPHQWR GL HODERUD]LRQH H GL LQWHUSUHWD]LRQH /D SUHVHQWH HGL]LRQH
FRPSUHQGH XQ QXRYR LQGLFDWRUH ULOHYDQWH LO JUDGR GL SDUWHFLSD]LRQH FKH IRUQLVFH OD TXRWD GL
SURIHVVLRQLVWL FKH VRQR VWDWL FRLQYROWL LQ DWWLYLWj GL ULFHUFD FLRq KDQQR SXEEOLFDWR DOPHQR XQ
DUWLFRORQHOSHULRGRFRQVLGHUDWRRKDQQRSDUWHFLSDWRDGDOWUDDWWLYLWjGLULFHUFD7DOHLQGLFDWRUH
q O¶XQLRQH GL GXH ULOHYD]LRQL OD SULPD q UHODWLYD DOO¶LQWHUURJD]LRQH GHOOD EDQFD GDWL ,6, OD
VHFRQGD q IUXWWR GL XQ TXHVWLRQDULR RQOLQH DGDWWDWR GDOOD OHWWHUDWXUD FKH OD 5LFHUFD H
,QQRYD]LRQH KD PHVVR LQ DWWR GDO FRQ OR VFRSR GL ULOHYDUH OD SDUWHFLSD]LRQH GHL
SURIHVVLRQLVWL DOOH GLYHUVH DWWLYLWj GL ULFHUFD SRVVLELOL TXDOL LO UXROR DWWLYR QHOOD
SLDQLILFD]LRQHVYROJLPHQWRSXEEOLFD]LRQH
GL
VWXGL
OD
SDUWHFLSD]LRQH
D
IRUPD]LRQHDJJLRUQDPHQWR VX WHPDWLFKH FRQFHUQHQWL OD PHWRGRORJLD GHOOD ULFHUFD
SUHVHQWD]LRQL D FRQYHJQL DWWLYLWj GL GLYXOJD]LRQH VFLHQWLILFD HFFHWHUD ,O JUDGR GL DGHVLRQH D
WDOHLQGDJLQHqVWDWRJOREDOPHQWHGHOFRQULVSRQGHQWLVXJUDILFRH
,QJHQHUDOHO¶DQDOLVLGHOOHLQIRUPD]LRQLUDFFROWHHYLGHQ]LDLQROWUHXQWUHQGLQLQFUHPHQWRGHOOD
SURGX]LRQHVFLHQWLILFDGHOO¶$]LHQGDDVVRFLDWRDXQPLJOLRUDPHQWRGHOODTXDOLWj7UDOHUDJLRQLGL
TXHVWLGDWLSRVLWLYLVLVRWWROLQHDLOFRVWDQWHLPSHJQRGHOOD5HJLRQH(PLOLD5RPDJQDFKHVWDQ]LD
DQQXDOPHQWH IRQGL GHGLFDWL DOOD ULFHUFD H O¶LPSXOVR IRUQLWR GDO %RDUG SHU OD 5LFHUFD H
O¶,QQRYD]LRQH FKH KD LQFRUDJJLDWR OD SDUWHFLSD]LRQH GL JLRYDQL ULFHUFDWRUL D EDQGL GL
ILQDQ]LDPHQWR SXEEOLFL H SURPRVVR OD FUHD]LRQH GL UHVHDUFK QHWZRUN FRQ SURIHVVLRQLVWL
GHOO¶$]LHQGDHGHOO¶8QLYHUVLWj
8QD VHFRQGD FRQVLGHUD]LRQH FKH HPHUJH GDOO¶DQDOLVLULJXDUGD OH VHL /LQHH GL ULFHUFD SUHYDOHQWL
GHOQRVWUR2VSHGDOHLGHQWLILFDWHJUD]LHDOO¶DQDOLVLGHLSUHFHGHQWLYROXPLGLDWWLYLWjHULOHYDWHQHO
3LDQRGHOOD5LFHUFDGHOO¶$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGL3DUPDFIUVFKHGD³/HDWWLYLWjHL
WHDP GL ULFHUFD LO 3LDQR ´ 7UD TXHVWH OD 0HGLFLQD 3HUVRQDOL]]DWD q VWDWD
LQGLYLGXDWD GDO &ROOHJLR GL 'LUH]LRQH TXDOH DUHD GL ULFHUFD SULRULWDULD LQ TXDQWR DPELWR GL
LQWHUHVVH WUDVYHUVDOH D WXWWL L 'LSDUWLPHQWL H LQ FRQVLGHUD]LRQH GHO VXR FDUDWWHUH DOWDPHQWH
LQQRYDWLYRHGHOSRWHQ]LDOHIRUWHLPSDWWRFKHLULVXOWDWLSRWUDQQRDYHUHQHOSURVVLPRIXWXURVX
XQD YDVWD JDPPD GL SD]LHQWL 7DOH VFHOWD q ULVXOWDWD YLQFHQWH LQ TXDQWR KD FRQVHQWLWR GL
5LFHUFDHLQQRYD]LRQH
RWWHQHUH XQ ILQDQ]LDPHQWR GL GXH SURJUDPPL GL ULFHUFD GL GXUDWD WULHQQDOH FKH FRLQYROJRQR
DXWRUHYROLJUXSSLGLULFHUFDDIIHUHQWLDOO¶2VSHGDOHHDOO¶8QLYHUVLWj
6LHYLQFHLQILQHODFDSDFLWjGHOO¶$]LHQGDGLIDUHULFHUFDXWLOL]]DQGRWXWWDODJDPPDGLDSSURFFL
GLVSRQLELOL GDOOD VSHULPHQWD]LRQH SUHFOLQLFD DJOL VWXGL FOLQLFL FRQWUROODWL DOO¶DQDOLVL
HSLGHPLRORJLFDILQRDOODULFHUFDVXLVHUYL]L4XHVWDFDSDFLWjYDSLHQDPHQWHVIUXWWDWDDOILQHGL
VRVWHQHUHODFUHVFLWDIXWXUDGHOOHFRPSHWHQ]HSHUDLXWDUHDULVSRQGHUHDGRPDQGHFKLDYHGHOOD
ULFHUFDHSHUDYHUHXQLPSDWWRSRVLWLYRVXOODVDOXWHHLOEHQHVVHUHGHOODSRSROD]LRQH
5LFHUFDHLQQRYD]LRQH
*UDILFR$WWLYLWjGLSURGX]LRQHVFLHQWLILFDDQQL
5LFHUFDHLQQRYD]LRQH
*UDILFR3URJHWWLGLULFHUFDVFLHQWLILFDDQQL
9DORUL]]D]LRQHGHOUXRORGHO&RPLWDWR(WLFR
³3HUFRUVRHODERUDWRLQPRGRFRPXQHGDOOHGXH$]LHQGHVDQLWDULH
5LFHUFDHLQQRYD]LRQH
,Q FRQIRUPLWj DOOD /HJJH H DO 'HFUHWR GHOO¶ IHEEUDLR q VWDWR LVWLWXLWR LO
&RPLWDWR (WLFR SHU 3DUPD FRQ 'HOLEHUD Q GHO OXJOLR GHO 'LUHWWRUH *HQHUDOH
GHOO¶$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGL3DUPDDVHJXLWRGLLQWHVDFRQO¶8QLYHUVLWjGHJOL6WXGL
GL3DUPDHO¶$]LHQGD86/GL3DUPD
1HOOD VHGXWD GL LQVHGLDPHQWR GHO VHWWHPEUH VRQR VWDWL HOHWWL LO 3UHVLGHQWH H LO
9LFHSUHVLGHQWH GHO &RPLWDWR HG q VWDWD SUHVHQWDWD OD QXRYD VHJUHWHULD WHFQLFRVFLHQWLILFD
SRWHQ]LDWD FRQ O¶DFTXLVL]LRQH GL XQ JLXULVWD DO ILQH GL IDYRULUH OD UDSLGD VRWWRVFUL]LRQH GHOOH
FRQYHQ]LRQLFRQOHLQGXVWULHSULYDWHHDJHYRODUHO¶LWHUGLDXWRUL]]D]LRQHDOO¶DYYLRGHOORVWXGLR
,O &RPLWDWR (WLFR SHU 3DUPD ULVXOWD FRPSRVWR GD PHPEUL HVSHUWL LQ GLYHUVH GLVFLSOLQH
VFLHQWLILFKH FKH SRVVRQR DYYDOHUVL GL FRQVXOHQWL HVWHUQL LQGLYLGXDWL DG KRF D VHFRQGD GHOOH
SUREOHPDWLFKHDIIURQWDWH
'LVHJXLWRVLULSRUWDODFRPSRVL]LRQHGHO&RPLWDWR(WLFRSHU3DUPDFRHUHQWHFRQLUHTXLVLWLGHO
VXGGHWWR'HFUHWR
• &OLQLFL
• (VSHUWRLQGLVSRVLWLYLPHGLFL
• 0HGLFRGLPHGLFLQDJHQHUDOH
• 5DSSUHVHQWDQWHDUHDGHOOHSURIHVVLRQLVDQLWDULH
• )DUPDFLVWDGHO665
• 'HOHJDWR'LUHWWRUH6DQLWDULR$]2VS8QLY
• (VSHUWRLQQXWUL]LRQH
• %LRVWDWLVWLFR
• )DUPDFRORJR
• 0HGLFR/HJDOH
• (VSHUWRLQ%LRHWLFD
• 5DSSUHVHQWDQWHGHL3D]LHQWL
• 'HOHJDWR'LUHWWRUH6DQLWDULR$]LHQGD86/
• (VSHUWRLQQXRYHWHFQRORJLH
• (VSHUWRDUHDPHGLFRFKLUXUJLFDSHU'0
• 9LFH3UHVLGHQWH3HGLDWUD
• 3UHVLGHQWH(VSHUWRLQJHQHWLFD
&RPSOHVVLYDPHQWHQHOVRQRVWDWLYDOXWDWLGDO&RPLWDWR(WLFRSURWRFROOLGLULFHUFDGL
FXLILQDQ]LDWLGDVSRQVRUSULYDWLYHGLWDEHOOD
7DEHOOD6WXGLYDOXWDWLGDO&RPLWDWR(WLFRVXGGLYLVLSHUWLSRORJLDHVSRQVRU
$QQR
6WXGLYDOXWDWLGDO
&RPLWDWR(WLFR
7RWDOH
3URILW
1R3URILW
6SHULPHQWD]LRQLFRQ
IDUPDFR
'/JV
6SHULPHQWD]LRQLFRQ
'LVSRVLWLYL0HGLFL
6WXGLVHQ]DIDUPDFLHV
VSHULPHQWD]LRQL
FKLUXUJLFKH
6WXGLRVVHUYD]LRQDOL
6WXGLGLJHQHWLFD
727$/(
1HOODVHJXHQWHWDEHOODWDEHOODVRQRLQGLFDWLLOQXPHURGLSURJHWWLLQFXL3DUPDqFHQWURGL
FRRUGLQDPHQWR H FKH SHUWDQWR KDQQR ULFKLHVWR OD IRUPXOD]LRQH GL XQ 3DUHUH 8QLFR 38
&RPSOHVVLYDPHQWH q VWDWR HVSUHVVR SDUHUH IDYRUHYROH SHU SURJHWWL VXL YDOXWDWL 6RQR
VWDWLLQROWUHYDOXWDWLHPHQGDPHQWLVRVWDQ]LDOLHSUHVHG¶DWWR
7DEHOOD6WXGLFRQ3DUHUH8QLFR
$QQR
3DUHUH8QLFLHVSUHVVLSHUWLSRORJLDGLVWXGLR
1ƒ
6SHULPHQWD]LRQLFRQIDUPDFR'/JV
6SHULPHQWD]LRQLFRQ'LVSRVLWLYL0HGLFL
6WXGLVHQ]DIDUPDFLHVVSHULPHQWD]LRQLFKLUXUJLFKH
6WXGLRVVHUYD]LRQDOL
6WXGLGLJHQHWLFD
727$/(
5LFHUFDHLQQRYD]LRQH
'XUDQWH LO VRQR VWDWL LQROWUH DGRWWDWL GLYHUVL GRFXPHQWL SURSUL GHO &RPLWDWR TXDOL
5HJRODPHQWR3URFHGXUH2SHUDWLYH6WDQGDUGFRQDOOHJDWHOH&KHFN/LVWSHUJOL6SHULPHQWDWRUL
,VWUX]LRQH 2SHUDWLYD 8VL &RPSDVVLRQHYROL 0RGXOR GL $VVXQ]LRQH GL 5HVSRQVDELOLWj GHOOR
6SHULPHQWDWRUH
,OQXRYR&RPLWDWRKDLVWLWXLWRDOWUHVuGHLJUXSSLGLODYRURFKH DYUDQQRLOFRPSLWRGLHODERUDUH
GHL GRFXPHQWL GL LQGLUL]]R GD SXEEOLFDUH VXO VLWR GHO &RPLWDWR (WLFR FRQVXOWDELOH GDJOL
6SHULPHQWDWRUL H GDL 3URPRWRUL VXOOH VHJXHQWL WHPDWLFKH ³6SHULPHQWD]LRQH H 3DUL
RSSRUWXQLWj´ ³6WXGL VSHULPHQWDOL FRQ VRJJHWWL LQFDSDFL´ ³)DUPDFRJHQHWLFD H
)DUPDFRJHQRPLFD´³/LQHH*XLGDSHUODYDOXWD]LRQHGLVWXGLGLWLSRRVVHUYD]LRQDOH´
5LFHUFDHLQQRYD]LRQH
2ELHWWLYLVSHFLILFLGL
SDUWLFRODUHULOHYDQ]D
LVWLWX]LRQDOH
,O VHWWLPR FDSLWROR LQWHQGH IRUQLUH LQIRUPD]LRQL
VXOO¶DWWLYLWj LVWLWX]LRQDOH VYROWD SHU LO SHUVHJXLPHQWR GL
RELHWWLYLVSHFLILFLHGLSDUWLFRODUHULOHYDQ]DSHUO¶$]LHQGD
PDDQFKHSHULOFRQWHVWRWHUULWRULDOHGLULIHULPHQWRHSHU
LO VLVWHPD UHJLRQDOH 1HO FRUVR GHO VRQR GXH JOL
RELHWWLYL GL PDJJLRU ULOLHYR H GL FXL GLDPR FRQWR LQ
TXHVWRFDSLWROR
•
5LRUJDQL]]D]LRQHGHOO¶RIIHUWDDVVLVWHQ]LDOH
QHOO¶$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGL
3DUPD
•
$OWULSHUFRUVLRUJDQL]]DWLYL
2ELHWWLYLVSHFLILFLGLSDUWLFRODUHULOHYDQ]DLVWLWX]LRQDOH
1HOO¶DPELWR GHOOD UHDOWj VDQLWDULD GHO QRVWURWHPSR VRQR DYYHQXWL H VWDQQR DYYHQHQGR FDPELDPHQWL SHU
FXL GD XQD SDUWH VL DVVLVWH DG XQD VHPSUH FUHVFHQWH FRPSOHVVLWj FOLQLFRDVVLVWHQ]LDOH GHL SD]LHQWL
VRJJHWWLµIUDJLOL¶VSHVVRSOXULSDWRORJLFLHXOWUDVHWWDQWDFLQTXHQQLHDXQ¶HYROX]LRQHWHFQRORJLFDFKHQHJOL
XOWLPLDQQLKDYLVWRXQRVYLOXSSRQRWHYROHVRSUDWWXWWRLQDPELWRFKLUXUJLFRHLQWHUYHQWLVWLFRHGDOO¶DOWUD
VL UHJLVWUD XQ FDOR GHOOH ULVRUVH FRQ FRQVHJXHQWH QHFHVVLWj GL PDJJLRUH IOHVVLELOLWj QHO ORUR XWLOL]]R Ê
GLYHQWDWD SHUWDQWR LQGLVSHQVDELOH XQD ULHODERUD]LRQH GHOO¶DVVLVWHQ]D RVSHGDOLHUD QRQ SL OLPLWDWD D
VLQJROLVHWWRULPDFRQLOFRLQYROJLPHQWRGHOO¶RVSHGDOHQHOODVXDJOREDOLWjDOILQHGLRWWLPL]]DUHOHULVRUVH
GLVSRQLELOLPDQRQYHQHQGRPHQRDJOLRELHWWLYLGLHIILFDFLDTXDOLWjHGHIILFLHQ]DFDUDWWHULVWLFLGHOQRVWUR
VLVWHPDVDQLWDULR
'DO O¶$28 GL 3DUPD KD LQL]LDWR XQ SURFHVVR GL WUDVIRUPD]LRQH EDVDWR VXOOD SURJHWWD]LRQH
GHOO¶RVSHGDOH RUJDQL]]DWR SHU LQWHQVLWj GL FXUD XQ PRGHOOR LQ FRQWLQXLWj FRQ XQ JHQHUDOH FDPELDPHQWR
GHOO¶RVSHGDOHFDUDWWHUL]]DWRVHPSUHSLFRPHOXRJRGLFXUDGHOOHDFX]LH$OO¶LQL]LRLOSURJHWWRqSDUWLWRLQ
PDQLHUD VSHULPHQWDOH DOO¶LQWHUQR GHOO¶DUHD VSHFLDOLVWLFD RUWRSHGLFD q VWDWR DYYLDWR XQ DQDORJR SURJHWWR
ULRUJDQL]]DWLYR DOO¶LQWHUQR GHO 1XRYR 2VSHGDOH GHL %DPELQL LQDXJXUDWR DOO¶LQL]LR GHO H DO TXDOH q
VWDWRGHGLFDWRLOFDSLWRORGHO%LODQFLRGL0LVVLRQH
,Q PDQLHUD JUDGXDOH WDOH PRGDOLWj GL ULRUJDQL]]D]LRQH RVSHGDOLHUD
LQWHUHVVHUj O¶LQWHUR RVSHGDOH ,O SURJHWWR ULRUJDQL]]DWLYR D]LHQGDOH q
VWDWRGHQRPLQDWRSURJHWWR³0DNHLQ3DUPD´
0$.(,13$50$,FDPELDPHQWLHLQXRYLIDEELVRJQL
RUJDQL]]DWLYL
,O 3URJHWWR 0DNH LQ 3DUPD LQWURGXFH XQD YLVLRQH QXRYD GHOO¶RVSHGDOH
SHU OD VXD PRGHUQL]]D]LRQH LQ WHUPLQL GL RUJDQL]]D]LRQH GHJOL DVVHW
SURGXWWLYLGHOORVYLOXSSRGLORJLFKHHSUDVVLGLNQRZOHGJHPDQDJHPHQW
H GL GLVHDVH PDQDJHPHQW 0ROWL VRQR L FDPELDPHQWL FKH SURGXFRQR QXRYL IDEELVRJQL RUJDQL]]DWLYL
GHOO¶RVSHGDOHWUDFXL
•
PRGLILFD]LRQLGHPRJUDILFKHGHOODSRSROD]LRQH FRQ SURJUHVVLYR LQYHFFKLDPHQWR H DXPHQWR GHOOH
PDODWWLHFURQLFKHHGHOOHSRWHQ]LDOLFRQGL]LRQLGLQRQDXWRVXIILFLHQ]DFKHFRPSRUWDQRODQHFHVVLWjGL
PRGLILFDUHLVHWWLQJDVVLVWHQ]LDOLHGLPLJOLRUDUHLOFRRUGLQDPHQWRWUDVSHFLDOLWjGLIIHUHQWLQHLSURFHVVL
GLHURJD]LRQHGHOOHSUHVWD]LRQL
•
HYROX]LRQH WHFQRORJLFD FKH JUD]LH DOOH QXRYH SRVVLELOLWj FKLUXUJLFKH H WHUDSHXWLFKH PRGLILFD OH
QHFHVVLWjDVVLVWHQ]LDOLHLSURFHVVLSURGXWWLYLWUDIDVLSUHRSHUDWRULHGLLQWHUYHQWRHSRVWDFX]LD
•
YLQFROL GL VSHVD FKH LPSRQJRQR XQD VWUDWHJLD GL VYLOXSSR SHU GHILQLUH OH SULRULWj D]LHQGDOL QHJOL
LQYHVWLPHQWLHQHOSRUWDIRJOLRGLDWWLYLWj
•
FDPELDPHQWL QHOOD GHPRJUDILD SURIHVVLRQDOH FKH HYLGHQ]LDQR WUHQG TXDOL OD SURJUHVVLYD
ULGX]LRQHQHOQXPHURGLPHGLFLHO¶LQYHFFKLDPHQWRGHOSHUVRQDOH
•
FRQLXJDUHULFHUFDHDVVLVWHQ]DLQGLYLGXDQGRVFKHPLRUJDQL]]DWLYLHIILFDFL
$WDOLFDPELDPHQWLHVRSUDJJLXQWHHVLJHQ]HO¶RUJDQL]]D]LRQHRVSHGDOLHUDGHYHULVSRQGHUHPHGLDQWH
LQWHJUD]LRQH H XVR IOHVVLELOH GHOOH ULVRUVH VDOH RSHUDWRULH SRVWL OHWWR DPEXODWRUL WHFQRORJLH
HFFHWHUD
LGHQWLILFD]LRQHGLVHWWLQJDVVLVWHQ]LDOLGLYHUVLILFDWLHFRHUHQWLFRQLQXRYLELVRJQL
LQWHJUD]LRQHGHLSURIHVVLRQLVWLLQRWWLFDPXOWLGLVFLSOLQDUHQHOULVSHWWRGHOOHSURSULHVSHFLDOL]]D]LRQL
HFRPSHWHQ]H
VYLOXSSRHFRQGLYLVLRQHGHOOHFRPSHWHQ]HSURIHVVLRQDOLGHLPHGLFLDOO¶LQWHUQRGLJUXSSLVSHFLDOLVWLFL
LQWHJUD]LRQHIUDULFHUFDHDVVLVWHQ]D
LQWHJUD]LRQHWUDRVSHGDOHHUHWLWHUULWRULDOL
2ELHWWLYLVSHFLILFLGLSDUWLFRODUHULOHYDQ]DLVWLWX]LRQDOH
5LRUJDQL]]D]LRQH GHOO¶RIIHUWD DVVLVWHQ]LDOH QHOO¶$]LHQGD
2VSHGDOLHUR8QLYHUVLWDULDGL3DUPD
2ELHWWLYLVSHFLILFLGLSDUWLFRODUHULOHYDQ]DLVWLWX]LRQDOH
,WUHDVVLGHOQXRYRDVVHWWRRUJDQL]]DWLYR
1HOOD FRPSOHVVLWj GL JHVWLRQH GL XQ¶D]LHQGD
)LJXUD
VDQLWDULD VRQR VWDWH LGHQWLILFDWH WUH GLPHQVLRQL
OXQJROHTXDOLVLPXRYHLOPDQDJHPHQWLQRVSHGDOH
OD JHVWLRQH GHOOH FRQRVFHQ]H H GHOOH SHUVRQH
NQRZOHGJHPDQDJHPHQW
OD JHVWLRQH GHL SHUFRUVL GL FXUD GHL SD]LHQWL
GLVHDVHPDQDJHPHQW
OD JHVWLRQH GHOOH ULVRUVH SURGXWWLYH DVVHW
PDQDJHPHQWFIU)LJXUD)RQWH/HJD
5DSSRUWR2$6,±LQSUHVV
4XHVWH WUH GLPHQVLRQL VRQR VWUHWWDPHQWH FRUUHODWH
WUD ORUR H SUHVHQWDQR QXPHURVH DUHH GL
VRYUDSSRVL]LRQH PD VRQR FDUDWWHUL]]DWH GD ORJLFKH
JHVWLRQDOL VSHFLILFKH HVVH UDSSUHVHQWDQR L WUH DVVL
VXLVYLOXSSDUHODPRGHUQL]]D]LRQHGHOO¶RVSHGDOH
.QRZOHGJHPDQDJHPHQW
)RQWH/HJD5DSSRUWR2$6,±LQSUHVV
,O NQRZOHGJH PDQDJHPHQW ULXQLVFH OH DWWLYLWj FKH
FRQWUDGGLVWLQJXRQR LO ³FRUH EXVLQHVV´ GHOO¶D]LHQGD
QH GHILQLVFRQR LO SRVL]LRQDPHQWR H QH GHWHUPLQDQR OR VYLOXSSR IXWXUR 6L WUDWWD GHO JRYHUQR GL DWWLYLWj
VWUDWHJLFKH TXDOL OH VFHOWH GHL FDVH PL[ SURGXWWLYL H GHOOH DUHH GL VSHFLDOL]]D]LRQH OH VFHOWH GL
LQYHVWLPHQWRLQWHFQRORJLHLOSUHVLGLRGHOODTXDOLWjFOLQLFDODIRUPD]LRQHHODFUHVFLWDSURIHVVLRQDOHGHJOL
RSHUDWRUL,O³OXRJR´DOO¶LQWHUQRGHOTXDOHVLVYLOXSSDO¶DWWLYLWjGLNQRZOHGJHPDQDJHPHQWqLO'LSDUWLPHQWR
HDOO¶LQWHUQRGLHVVROH8QLWj2SHUDWLYHVXOODEDVHGHOOHLQGLFD]LRQLVWUDWHJLFKHIRUPXODWHGDO&ROOHJLRGL
'LUH]LRQH ,O 'LUHWWRUH GL 'LSDUWLPHQWR q UHVSRQVDELOH GL SDUWHFLSDUH DOOD GHILQL]LRQH GHOOH SROLWLFKH GL
IRUPD]LRQH FRQGLYLVLRQH GHOOH FRQRVFHQ]H H VYLOXSSR SURIHVVLRQDOH GHL SURIHVVLRQLVWL PHGLFL SL JLRYDQL
QRQFKp GHO PDQWHQLPHQWR GHOOD ³FOLQLFDO FRPSHWHQFH´ H GHOO¶DJJLRUQDPHQWR FRQWLQXR GHOOH SUDWLFKH
PHGLFKH /R VYLOXSSR GHO NQRZOHGJH PDQDJHPHQW SUHYHGH O¶LQGLYLGXD]LRQH H LO PRQLWRUDJJLR GL ³JUXSSL
GHO VDSHUH´ DOO¶LQWHUQR GL RJQL 8QLWD 2SHUDWLYD R WUDVYHUVDOPHQWH D SL 8822 DO ILQH GL DJJUHJDUH
SURIHVVLRQLVWL ³HVSHUWL´ GL GHWHUPLQDWH SDWRORJLH LQ JUDGR GL WUDVIHULUH OH FRPSHWHQ]H DYDQ]DWH DG DOWUL
SURIHVVLRQLVWLQHOODORJLFDGHOODFRQGLYLVLRQHGHLVDSHUL
$OO¶LQWHUQR GL RJQL JUXSSR GHO VDSHUH XQ SURIHVVLRQLVWD HVSHUWR YLHQH LQGLYLGXDWR FRPH
5HIHUHQWH5HVSRQVDELOHFRQLOFRPSLWRGLJDUDQWLUHDWWUDWWLYLWjHGLDVVHJQDUHLFDVLGDWUDWWDUHDLVLQJROL
SURIHVVLRQLVWLLQEDVHDOOHFRPSHWHQ]HVSHFLILFKHHDOOHQHFHVVLWjGLIRUPD]LRQH
3HU TXDQWR ULJXDUGD L ³JUXSSL GL VDSHUH´ D WLWROR HVHPSOLILFDWLYR VL SRVVRQR ULSRUWDUH OH HVSHULHQ]H
DYYLDWH LQ $]LHQGD TXDOL O¶DPEXODWRULR GHOOD SDWRORJLD GHOOD PDPPHOOD ,QROWUH VL DQQRYHUD OD UHFHQWH
HVSHULHQ]D QHOO¶DPELWR GHOOD VSHFLDOLWj RUWRSHGLFD DOO¶LQWHUQR GHOOD TXDOH VRQR VWDWL DWWLYDWL JUXSSL
VSHFLDOLVWLFL GL SDWRORJLDDSSDUDWR FKH DJJUHJDQR SURIHVVLRQLVWL DSSDUWHQHQWL D GLYHUVH XQLWj RSHUDWLYH
TXDOLILFDWLSHUODULVSRVWDFOLQLFDHLQWHUYHQWLVWLFD,FLQTXHJUXSSLDGRJJLLGHQWLILFDWLLQRUWRSHGLDVRQR
•
VSDOOD
•
DQFD
•
JLQRFFKLR
•
FDYLJOLDSLHGH
•
JRPLWRSROVRPDQR
,Q FRQVHJXHQ]D GL FLz OH GXH VWUXWWXUH RUWRSHGLFKH HVLVWHQWL KDQQR DYYLDWR DPEXODWRUL GL SDWRORJLD
FRQGLYLVLFRQOLVWDG¶DWWHVDXQLILFDWDSHUOHDWWLYLWjLQHOH]LRQH6LqVYLOXSSDWDLQROWUHLQWHJUD]LRQHWUDOH
GLYHUVH HTXLSH FKH FROODERUDQR QHOO¶DWWLYLWj DPEXODWRULDOH H VRQR FKLDPDWH D FRQGLYLGHUH L FULWHUL SHU
O¶LQVHULPHQWRGHLSD]LHQWLLQQRWDRSHUDWRULD
'LVHDVHPDQDJHPHQW
,O GLVHDVH PDQDJHPHQW UDSSUHVHQWD OD JHVWLRQH GHL SHUFRUVL FOLQLFL GHL SD]LHQWL IUHTXHQWHPHQWH
WUDVYHUVDOLDSLXQLWjRSHUDWLYHHGLSDUWLPHQWLLQXQDORJLFDGLLQWHJUD]LRQHRUJDQL]]DWLYDFHQWUDOLWjGHO
SD]LHQWHHFRQWLQXLWjGHOODSUHVDLQFDULFR,QROWUHWDOLORJLFKHVRQRIXQ]LRQDOLDOO¶LQWURGX]LRQHGLSURWRFROOL
GLULFHUFDFRPXQLHWUDVYHUVDOLDSLXQLWjRSHUDWLYH/RVWUXPHQWRSULQFLSHSHUO¶LQWURGX]LRQHGLORJLFKHGL
GLVHDVH PDQDJHPHQW H SHU JDUDQWLUH O¶DSSURSULDWH]]D O¶HIILFDFLD H OD VLFXUH]]D GHL SURFHVVL GL FXUD q OD
$VVHWPDQDJHPHQW
/¶DVVHW PDQDJHPHQW q ILQDOL]]DWR D UHQGHUH RWWLPDOH LO IXQ]LRQDPHQWR GHL SURFHVVL FKH VRWWRVWDQQR DOOH
DWWLYLWj GL DVVLVWHQ]D H FXUD JHVWHQGR LQ PDQLHUD LQWHJUDWD OH ULVRUVH ILVLFKH H ORJLVWLFKH DG HVHPSLR
SRVWLOHWWRWHFQRORJLHVDOHRSHUDWRULHDPEXODWRUL7DOHLQWHJUD]LRQHDYYLHQHSUHYDOHQWHPHQWHDOO¶LQWHUQR
GL 0DFUR $UHH FDUDWWHUL]]DWH GD ORJLFKH GL TXDOLWj HG HIILFLHQ]D VSHFLILFKH TXDOL DG HVHPSLR O¶DUHD
FKLUXUJLFD O¶DUHD PHGLFD O¶DUHD PDWHUQR LQIDQWLOH O¶DUHD SD]LHQWH IUDJLOH O¶DUHD HPHUJHQ]DXUJHQ]D
HFFHWHUDPDSRWUHEEHDQFKHHVVHUHWUDVYHUVDOHDSLDUHH
$WWUDYHUVROHSLDWWDIRUPHSURGXWWLYHVLGLVSLHJDLOSHUFRUVRILVLFRHORJLVWLFRGHOSD]LHQWHQHOO¶RVSHGDOH,Q
SDUWLFRODUHO¶RELHWWLYRGHOO¶DVVHWPDQDJHPHQWqPLJOLRUDUHODSURJUDPPD]LRQHODJHVWLRQHHLOFRQWUROORGL
WXWWH TXHOOH DUHH SURGXWWLYH DWWUDYHUVDWH GDO SD]LHQWH SHU ULFHYHUH FXUD H DVVLVWHQ]D /H ORJLFKH
2ELHWWLYLVSHFLILFLGLSDUWLFRODUHULOHYDQ]DLVWLWX]LRQDOH
UHDOL]]D]LRQH H O¶DSSOLFD]LRQH GHL 3'7$ (VVL VRQR IXQ]LRQDOL D LGHQWLILFDUH OH WLSRORJLH GL ELVRJQR GHL
SD]LHQWL H L SL DSSURSULDWL PRGHOOL GL SUHVD LQ FDULFR D PRQLWRUDUH OD YDULDELOLWj QHJOL DSSURFFL FOLQLFL
FRQGLYLGHQGRSUDWLFKHFOLQLFKHHGRUJDQL]]DWLYHDSSURSULDWHDULGXUUHOHFULWLFLWjUHODWLYHDOFRRUGLQDPHQWR
WUD GLYHUVH XQLWj RUJDQL]]DWLYH WHPSL GL DWWHVD GXSOLFD]LRQL FROOL GL ERWWLJOLD HFFHWHUD D GHILQLUH
VWUXPHQWLGLFRPXQLFD]LRQHQHLFRQIURQWLGHLSD]LHQWLHGHOOHORURDVVRFLD]LRQL
'DO SXQWR GL YLVWD RSHUDWLYR LQ GLYHUVH HVSHULHQ]H LQWHUQD]LRQDOL H QD]LRQDOL YHQJRQR LGHQWLILFDWL
FRRUGLQDPHQWLWUDVYHUVDOLQHOODIRUPDGLOLQHHGLSURGRWWRHVHPSLSRVVRQRHVVHUHXQFDQFHUFHQWHUHDO
VXR LQWHUQR LO FRRUGLQDPHQWR GHL SURIHVVLRQLVWL FKH LQWHUYHQJRQR QHO SHUFRUVR GL FXUD GHOOH VSHFLILFKH
QHRSODVLHFRORQUHWWRPDPPHOODHFFHWHUDXQDVWURNHXQLWHFFHWHUD
,Q $28 YHQJRQR LGHQWLILFDWL JUXSSL GL SURIHVVLRQLVWL DSSDUWHQHQWL D GLYHUVH XQLWj RSHUDWLYH FKH KDQQR
UHVSRQVDELOLWj GL GHILQL]LRQH PRQLWRUDJJLR H FRQWUROOR GHO 3'7$ H FKH GHFOLQDQR WDOL SHUFRUVL FOLQLFR
DVVLVWHQ]LDOL DOO¶LQWHUQR GHL SHUFRUVL ORJLVWLFL LQGLFDQGR FRQVHJXHQWHPHQWH LO IDEELVRJQR GL XWLOL]]R GHOOH
SLDWWDIRUPH DVVHW , SURIHVVLRQLVWL FRLQYROWL QHL SHUFRUVL VYLOXSSDQR TXLQGL VLD JOL DVSHWWL FOLQLFR
DVVLVWHQ]LDOL FKH TXHOOL SL VWUHWWDPHQWH RUJDQL]]DWLYRJHVWLRQDOL , SHUFRUVL FKH DEELDPR GHILQLWR
³FOLQLFRORJLVWLFL´ KDQQR QHFHVVLWj GL HVVHUH VWUXWWXUDWL H SUHVLGLDWL SHU WXWWH OH VSHFLDOLWj DWWUDYHUVR
O¶LQGLFD]LRQHSUHFLVDGHOOHULVRUVHFKHGHYRQRHVVHUHIRUQLWHDOLYHOORGHOOH³SLDWWDIRUPHDVVLVWHQ]LDOL´
&RPHUHIHUHQWHGLRJQLJUXSSRqLGHQWLILFDWRXQSURIHVVLRQLVWDGHOO¶D]LHQGDQRQQHFHVVDULDPHQWHWLWRODUH
GLXQLQFDULFRGLGLUH]LRQHGLXQLWjRSHUDWLYDDFXLDIIHULVFRQRIXQ]LRQDOPHQWHJOLDOWULDWWRULGHOSURFHVVR
VHQ]DSHUzPRGLILFDUHO¶LPSLDQWRRUJDQL]]DWLYRJLjGHILQLWRVXOOHXQLWjRSHUDWLYHGLSDUWLPHQWL
3HUTXDQWRULJXDUGDL³SHUFRUVLFOLQLFRORJLVWLFL´DWLWRORHVHPSOLILFDWLYRqVWDWDRSHUDWDXQDVLPXOD]LRQH
GHOSHUFRUVRGHOO¶,FWXVLVFKHPLFRFRQUHODWLYRVFKHPDULHSLORJDWLYR
2ELHWWLYLVSHFLILFLGLSDUWLFRODUHULOHYDQ]DLVWLWX]LRQDOH
VRWWRVWDQWL TXLQGL QRQ IDQQR ULIHULPHQWR D GHWHUPLQDWL SUREOHPL GL FXUDSDWRORJLH PD D FDWHJRULH
RPRJHQHH GL SD]LHQWL FKH FRQGLYLGRQR XQ LGHQWLFR SHUFRUVR ORJLVWLFRRUJDQL]]DWLYR DWWUDYHUVR OH
SLDWWDIRUPHGHOO¶D]LHQGD1HOODSURVSHWWLYDGHOO¶DVVHWPDQDJHPHQWOHSLDWWDIRUPHSURGXWWLYHSRVWLOHWWR
WHFQRORJLH VDOH RSHUDWRULH DPEXODWRUL QRQ VRQR SL DVVHJQDWH DG XVR HVFOXVLYR GL XQ GLSDUWLPHQWR R
XQLWjRSHUDWLYDPDVRQRLOSLSRVVLELOHJHVWLWHLQFRQGLYLVLRQH,QWDOHPRGHOORGLJHVWLRQHGHOOHULVRUVHq
SHUWDQWRULFRPSUHVDDQFKHO¶LQQRYD]LRQHQHLVHWWLQJDVVLVWHQ]LDOLSHUFXLODWUDGL]LRQDOHJHVWLRQHGHLSRVWL
OHWWR EDVDWD VXOOH VSHFLDOLWj FOLQLFKH YLHQH LQWHJUDWD GD ORJLFKH DOWHUQDWLYH TXDOL O¶LQWHQVLWj DVVLVWHQ]LDOH
FRQ OD GLVWLQ]LRQH GL UHSDUWL GL KLJK FDUH GHJHQ]D RUGLQDULD D DOWD H PHGLD LQWHQVLWj SRVW DFX]LH OD
GXUDWDDWWHVDGHOULFRYHURDGHVHPSLRLQDUHDFKLUXUJLFDYHQJRQRLQWURGRWWLVHWWRULPXOWLVSHFLDOLVWLFLTXDOL
'D\ 6XUJHU\ :HHN 6XUJHU\ +LJK &DUH L ELVRJQL RPRJHQHL GHL SD]LHQWL DG HVHPSLR SHULFKLUXUJLFL R
SD]LHQWLIUDJLOLDEDVVDLQVWDELOLWjFOLQLFDPDDGDOWDFRPSOHVVLWjDVVLVWHQ]LDOHHFFHWHUDODVHSDUD]LRQH
WUDSHUFRUVLGHOSD]LHQWHLQHPHUJHQ]DHSHUFRUVLLQHOH]LRQH
7DOHPRGHOORULFKLHGHQHFHVVDULDPHQWHFKHDQFKHODOLQHDDVVLVWHQ]LDOHQRQVLVWUXWWXULSLLQIXQ]LRQHGHL
UHSDUWLVSHFLDOLVWLFLEHQVuLQUHOD]LRQHDOOHFDUDWWHULVWLFKHGHOOHDUHHRGHLVHWWRULQRQSLFRRUGLQDWRULGL
VSHFLDOLWj PD FRRUGLQDWRUL GL DUHH PRGXODWH SHU LQWHQVLWj GL FXUD TXDOL GD\VXUJHU\ GHJHQ]D EUHYH RG
RUGLQDULDRFKHDJJUHJDQRSLVSHFLDOLWj
,OSURJHWWR³0DNHLQ3DUPD´SUHYHGHO¶LVWLWX]LRQHGLILJXUHSURIHVVLRQDOLDOO¶LQWHUQRGHOODOLQHDDVVLVWHQ]LDOH
FRQ IXQ]LRQL GL JHVWLRQH GHOOH SLDWWDIRUPH DVVLVWHQ]LDOL VLD D OLYHOOR FHQWUDOH FKH D OLYHOOR SHULIHULFR 7DOL
IXQ]LRQL VDUDQQR VHPSUH DUPRQL]]DWH DOOH LQGLFD]LRQL VWUDWHJLFKH D]LHQGDOL LQ DFFRUGR FRQ OD 'LUH]LRQH
*HQHUDOHHFRQGLYLVHFRQLO&ROOHJLRGL'LUH]LRQH
$OLYHOORFHQWUDOHVLFROORFDQRDOO¶LQWHUQRGHOOD'LUH]LRQH0HGLFDGHOOHILJXUHGL³2SHUDWLRQV0DQDJHUV´WUD
FXLL%HGPDQDJHUSHUODJHVWLRQHGHOODSLDWWDIRUPDGHOOHGHJHQ]HD]LHQGDOLLJHVWRULGHOODSLDWWDIRUPDGL
VDODRSHUDWRULDLJHVWRULGHOODSLDWWDIRUPDDPEXODWRULDOHHGHOOHWHFQRORJLH
)XQ]LRQLGHJOL³2SHUDWLRQV0DQDJHU´FHQWUDOL
• JHVWLRQHSURJUDPPD]LRQHHFRQWUROORVHFRQGROHVWUDWHJLHD]LHQGDOLHOHHVLJHQ]HGHOOH8822
GHOOHSLDWWDIRUPHDVVLVWHQ]LDOLOHWWLVDOHRSHUDWRULHSLDWWDIRUPDDPEXODWRULDOHHGHOOHWHFQRORJLH
FKHVRQRDWWUDYHUVDWHGDOSD]LHQWHOXQJRLOVXRSHUFRUVRGLFXUD
• DQDOLVL GHOO¶XWLOL]]R GHOOH GLYHUVH SLDWWDIRUPH DWWLYDWH YHULILFDQGR OD ULVSRQGHQ]D DJOL VWDQGDUG
SURJUDPPDWL FRQ OD ILQDOLWj GL RWWLPL]]DUH OH ULVRUVH H GL DVVHJQDUH OH VWHVVH LQ UHOD]LRQH DOOH
QHFHVVLWjGHLSHUFRUVLGLSUHVDLQFDULFRGHOSD]LHQWH
• XWLOL]]R GL VWUXPHQWL JHVWLRQDOL TXDOL L VRIWZDUH $'7 GL 3URQWR VRFFRUVR GL 6DOD 2SHUDWRULD HG
HYHQWXDOL DOWUL GHILQLWL QHFHVVDUL DOOR VYROJLPHQWR GHOOH DWWLYLWj LQ TXDOLWj GL DPPLQLVWUDWRUL GL
VLVWHPDYHULILFDQGRODTXDOLWjGHOGDWRSURGRWWRHOHQXRYHLPSOHPHQWD]LRQLGDDGRWWDUH
• FROODERUD]LRQHHFRQIURQWRFRQLQWHUORFXWRULSHULIHULFLPHGLFLFRRUGLQDWRULHFFHWHUDQHOODULFHUFD
GLVWUDWHJLHPLUDWHDOPLJOLRUDPHQWRGHOO¶XWLOL]]RGHOOHSLDWWDIRUPH
• VXSSRUWRDLSHUFRUVLIRUPDWLYLOHJDWLDJOLHYHQWXDOLSURFHVVLGLULRUJDQL]]D]LRQH
/¶2SHUDWLRQ0DQDJHUGLVSRQHLQROWUHGLDOFXQLVWUXPHQWLRSHUDWLYLTXDOL
ODJHVWLRQHLQIRUPDWL]]DWDGHLSRVWLOHWWRFRQVHQWHSHURJQLUHSDUWRODPDSSDWXUDGLWXWWLLSRVWL
OHWWR UHDOL H O¶DOORFD]LRQH VXJOL VWHVVL GHL SD]LHQWL SUHVHQWL LQ UHSDUWR (¶ VWDWD DWWLYDWD LQ FLDVFXQ
UHSDUWRODGLVWLQ]LRQHWUDUHSDUWRORJLVWLFRHUHSDUWRGLULFRYHURIXQ]LRQDOHDOODFRVWLWX]LRQHGHOOH
SLDWWDIRUPH
ODJHVWLRQHLQIRUPDWL]]DWDGHOODGDWDSUHVXQWDGLGLPLVVLRQHGHLSD]LHQWLFRQVHQWHODYHULILFDGHOOD
GLPLVVLELOLWjGLFLDVFXQSD]LHQWHHLOPRQLWRUDJJLRGHOOHHYHQWXDOLPRWLYD]LRQLFKHQHRVWDFRODQRXQ
WUDVIHULPHQWRGLPLVVLRQHVWDQGDUG
,O³%('0$1$*(5´
,OEHGPDQDJHUSUHVLGLDGDXQODWRLOFRUUHWWRIXQ]LRQDPHQWRGHLIOXVVLGLSD]LHQWLLQRVSHGDOHHGDOO¶DOWUR
QHL VHWWLQJ RUJDQL]]DWL SHU LQWHQVLWj GL FXUD HR LQ DUHH FRPXQL PXOWLGLVFLSOLQDUL FRRUGLQD O¶DWWLYLWj GL
SURJUDPPD]LRQHHDOORFD]LRQHGHLSD]LHQWL
/¶RUJDQL]]D]LRQHVXWXWWRLOSUHVLGLRRVSHGDOLHURXQLYHUVLWDULRSUHYHGHODSUHVHQ]DGLEHGPDQDJHUDOLYHOOR
GHFHQWUDWRDOO¶LQWHUQRGHLGLYHUVLGLSDUWLPHQWLHGLXQFRRUGLQDPHQWRFHQWUDOL]]DWR
$±%HG0DQDJHU&(175$/(
,VXRLSULQFLSDOLFRPSLWLVRQR
• GHILQLUH L SURWRFROOL RSHUDWLYL FRQQHVVL DOO¶DFFHWWD]LRQHWUDVIHULPHQWRGLPLVVLRQH GHL SD]LHQWL H
YHULILFDUQHO¶DSSOLFD]LRQH
• FRRUGLQDUHL%HG0DQDJHUGL0DFURDUHD
• YHULILFDUHVLVWHPDWLFDPHQWHLULFRYHULFRQGHJHQ]D³DQRPDOD´
• UDFFRUGDUVL FRQ L UHIHUHQWL GHOOD UHWH SURYLQFLDOH LQ SDUWLFRODUH SHU OH SDWRORJLH PHGLFKH GL EDVVD
FRPSOHVVLWjFOLQLFD
• JHVWLUH OH GLPLVVLRQL FRPSOHVVH GHL SD]LHQWL DWWUDYHUVR LO UDFFRUGR FRQ L UHIHUHQWL GHOO¶$86/ SHU OH
VWUXWWXUHLQWHUPHGLHSHUL00*SHULVHUYL]LVRFLDOLHFFHWHUD
• JDUDQWLUH OD FRUULVSRQGHQ]D GL GLVSRQLELOLWj GHL SRVWL OHWWR FRQ O¶DFFHVVR DOOH DOWUH SLDWWDIRUPH
DVVLVWHQ]LDOLDGHVHPSLROHVDOHRSHUDWRULHUDSSRUWDQGRVLDQFKHFRQL%HGPDQDJHUGL0DFUR$UHD
UHDOL]]D]LRQHGHOOHDWWLYLWjSUHYLVWHVLDLQSURJUDPPDWRFKHLQXUJHQ]D
%±%HG0DQDJHUGLGHFHQWUDWLGL'LSDUWLPHQWR
,VXRLSULQFLSDOLFRPSLWLVRQR
• JDUDQWLUH OD FRUULVSRQGHQ]D GL GLVSRQLELOLWj GHL SRVWL OHWWR FRQ O¶DFFHVVR DOOH DOWUH SLDWWDIRUPH
DVVLVWHQ]LDOLDGHVHPSLRVDOHRSHUDWRULHYVSRVWLOHWWR
• JHVWLUH L SRVWL OHWWR GHOOD SLDWWDIRUPD DVVHJQDWD DO ILQH GL JDUDQWLUH OD UHDOL]]D]LRQH GHOOH DWWLYLWj
SUHYLVWHVLDLQSURJUDPPDWRFKHLQXUJHQ]D
• RWWLPL]]DUHLIOXVVLGLHQWUDWDHXVFLWDGHLSD]LHQWLDOO¶LQWHUQRGHOO¶DUHDVSHFLDOLVWLFDRGHO'LSDUWLPHQWR
GLULIHULPHQWRIDFLOLWDQGRLSURFHVVLGLULFRYHURHGLGLPLVVLRQHFROODERUDQGRFRQLOSHUVRQDOHPHGLFR
HG LQIHUPLHULVWLFR QHOOD GHILQL]LRQH GHL ELVRJQL GHO SD]LHQWH H QHOOD VFHOWD GHO VHWWLQJ DVVLVWHQ]LDOH
DSSURSULDWR
• JDUDQWLUHXQDDSSURSULDWDHVXIILFLHQWHGLVSRQLELOLWjGLSRVWLOHWWRSHUWXWWDODGRPDQGDSURYHQLHQWH
GDO 'LSDUWLPHQWR GL (PHUJHQ]D DQFKH DWWUDYHUVR LO JRYHUQR GHOOD SURJUDPPD]LRQH GHOO¶DWWLYLWj GL
ULFRYHUR
• RUJDQL]]DUHEULHILQJTXRWLGLDQLFRQWXWWLLUHVSRQVDELOLPHGLFLHLQIHUPLHULVWLFLDIIHUHQWLDOOHGLYHUVH
XQLWj DVVLVWHQ]LDOL GHOO¶DUHD VSHFLDOLVWLFD R GHO 'LSDUWLPHQWR SHU SLDQLILFDUH H DWWXDUH OH VWUDWHJLH
QHFHVVDULHDJDUDQWLUHODGLVSRQLELOLWjGLSRVWLOHWWRSHULULFRYHULFKLUXUJLFLHPHGLFLSURJUDPPDWLHLQ
XUJHQ]DSHUODJLRUQDWDHODJLRUQDWDVXFFHVVLYD
/DIXQ]LRQHYLHQH&RRUGLQDWDGDO%HG0DQDJHU&HQWUDOH
5LRUJDQL]]D]LRQHSHULQWHQVLWjGLFXUHGHOO¶DWWLYLWjVSHFLDOLVWLFDGLRUWRSHGLD
,O WUDGL]LRQDOH PRGHOOR VLQR DG RUD DGRWWDWR LQ $]LHQGD SUHVHQWD XQD VXGGLYLVLRQH LQ UHSDUWL EDVDWD VXOOD
GLVFLSOLQD GHL SURIHVVLRQLVWL FKH YL RSHUDQR 4XHVWR SUHVHQWD SUREOHPL GL FRRUGLQDPHQWR
QHOO
RUJDQL]]D]LRQH GHOO¶DVVLVWHQ]D GD IRUQLUH DO SD]LHQWH 3HU IDU IURQWH D FLz PROWH D]LHQGH VL VRQR
RULHQWDWH YHUVR PRGHOOL RUJDQL]]DWLYL IRFDOL]]DWL VXL SURFHVVL FKH SUHYHGRQR LO VXSHUDPHQWR GHL UHSDUWL
FRPH FRPSRQHQWH FKLDYH GHOOD JHVWLRQH GHOOD FDVLVWLFD GHJOL VSD]L GHOOH ULVRUVH H OD FUHD]LRQH GL XQ
QXRYRFRQWHQLWRUHO¶DUHDIXQ]LRQDOH8QPRGHOORFKHVHJXHTXHVWRRULHQWDPHQWRqTXHOORSHULQWHQVLWjGL
FXUHFKHqDWWXDWRLQPDQLHUDGLYHUVLILFDWDGDOOHD]LHQGHSHUFKpVRQRFRQGL]LRQDWHGDJOLDVSHWWLORJLVWLFR
RSHUDWLYL SUHHVLVWHQWL ,O SURJHWWR LQWHQGHYD IDU IURQWH DOO¶HVLJHQ]D GL LQWURGXUUH LQQRYD]LRQL FOLQLFR
RUJDQL]]DWLYHDSDUWLUHGDOO¶DUHDRUWRSHGLFDSHUODJHVWLRQHGHLSD]LHQWLDQ]LDQLGHOOHSDWRORJLHFURQLFKH
HGHOOHDUHHSHUOHTXDOLqQHFHVVDULRULPRGXODUHLSHUFRUVLDVVLVWHQ]LDOLDOILQHGLPLJOLRUDUHO¶LPSLHJRGHOOH
ULVRUVHJLjGLVSRQLELOLFRQVHSDUD]LRQHGHOSHUFRUVRGLXUJHQ]DWUDXPDWRORJLFDGDTXHOORHOHWWLYR
,O SURJHWWR PHWWH LQ DWWR XQD VWUDWHJLD DO ILQH GL JDUDQWLUH XQ¶DVVLVWHQ]D FRQWLQXD H EDVDWD VXOOH UHDOL
QHFHVVLWj GHL SD]LHQWL DWWUDYHUVR OD ULGHILQL]LRQH GHL SURFHVVL GL FXUD H GHOOH FRPSHWHQ]H
PXOWLSURIHVVLRQDOLHPXOWLGLVFLSOLQDULQHFHVVDULH
$ WDO ILQH RFFRUUH HOLPLQDUH LQQDQ]LWXWWR OH ULGRQGDQ]H GL DWWLYLWj LQ VWUXWWXUH DSSDUHQWHPHQWH GLIIHUHQWL
PD FKH GL IDWWR WUDWWDQR OH VWHVVH SDWRORJLH FRQVHQWHQGR XQD PDJJLRUH VSHFLDOL]]D]LRQH GHOO¶RIIHUWD
VDQLWDULD 6L DXVSLFD LQROWUH FKH OD ULRUJDQL]]D]LRQH GHOO¶DUHD RUWRSHGLFD FRQWULEXLVFD DO UHFXSHUR GHOOD
PRELOLWjSDVVLYDHDOO¶LQFUHPHQWRGHOO¶DWWUD]LRQHGLSD]LHQWLSURYHQLHQWLGDIXRULSURYLQFLD
$]LRQLLQWUDSUHVHLQUHOD]LRQHDJOLRELHWWLYL
3HUFRUVR GL VXGGLYLVLRQH WUDXPD HG HOH]LRQH DXPHQWR GHJOL LQWHUYHQWL FKLUXUJLFL LQ HOH]LRQH
GLPLQX]LRQHGHOWHPSRGLDWWHVDGLLQWHUYHQWRVXOODSDWRORJLDWUDXPDWLFD
¾ &RVWLWX]LRQHGLJUXSSLPXOWLGLVFLSOLQDULSHUDYYLRIRFXVJURXS
¾ &RQGLYLVLRQHGHOSURJHWWRFRQLQFRQWULVHPLQDULDXGLWFRQSHUVRQDOHLQWHUHVVDWR
¾ 3UHVHQWD]LRQHGHOSURJHWWRDRSHUDWRULVDQLWDULPDQDJHPHQWPDVVPHGLD
¾ 6HSDUD]LRQH6DOH2SHUDWRULHWUDXPDWRORJLDHGHOH]LRQH
¾ &UHD]LRQH ³JUXSSL GHO VDSHUH´ DPEXODWRULR VSDOOD DQFD JLQRFFKLR FDYLJOLDSLHGH JRPLWR
SROVRPDQR
¾ $YYLRVSHULPHQWD]LRQH³JHVWLRQHSRVWLOHWWR´HIXQ]LRQH%HG0DQDJHU
¾ 6HSDUD]LRQHORJLVWLFDGHLSHUFRUVLGLGHJHQ]DWUDXPDWRORJLFRHGHOHWWLYR
2ELHWWLYLVSHFLILFLGLSDUWLFRODUHULOHYDQ]DLVWLWX]LRQDOH
• JHVWLUH L SRVWL OHWWR GHOOH SLDWWDIRUPH HYHQWXDOPHQWH GLUHWWDPHQWH DVVHJQDWH DO ILQH GL JDUDQWLUH OD
¾ $GHJXDPHQWRIOXVVLLQIRUPDWLYLGD&G*DWWLYD]LRQHFHQWULGLFRVWRORJLVWLFRHFOLQLFR
3HUFRUVRRUJDQL]]DWLYRSHUODJHVWLRQHGHOSD]LHQWHSHULQWHQVLWjGLFXUDVHFRQGRLOPRGHOOR
LQIHUPLHULVWLFRGLPLQX]LRQHGHLWHPSLG¶DWWHVDGHLSD]LHQWLLQOLVWDRSHUDWRULDDGHVLRQHDLFULWHULGL
DPPLVVLRQHHGLPLVVLRQHSHUVSHFLDOLWjHGDLFULWHULGLSDVVDJJLRGDXQ¶LQWHQVLWjGLFXUDDGXQ¶DOWUD
PDJJLRUHVRGGLVID]LRQHGHLSURIHVVLRQLVWL
¾ ,QIRUPD]LRQH DL FRRUGLQDWRUL FRQ LQYLR ULYLVWD 0$36 FRQ GHVFUL]LRQH VWUXPHQWL3(59,1&$ 0$32
75,&2,&$HDQDOLVLLQFRUVRSHULPSOHPHQWD]LRQH,&&$
¾ 9LVLWD&RRUGLQDWRUL2VSHGDOHGL9LPHUFDWH
¾ 3UHVHQWD]LRQHSURJHWWRULRUJDQL]]D]LRQHDRUJDQL]]D]LRQLVLQGDFDOL
¾ ,QGDJLQHVRGGLVID]LRQHSURIHVVLRQLVWLDOƒDQQR
3HUFRUVRPXOWLGLVFLSOLQDUHGLSUHVDLQFDULFRGHOSD]LHQWHVRGGLVID]LRQHGHOSD]LHQWH
GLPLQX]LRQHGHLWHPSLGLULFRYHURSHUSDWRORJLDHGHLUHLQJUHVVL
¾ $YYLRSHUFRUVRRUWRJHULDWULFR
¾ 'HILQL]LRQHFULWHULFRVWLWX]LRQHOLVWHRSHUDWRULHXQLFKHSHUSDWRORJLHVSHFLILFKH
¾ ,QGDJLQH VRGGLVID]LRQH SD]LHQWL H GDWL WHPSL GL ULFRYHUR SHU SDWRORJLD H UHLQJUHVVL HQGSRLQW GD
YHULILFDUHDOƒDQQR
,QWHUYHQWLGLLPSOHPHQWD]LRQHGHOSURJHWWRDXPHQWRGHOODSHUIRUPDQFHGHLSURIHVVLRQLVWLPHGLFL
HGLQIHUPLHUL)RUPD]LRQHSHUJOLDVSHWWLGLJHVWLRQHSURJHWWR
2ELHWWLYLVSHFLILFLGLSDUWLFRODUHULOHYDQ]DLVWLWX]LRQDOH
$OWULSHUFRUVLGLULRUJDQL]]D]LRQH
,OSURJHWWR0DNHLQ3DUPDQRQHVDXULVFHWXWWDODSURJHWWXDOLWjHLOFDPELDPHQWRLQFRUVRLQ$]LHQGD7UDL
GLYHUVL SURJHWWL GL ULRUJDQL]]D]LRQH QH LOOXVWULDPR EUHYHPHQWH GXH FKH ULJXDUGDQR DPELWL GL SULPD OLQHD
QHOUDSSRUWRFRQLFLWWDGLQL$OWULVSXQWLVLSRVVRQRWURYDUHQHOFDSLWRORGHOYROXPH
5LRUJDQL]]D]LRQHGHOOHDWWLYLWjDVVLVWHQ]LDOLGHOO
DUHD2VWHWULFR*LQHFRORJLFD
/D ULRUJDQL]]D]LRQH GHOOH DWWLYLWj DVVLVWHQ]LDOL GL RVWHWULFLD H JLQHFRORJLD KD WUDVYHUVDOPHQWH LQWHUHVVDWR
GLYHUVH XQLWj RSHUDWLYH 2VWHWULFLD H *LQHFRORJLD O¶DUHD QHRQDWRORJLFD FRQ ULIHULPHQWR DOO
DVVLVWHQ]D DO
QHRQDWR D EDVVD SDWRORJLD FRLQYROJHQGR DQFKH OH XQLWj GL GHJHQ]D GD\ KRVSLWDO GD\ VXUJHU\ H LO
FRPSDUWRRSHUDWRULR
6L q WUDWWDWR GL XQ SURJHWWR GL ULGHILQL]LRQH GHL SHUFRUVL RUJDQL]]DWLYL H GL DSSURIRQGLPHQWR GHOOH
FRPSHWHQ]HQHFHVVDULHDOO
DVVLVWHQ]DGHOOHSD]LHQWL
/H FULWLFLWj HYLGHQ]LDWH KDQQR SRVWR O¶DWWHQ]LRQH VXOOD QHFHVVLWj GL PLJOLRUDUH L WHPSL GL ULVSRVWD DOOH
XUJHQ]HHPHUJHQ]H RVWHWULFKH DPSOLDUH OR VSD]LR GHGLFDWR DOO
DVVLVWHQ]D DO QHRQDWR D EDVVD SDWRORJLD
WHUDSLDPLQLPDQHRQDWDOHJDUDQWLUHXQDGLVSRQLELOLWjGLSRVWLOHWWRSHUODGHJHQ]DRVWHWULFDFRPSDWLELOH
FRQ OH QHFHVVLWj HG HYLWDUH L ULFRYHUL GHOOH SXHUSHUH LQ JLQHFRORJLD UHQGHQGR SL GLIILFLOH O
DVVLVWHQ]D
RVWHWULFD
2ELHWWLYLGHOODULRUJDQL]]D]LRQHVRQRVWDWL
ϭ͘ 5LGXUUHLWHPSLGLDWWLYD]LRQHGHOOD6DOD2SHUDWRULDLQFDVRGLHPHUJHQ]DRVWHWULFDQHOOHIDVFHRUDULH
QRWWXUQHIHVWLYHHSUHIHVWLYHDWWUDYHUVRODVRVWLWX]LRQHGLXQD3URQWD'LVSRQLELOLWjLQIHUPLHULVWLFDFRQ
XQDSUHVHQ]D+/HHPHUJHQ]DRVWHWULFKHYHUUHEEHURFRVuJDUDQWLWHGDGXHRSHUDWRULJLjSUHVHQWL
RVWHWULFDHLQIHUPLHUD
Ϯ͘ ,QGLYLGXDUHSUHVVROHDUHHGLGHJHQ]DRVWHWULFDXQOXRJRLGRQHRSHUO
DVVLVWHQ]DDOQHRQDWRDEDVVD
SDWRORJLD7HUDSLD0LQLPD1HRQDWDOH
ϯ͘ ,QFUHPHQWDUH OD SRVVLELOLWj GL ULFRYHUR GHOOH SD]LHQWL GL SHUWLQHQ]D RVWHWULFD DWWUDYHUVR XQD JHVWLRQH
IOHVVLELOHGHLSRVWLOHWWR
ϰ͘ *DUDQWLUHODSUHVHQ]DGHOSHUVRQDOHRVWHWULFRLQWXWWHOHDUHHGHGLFDWDDOULFRYHURGHOOHSD]LHQWL
/HIDVLDWWXDWLYHVRQRVWDWHGHFOLQDWHLQPDQLHUDIOHVVLELOHLQPRGRGDULFDOLEUDUHLOSURJHWWRLQVLHPHDJOL
RSHUDWRULGXUDQWHLOSHUFRUVR
•
GHILQL]LRQHGHOODYDULD]LRQHGHOOHpTXLSHDVVLVWHQ]LDOL
'HJHQ]D 2VWHWULFD GLPLQX]LRQH GL RVWHWULFD QHL WXUQL PDWWLQR SRPHULJJLR H QRWWH 7XUQR
WUDVIHULWRQHOOD'HJHQ]D2VWHWULFR*LQHFRORJLFD
'HJHQ]D2VWHWULFR*LQHFRORJLFDWXUQRPDWWLQRSRPHULJJLRHQRWWHFRPSRVWRGDLQIHUPLHUDH
RVWHWULFDDQ]LFKpLQIHUPLHUH
•
ULRUJDQL]]D]LRQHGHL&RRUGLQDPHQWLGHOOHXQLWjRSHUDWLYH
•
•
•
•
•
•
ULGHILQL]LRQHGHOO
RUJDQLFRLQIHUPLHULVWLFRGLVDODRSHUDWRULD
IRUPD]LRQHDGGHVWUDPHQWRGHOSHUVRQDOHLQIHUPLHULVWLFRHRVWHWULFRDWWUDYHUVRIRUPD]LRQHVXOFDPSR
HLQFRQWULG
DXODVXWHPDWLFKHLQGLYLGXDWHGDJOLRSHUDWRUL
GDOOD FRQFOXVLRQH GHJOL DGGHVWUDPHQWL SURJUHVVLYR LQVHULPHQWR GL WXWWR LO SHUVRQDOH LQ WXWWH OH
WLSRORJLHGLWXUQRKGLXUQLHUHSHULELOLWj
ODGHJHQ]D*LQHFRORJLFDGLYLHQH'HJHQ]D2VWHWULFR*LQHFRORJLFD
ODSURJUDPPD]LRQHGHLULFRYHULHTXLQGLGHOO
DVVHJQD]LRQHGHLSOYLHQHSRVWDLQFDSRDO%HG0DQDJHU
DOTXDOHFRQIOXLUDQQROHOLVWHGHLULFRYHULSURJUDPPDWL
L SRVWL OHWWR YHQJRQR JHVWLWL LQ PRGR IOHVVLELOH H DVVHJQDWL DG XQR GHL GXH VHWWRUL RVWHWULFR R
JLQHFRORJLFRVHFRQGRFULWHULGLQHFHVVLWjHGLSLHQRXWLOL]]R
ODIOHVVLELOLWjYLHQHHVWHVDDLSOGHOOD'HJHQ]D2VWHWULFD
ULDOORFD]LRQHGHOODGHJHQ]DGLQHRQDWRORJLDLQDOWURORFDOHLGRQHR
•
•
/D IDVH SUHOLPLQDUH GHO SURJHWWR KD ULJXDUGDWR OD IRUPD]LRQH GHO SHUVRQDOH RVWHWULFR H LQIHUPLHULVWLFR
VWUXWWXUDWDFRPHIRUPD]LRQHVXOFDPSRHIRUPD]LRQHLQDXOD
*OL RELHWWLYL H L FRQWHQXWL GHOOD IRUPD]LRQH LQ DXOD VRQR VWDWL GHILQLWL GXUDQWH OD )6& )RUPD]LRQH VXO
&DPSRSHUPHJOLRLQGLYLGXDUHLELVRJQLIRUPDWLYLGHOJUXSSRHGHLVLQJROLSURIHVVLRQLVWL
/
DGGHVWUDPHQWR q VWDWR UHDOL]]DWR FRQ O
DIILDQFDPHQWR DJOLRSHUDWRUL HVSHUWLGHJOL RSHUDWRUL QHR LQVHULWL
VLDSHUO
DUHDGHOOHGHJHQ]HFKHSHULOFRPSDUWRRSHUDWRULR
,OSURJHWWRqLQFRUVR
,O &HQWUR VHUYL]L VHGH SHU OD SUHQRWD]LRQH GL YLVLWH HG HVDPL UDSSUHVHQWD XQR VQRGR QHYUDOJLFR
GHOO¶RVSHGDOHGDFXLSDVVDTXRWLGLDQDPHQWHXQHOHYDWRIOXVVRGLXWHQ]D
$O ILQH GL JDUDQWLUH PDJJLRUH SULYDF\ DOO¶XWHQWH H DPSOLDUH O¶RIIHUWD GL VSRUWHOOL LQ PRGR GD PLJOLRUDUH
O¶DFFRJOLHQ]DHULGXUUHLWHPSLGLDWWHVDHFRGHVLqUHVDQHFHVVDULDXQDULVWUXWWXUD]LRQHGHJOLVSD]LHXQD
ULRUJDQL]]D]LRQHGHOOHDWWLYLWjGLVSRUWHOOR
,ODYRULLQL]LDWLQHOQRYHPEUHGHOKDQQRSUHYLVWRXQDVDODG¶DWWHVDHXQDVDODGHGLFDWDDJOLVSRUWHOOL
2JQXQRGLHVVLqGRWDWRGLVHGXWDSHUO¶XWHQWHHSLFFROHSDUHWLGLYLVRULHSHUORVYROJLPHQWRFRQPDJJLRUH
ULVHUYDWH]]DGHOOHRSHUD]LRQLULFKLHVWH
$QFKHLOQXPHURGHJOLVSRUWHOOLqVWDWRDPSOLDWRFRQXQDGRWD]LRQHSDULDSRVWD]LRQL7DOHHVWHQVLRQHKD
FRQVHQWLWRROWUHXQDPLJOLRUULVSRVWDDOO¶XWHQ]DJUD]LHDOO¶LQFUHPHQWRGHOVHUYL]LRGLULPRGXODUHJOLRUDULGL
DSHUWXUDHULYHGHUHO¶HIILFLHQ]DFRPSOHVVLYD
,QILQHVRQRVWDWHSUHGLVSRVWHOHDWWLYLWjSHUSURFHGHUHDOODFUHD]LRQHGLXQQXPHURXQLFRGLSUHQRWD]LRQH
WHOHIRQLFDLQDPELWRSURYLQFLDOH7DOHHVWHUQDOL]]D]LRQHDQGUjDUHJLPHQHOO¶DQQR
2ELHWWLYLVSHFLILFLGLSDUWLFRODUHULOHYDQ]DLVWLWX]LRQDOH
5LVWUXWWXUD]LRQHHULRUJDQL]]D]LRQHGHO&HQWUR6HUYL]LGHOO¶$]LHQGD
2ELHWWLYLVSHFLILFLGLSDUWLFRODUHULOHYDQ]DLVWLWX]LRQDOH
&RQFOXVLRQLGHO'LUHWWRUH*HQHUDOH
&RQFOXVLRQLGHO'LUHWWRUH*HQHUDOH
/H SROLWLFKH VDQLWDULH GHOO¶$]LHQGD 2VSHGDOLHUR8QLYHUVLWDULD GL 3DUPD LQ TXHVWL XOWLPL DQQL VRQR VWDWH
LQIOXHQ]DWH GDOOH VFHOWH GHWWDWH GDOOH GLVSRVL]LRQL GHO *RYHUQR H GHOOD 5HJLRQH UHODWLYH DOO¶DQDOLVL H DOOD
UHYLVLRQHGHOODVSHVDSXEEOLFDDOILQHGLUD]LRQDOL]]DUHODVWHVVDJDUDQWHQGRQHOFRQWHPSRO¶LQYDULDQ]DGHL
VHUYL]LDLFLWWDGLQL
/¶$]LHQGD KD FKLXVR O¶HVHUFL]LR GL IDWWR LQ SDUHJJLR FRQ XQ SLFFROR XWLOH SDUL D HXUR VLWXD]LRQH DQDORJD DO 7DOH YDORUH ULVXOWDLQOLQHD ULVSHWWR DO ULVXOWDWR DWWHVRGDOODSURJUDPPD]LRQH
UHJLRQDOHHGDOOHGLVSRVL]LRQLQD]LRQDOL
/DPDJJLRUHDWWHQ]LRQHDOODJHVWLRQHGHOOHULVRUVHSXEEOLFKHKDFHUWDPHQWHXQ¶LPSRUWDQ]DVWUDWHJLFDFKH
VLWUDGXFHQHOODVILGDDOODPDVVLPDHIILFLHQ]DQHOO¶XWLOL]]RGHOOHULVRUVHHFRQRPLFKHDGLVSRVL]LRQH
&RQVLGHUDUHTXHVWRYLQFRORqHVVHQ]LDOHSHUFRPSUHQGHUHOHUDJLRQLGLDOFXQHVFHOWHVWUDWHJLFKHQRQFKp
JOLLQGLVSHQVDELOLFRPSURPHVVLFRVWREHQHILFLRDOODEDVHGHOOHPRGDOLWjGLHURJD]LRQHGLTXDOVLDVLVHUYL]LR
,O SHUGXUDUH GHOOD FULVL HFRQRPLFD FRQWLQXD D WHQHUH DO FHQWUR GHO GLEDWWLWR LVWLWX]LRQDOH OD VRVWHQLELOLWj
ILQDQ]LDULD/DULVSRVWDGHOODQRVWUD$]LHQGDqTXHOODGLIDUIURQWHDOOHQXRYHSUREOHPDWLFKHGHOODPHGLFLQD
LFXLFRQWHVWLVFLHQWLILFLHGHSLGHPLRORJLFLVRQRFDPELDWLSURPXRYHQGRODVDOXWHPHGLDQWHLQYHVWLPHQWLH
LQQRYD]LRQL QHFHVVDULH SHU PDQWHQHUH H DXPHQWDUH O¶HIILFLHQ]D WHFQLFD H SURPXRYHUH OR VYLOXSSR GHOOH
SROLWLFKHVDQLWDULHGLTXHVWD$]LHQGD
6RQR WDQWL L FDPELDPHQWL DYYHQXWL QHOOD UHDOW! VRFLDOH GHO QRVWUR WHPSR FKH KDQQR IRUWHPHQWH
LQWHUHVVDWR DQFKH LO PRQGR VDQLWDULR 'D XQD SDUWH VL DVVLVWH DG XQD FUHVFHQWH FRPSOHVVLW! FOLQLFR
DVVLVWHQ]LDOH GHL SD]LHQWL VRJJHWWL "IUDJLOL# VSHVVR SOXULSDWRORJLFL H GL HW! DYDQ]DWD 'DOO#DOWUD VL KD XQD
FRQWLQXD HYROX]LRQH WHFQRORJLFD FKH QHJOL XOWLPL DQQL KD YLVWR XQR VYLOXSSR QRWHYROH VRSUDWWXWWR LQ
DPELWR FKLUXUJLFR H LQWHUYHQWLVWLFR $ IURQWH GL TXHVWL IDWWRUL GL FUHVFHQWH FRPSOHVVLW! VL UHJLVWUD XQ FDOR
GHOOH ULVRUVH FRQ FRQVHJXHQWH QHFHVVLW! GL PDJJLRUH IOHVVLELOLW! QHO ORUR XWLOL]]R $ GLYHQWDWR QHFHVVDULR
ULSHQVDUH L FRQWHVWL H L PRGL GHOO#DVVLVWHQ]D LQ SDUWLFRODUH SHU TXDQWR FL ULJXDUGD % LPSUHVFLQGLELOH
ULYHGHUH O#DVVLVWHQ]D RVSHGDOLHUD QRQ SL& OLPLWDWD D VLQJROL VHWWRUL PD FRLQYROJHQGR O#RVSHGDOH QHOOD VXD
JOREDOLW!DOILQHGLRWWLPL]]DUHOHULVRUVHGLVSRQLELOLVHQ]DYHQLUPHQRDJOLRELHWWLYLGLHIILFDFLDTXDOLW!HG
HIILFLHQ]D FDUDWWHULVWLFL GHO QRVWUR VLVWHPD VDQLWDULR 4XHVWR DEELDPR FHUFDWR GL SUHVHQWDUH
VLQWHWLFDPHQWHQHOFDSLWRORPDVLWUDWWDGLXQSULPRSDVVR
6HPSUH QHOOD SURVSHWWLYD GHO FDPELDPHQWR H GHOO¶LQQRYD]LRQH YD OHWWR O¶LPSHJQR GHOO¶$]LHQGD SHU GDUH
DWWXD]LRQHDOOHUHFHQWLQRUPDWLYHQD]LRQDOLLQWHPDGLSUHYHQ]LRQHGHOODFRUUX]LRQHHGLDPPLQLVWUD]LRQH
WUDVSDUHQWHFKHqGRFXPHQWDWRGDJOLDWWLGLJRYHUQRFKHVRQRVWDWLDVVXQWLVLDQHOFKHQHOD
TXHVWR ULJXDUGR /¶DWWLYLWj GHO 5HVSRQVDELOH GHOOD 3UHYHQ]LRQH GHOOD &RUUX]LRQH H GHO 5HVSRQVDELOH GHOOD
7UDVSDUHQ]DqFDUDWWHUL]]DWDGDRSHUDWLYLWjFRLQYROJLPHQWRHSDUWHFLSD]LRQHGHOOH6WUXWWXUH6HUYL]L8IILFL
GHOO¶$]LHQGD /¶LPSHJQR GL WXWWL LQ WDO VHQVR YD FHUWDPHQWH ROWUH LO PHUR DGHPSLPHQWR EXURFUDWLFR 3HU
UDIIRU]DUH TXHVWL SULQFLSL VRQR LQ GHILQL]LRQH SHU LO DQFKH SHUFRUVL IRUPDWLYL VXL WHPL GHOO¶HWLFD FRQ
XQD IRUWH FDUDWWHUL]]D]LRQH LQWHUDWWLYD SHU PDVVLPL]]DUH LO FRLQYROJLPHQWR GHL SDUWHFLSDQWL H IDYRULUH OD
ULIOHVVLRQHVXFRQWHQXWLYDORULDOLPDDQFKHVXOOHULFDGXWHFRPSRUWDPHQWDOL
,QXQSHULRGRFRVuFULWLFRLQWHUPLQLGLULVRUVHGLVSRQLELOLORVSURQHSHUPLJOLRUDUHODTXDOLWjGHOO¶RIIHUWDH
GHOO¶HIILFLHQ]D QHOOD SURGX]LRQH GL VHUYL]L QRQ SXz FKH YHQLUH GD VWUDWHJLH LQQRYDWLYH FKH YHGRQR QHL
SURFHVVLGLLQWHJUD]LRQHGLDWWLYLWjHIXQ]LRQLWUD$]LHQGHFRQGL]LRQLSHULOPLJOLRUDPHQWRGHOODVRVWHQLELOLWj
GHO VLVWHPD VDQLWDULR DWWUDYHUVR OD UD]LRQDOL]]D]LRQH GL ULVRUVH WHFQRORJLFKH PDWHULDOL XPDQH H
ILQDQ]LDULH IDYRUHQGR OD FROODERUD]LRQH O¶LQWHJUD]LRQH H FRQFHQWUDQGR VWUXWWXUDOPHQWH OH IXQ]LRQL
DPPLQLVWUDWLYH WHFQLFRSURIHVVLRQDOL H VDQLWDULH D SUHYDOHQWH FDUDWWHUH JHQHUDOH H GL VXSSRUWR WHFQLFR
ORJLVWLFR
/¶$]LHQGD KD LQWHVR OH LQGLFD]LRQL HVSUHVVH GDOOD 5HJLRQH QHOOH OLQHH GL SURJUDPPD]LRQH FRPH XQD
RSSRUWXQLWjGDFRJOLHUHVLDVXOSLDQRLQWHUD]LHQGDOHFKHLQDPELWRGL$UHD9DVWD
,OSURFHVVRGLLQWHJUD]LRQHWUDOH$]LHQGHGL$UHD9DVWDqSURVHJXLWRQHOULVSHWWRGLTXDQWRLQGLFDWRGDJOL
LQGLUL]]L UHJLRQDOL H LQ XQD ORJLFD GL FRQWLQXLWj FRQ TXDQWR JLj LQ HVVHUH 'L WDOL SHUFRUVL VL GD FRQWR QHO
FDSLWROR
&RPH JL! FRQVLGHUDWR QHJOL DQQL SUHFHGHQWL OD WUDPD GHOOH UHOD]LRQL LVWLWX]LRQDOL % GD VHPSUH OD WUDFFLD
VXOODTXDOHYLHQHFRVWUXLWRLOGRFXPHQWRGLUHQGLFRQWD]LRQHHOR%LQPRGRVHPSUHSL&SXQWXDOHLQTXDQWR
TXHVWDUHWH%O#RVVDWXUDVXFXLVLVYLOXSSDO#DWWLYLW!GHOO#$]LHQGDGDOODSLDQLILFD]LRQHHSURJUDPPD]LRQHDOOD
TXRWLGLDQDDWWLYLW!GLFXUDILQRDOOHIXQ]LRQLGLFRQWUROORHYHULILFD
1HO VL % GDWD XOWHULRUH HYLGHQ]D D TXHVWL SHUFRUVL DQFKH DWWUDYHUVR OD IRUPDOL]]D]LRQH GL DFFRUGL
VSHFLILFL FRQ O#$]LHQGD WHUULWRULDOH H OD ILQDOL]]D]LRQH GL GLYHUVH FRQYHQ]LRQL DWWXDWLYH LQ DPELWR GL $UHD
9DVWDULSRUWDWHQHOFDSLWROR
5HJLRQH&RQIHUHQ]DWHUULWRULDOHVRFLDOHHVDQLWDULD&7668QLYHUVLW!H$]LHQGD86/GL3DUPDYHQJRQR
QRQ FDVXDOPHQWH FLWDWH QXPHURVH YROWH QHO YROXPH 4XHVWD ULSHWL]LRQH % OD PLVXUD GHOO#LPSRUWDQ]D FKH
WDOL LQWHUORFXWRUL KDQQR SHU QRL QHOOD GHILQL]LRQH GHOOH SLDQLILFD]LRQL SOXULHQQDOL H QHOOD SURJUDPPD]LRQH
DQQXDOH ,QSDUWLFRODUH5HJLRQHH&766GHILQLVFRQRLFRQILQLGHOQRVWURFRQWHVWRRSHUDWLYRHKDQQRXQD
IXQ]LRQHGLLQGLUL]]RHYHULILFDGHOQRVWURRSHUDWR
3HU LO IXWXUR SRVVLDPR FRQIHUPDUH FKH LQWHJUD]LRQH H FRQGLYLVLRQH FRVWLWXLVFRQR LPSRUWDQWL OLQHH GL
VYLOXSSRGHOOHVWUDWHJLHD]LHQGDOLSDVVDQGRSHULOFRLQYROJLPHQWRGLFKLDOO#LQWHUQRGHOO#2VSHGDOHRSHUDSHU
JDUDQWLUHLVHUYL]LDLFLWWDGLQLGHOWHUULWRULRGL3DUPDHQRQVRORHFRPHVHPSUHGLWXWWLFRORURFKHVRQR
LQWHUHVVDWLRFROODERUDQRDOODFUHVFLWDGHOO#2VSHGDOHFXLYDXQVHQWLWRJUD]LHYRORQWDULDWRRUJDQL]]D]LRQL
GHL FLWWDGLQL H GHJOL XWHQWL RUJDQL]]D]LRQL VLQGDFDOL LVWLWX]LRQL ORFDOL IRQGD]LRQL FKLXQTXH D TXDOXQTXH
WLWRORRIIUDLOSURSULRFRQWULEXWR
$SSHQGLFH
$SSHQGLFHFDSLWROR
7DEHOOD9DORULHYROXPLGHOODSURGX]LRQHGHOO¶$]LHQGDVXOWRWDOHGHOYDORUHHYROXPLGHOOD
SURGX]LRQHSURYLQFLDOHSXEEOLFRHSULYDWRDFFUHGLWDWRDQQR
$]LHQGD2VSHGDOLHUR
8QLYHUVLWDULDGL3DUPD
'LDJQRVWLFD
''6WUXPHQWFRQ
UDGLD]
''6WUXPHQWQR
UDGLD]
3UHVWD]LRQL
1
9DO
LQFLGHQ]D
1SUHVWD]LRQL
$28VXWRW
SURYLQFLDOL
SURYLQFLDOH
9DO
SURYLQFLDOH
LQFLGHQ]D
$28VXWRW
SURYLQFLDOH
7RWDOH
/3UHOLHYL
7RWDOH
$WWLYLWjULDVVRUELPHQWR
SXQWLSUHOLHYRFLWWDGLQL
7RWDOH
'%LRSVLD
/&KLPLFDFOLQLFD
/
(PDWRORJLDFRDJXOD]
/,PPXQRHPDWH
WUDVIXVLRQ
/
0LFURELRORJLDYLURORJLD
/$QDWRPLDHG
LVWSDWRO
55LDEGLDJQRVWLFD
555)
5LDELOLWD]LRQH 57HUDSLD)LVLFD
5$OWUDULDELOLWD]LRQH
7RWDOH
75DGLRWHUDSLD
7'LDOLVL
72GRQWRLDWULD
7RWDOH
93ULPDYLVLWD
99LVLWDGLFRQWUROOR
92VVHUYD]%UHYH
,QWHQVLYD
7RWDOH
77UDVIXVLRQL
3UHVWD]LRQL
7HUDSHXWLFKH 7&KLUXUJLD
DPEXODWRULDOH
7$OWUHSUHVWD]
WHUDSHXWLFKH
7RWDOH
)RQWH%DQFD'DWL$6$±5(5
5LWRUQRDOFDSLWROR
/
,PSRUWL
/*HQHWLFDFLWRJHQ
9LVLWH
,PSRUWL
'$OWUDGLDJQRVWLFD
/DERUDWRULR
3UHVWD]LRQL
ƉƉĞŶĚŝĐĞ
$QQR
7RWDOHSURYLQFLDOH
7DEHOOD9DORULHYROXPLGHOODSURGX]LRQHGHOO¶$]LHQGDVXOWRWDOHGHOYDORUHHYROXPLGHOOD
SURGX]LRQHSURYLQFLDOHSXEEOLFRHSULYDWRDFFUHGLWDWRDQQR
$]LHQGD2VSHGDOLHUR
8QLYHUVLWDULDGL3DUPD
$QQR
'LDJQRVWLFD
3UHVWD]LRQL
,PSRUWL
3UHVWD]LRQL
1
9DO
LQFLGHQ]D
1SUHVWD]LRQL
$28VXWRW
SURYLQFLDOL
SURYLQFLDOH
''6WUXPHQWFRQ
UDGLD]
''6WUXPHQWQR
UDGLD]
'%LRSVLD
7RWDOH
/3UHOLHYL
/&KLPLFDFOLQLFD
/(PDWROFRDJXOD]
/,PPXQRHPDWH
WUDVIXVLRQ
/
0LFURELROYLURORJLD
/$QDWRPLDHG
LVWSDWRO
$WWLYLWj
ULDVVRUELPHQWRSXQWL SUHOLHYRFLWWDGLQL
7RWDOH
55LDEGLDJQRVWLFD
555)
5LDELOLWD]LRQH 57HUDSLD)LVLFD
5$OWUD
ULDELOLWD]LRQH
7RWDOH
75DGLRWHUDSLD
7'LDOLVL
72GRQWRLDWULD
77UDVIXVLRQL
93ULPDYLVLWD
99LVLWDGLFRQWUROOR
7&KLUXUJLD
DPEXODWRULDOH
7$OWUHSUHVWD]
WHUDSHXWLFKH
7RWDOH
7RWDOH
7RWDOH
)RQWH%DQFD'DWL$6$±5(5
5LWRUQRDOFDSLWROR
ƉƉĞŶĚŝĐĞ
//
LQFLGHQ]D
$28VXWRW
SURYLQFLDOH
7RWDOH
9LVLWH
9DO
SURYLQFLDOH
/*HQHWLFDFLWRJHQ
3UHVWD]LRQL
7HUDSHXWLFKH
,PSRUWL
'$OWUDGLDJQRVWLFD
/DERUDWRULR
7RWDOHSURYLQFLDOH
7DEHOOD9DORULHYROXPLGHOODSURGX]LRQHGHOO¶$]LHQGDVXOWRWDOHGHOYDORUHHYROXPLGHOOD
SURGX]LRQHSURYLQFLDOHSXEEOLFRHSULYDWRDFFUHGLWDWRDQQR
$]LHQGD2VSHGDOLHUR
8QLYHUVLWDULDGL3DUPD
$QQR
'LDJQRVWLFD
''6WUXPHQWFRQ
UDGLD]
''6WUXPHQWQR
UDGLD]
'%LRSVLD
,PSRUWL
3UHVWD]LRQL
,PSRUWL
1
9DO
LQFLGHQ]D
1SUHVWD]LRQL
$28VXWRW
SURYLQFLDOL
SURYLQFLDOH
9DO
SURYLQFLDOH
LQFLGHQ]D
$28VXWRW
SURYLQFLDOH
7RWDOH
/3UHOLHYL
/&KLPLFDFOLQLFD
/
(PDWRORJLDFRDJXOD]
/,PPXQRHPDWH
WUDVIXVLRQ
/
0LFURELRORJLDYLURORJLD
/$QDWRPLDHG
LVWSDWRO
7RWDOH
$WWLYLWjULDVVRUELPHQWR
SXQWLSUHOLHYRFLWWDGLQL
/*HQHWLFDFLWRJHQ
7RWDOH
55LDEGLDJQRVWLFD
555)
5LDELOLWD]LRQH 57HUDSLD)LVLFD
7RWDOH
75DGLRWHUDSLD
7'LDOLVL
72GRQWRLDWULD
7RWDOH
93ULPDYLVLWD
99LVLWDGLFRQWUROOR
7RWDOH
5$OWUDULDELOLWD]LRQH
77UDVIXVLRQL
3UHVWD]LRQL
7HUDSHXWLFKH 7&KLUXUJLD
DPEXODWRULDOH
7$OWUHSUHVWD]
WHUDSHXWLFKH
9LVLWH
3UHVWD]LRQL
'$OWUDGLDJQRVWLFD
/DERUDWRULR
7RWDOHSURYLQFLDOH
7RWDOH
)RQWH%DQFD'DWL$6$±5(5
///
ƉƉĞŶĚŝĐĞ
5LWRUQRDOFDSLWROR
7DEHOOD&DVLVWLFDSURJUDPPDWDDFDULFRGHO661HVFOXVR36H2%,DQQR
$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGL3DUPD
7RWDOHSUHVWD]LRQL
HURJDWHDFDULFRGHO
HQWUR
HQWUR
7LSRORJLDSUHVWD]LRQH 661SURJUDPPDWHFRQ JJ JJ
JJBDWW! 'LDJQRVWLFD
/DERUDWRULR
HQWUR
JJ
HQWUR
HQWUR
JJ JJ
ROWUH
JJ
5LDELOLWD]LRQH
3UHVWD]LRQL7HUDSHXWLFKH
9LVLWH
)RQWH%DQFD'DWL$6$
5LWRUQRDOFDSLWROR
7DEHOOD&DVLVWLFDSURJUDPPDWDDFDULFRGHO661HVFOXVR36H2%,DQQR
$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGL3DUPD
7RWDOHSUHVWD]LRQL
HURJDWHDFDULFRGHO HQWUR
HQWUR
HQWUR
HQWUR HQWUR ROWUH
7LSRORJLDSUHVWD]LRQH
661SURJUDPPDWH JJ JJ JJ JJ JJ JJ
FRQJJBDWW! 'LDJQRVWLFD
/DERUDWRULR
5LDELOLWD]LRQH
3UHVWD]LRQL7HUDSHXWLFKH
9LVLWH
)RQWH%DQFD'DWL$6$
5LWRUQRDOFDSLWROR
7DEHOOD&DVLVWLFDSURJUDPPDWDDFDULFRGHO661HVFOXVR36H2%,DQQR
$]LHQGD2VSHGDOLHUR8QLYHUVLWDULDGL3DUPD
7RWDOHSUHVWD]LRQL
HURJDWHDFDULFRGHO HQWUR HQWUR
HQWUR
HQWUR HQWUR
ROWUH
7LSRORJLDSUHVWD]LRQH
661SURJUDPPDWH JJ JJ JJ JJ JJ JJ
FRQJJBDWW! 'LDJQRVWLFD
/DERUDWRULR
5LDELOLWD]LRQH
3UHVWD]LRQL7HUDSHXWLFKH
9LVLWH
)RQWH%DQFD'DWL$6$
5LWRUQRDOFDSLWROR
7DEHOOD$VVLVWHQ]D2VSHGDOLHUD±VWUXWWXUDGHOO¶RIIHUWDSRVWLOHWWRSXEEOLFLHSULYDWLDO
3RVWLOHWWRSXEEOLFL
3RVWLOHWWRSULYDWL
,QGLFDWRUL
$FXWL
$]LHQGH
/'
3RVWDFXWL
/'
7RWDOH
/' 5LDELOLWD
7RWDOH
DFFUHGLWD DFFUHGLWDWL $FXWL 5LDE ]LRQH
1RQ
5LDELOLWD]LR
$FFUHGLWDWL
WLHQRQ
DFFUHGLWDWL
QH
DFFUHGLWD
DFFUHGLWDWL
WL
/'
7RWDOH
$86/3DUPD
$283DUPD
7RW3DUPD
7RW5HJLRQH
ƉƉĞŶĚŝĐĞ
$FXWL
5LDELOL
WD]LRQH
4.586
)RQWH(ODERUD]LRQHGD)OXVVL,QIRUPDWLYL0LQLVWHURGHOOD6DOXWH+63ZZZUHJLRQHHPLOLDURPDJQDLW6,6
/DSRSROD]LRQHGLULIHULPHQWRSHUJOLLQGLFDWRULqODSRSROD]LRQHSHUD]LHQGDUHVLGHQWHLQ(PLOLD5RPDJQD
/DFRORQQDGHLSRVWLOHWWRDFXWLDFFUHGLWDWLHQRQqJHQHUDWDVXOODEDVHGLTXDQWRSUHYLVWRGDOO
$FFRUGR$,23SDUWH,,%
DFFUHGLWDPHQWRLQEDVHDOO
XWLOL]]R3HULOFDOFRORGHOO
LQGLFDWRUH3/DELWDQWLVLVRQRXWLOL]]DWLVRORTXHOOLDFFUHGLWDWL
1RQqVWDWDLQVHULWDODFRORQQDUHODWLYDDLSRVWLOHWWRGLULDELOLWD]LRQHQRQDFFUHGLWDWLFKHLQUHJLRQHVRQRSUHVHQWLVRORQHL
SUHVLGLGHOODSURYLQFLDGL%RORJQDSHUXQWRWDOHGLSRVWLOHWWR
5LWRUQRDOFDSLWROR
/s
7DEHOOD$VVLVWHQ]D2VSHGDOLHUD±VWUXWWXUDGHOO¶RIIHUWDSRVWLOHWWRSXEEOLFLHSULYDWLDO
3RVWLOHWWRSXEEOLFL
3RVWLOHWWRSULYDWL
,QGLFDWRUL
$FXWL
$]LHQGH
$FXWL
5LDELOL
WD]LRQH
/'
7RWDOH
3RVWDFXWL
/'
7RWDOH
/' 5LDELOLWD
DFFUHGLWD DFFUHGLWDWL $FXWL 5LDE ]LRQH
1RQ
5LDELOLWD]LR
$FFUHGLWDWL
WLHQRQ
DFFUHGLWDWL
QH
DFFUHGLWD
DFFUHGLWDWL
WL
/'
7RWDOH
$86/3DUPD
$283DUPD
7RW3DUPD
7RW5HJLRQH
)RQWH(ODERUD]LRQHGD)OXVVL,QIRUPDWLYL0LQLVWHURGHOOD6DOXWH+63ZZZUHJLRQHHPLOLDURPDJQDLW6,6
/DSRSROD]LRQHGLULIHULPHQWRSHUJOLLQGLFDWRULqODSRSROD]LRQHSHUD]LHQGDUHVLGHQWHLQ(PLOLD5RPDJQD±
/DFRORQQDGHLSRVWLOHWWRDFXWLDFFUHGLWDWLHQRQqJHQHUDWDVXOODEDVHGLTXDQWRSUHYLVWRGDOO
$FFRUGR$,23SDUWH,,%
DFFUHGLWDPHQWRLQEDVHDOO
XWLOL]]R3HULOFDOFRORGHOO
LQGLFDWRUH3/DELWDQWLVLVRQRXWLOL]]DWLVRORTXHOOLDFFUHGLWDWL
1RQqVWDWDLQVHULWDODFRORQQDUHODWLYDDLSRVWLOHWWRGLULDELOLWD]LRQHQRQDFFUHGLWDWLFKHLQUHJLRQHVRQRSUHVHQWLVRORQHL
SUHVLGLGHOODSURYLQFLDGL%RORJQDSHUXQWRWDOHGLSRVWLOHWWR
5LWRUQRDOFDSLWROR
7DEHOOD3HVR0HGLRGHOULFRYHURH,&0LQUHJLPHRUGLQDULRDQQL
'LVFLSOLQD
3HVR
3HVR
3HVR
,&0
,&0
,&0
PHGLR
PHGLR
PHGLR
)RQWH%DQFD'DWL6'25(5
5LWRUQRDOFDSLWROR
s
ƉƉĞŶĚŝĐĞ
&DUGLRFKLUXUJLD
&DUGLRORJLD
&KLUXUJLD*HQHUDOH
&KLUXUJLD0D[LOOR)DFFLDOH
&KLUXUJLD3HGLDWULFD
&KLUXUJLD3ODVWLFD
&KLUXUJLD7RUDFLFD
&KLUXUJLD9DVFRODUH
(PDWRORJLD
*HULDWULD
0DODWWLH,QIHWWLYHH7URSLFDOL
0HGLFLQD*HQHUDOH
1HIURORJLD
1HXURFKLUXUJLD
1HXURORJLD
2FXOLVWLFD
2UWRSHGLDH7UDXPDWRORJLD
2VWHWULFLDH*LQHFRORJLD
2WRULQRODULQJRLDWULD
3HGLDWULD
8URORJLD
*UDQGL8VWLRQDWL
1HIURORJLD7UDSLDQWL
7HUDSLD,QWHQVLYD
8QLWD
&RURQDULFD
$VWDQWHULD
'HUPDWRORJLD
*DVWURHQWHURORJLD
1HRQDWRORJLD
2QFRORJLD
3HGLDWULDH2QFRHPDWRORJLD
3QHXPRORJLD
7HUDSLD,QWHQVLYD1HRQDW
7DEHOOD3LDQRUHJLRQDOHVXOFRQWHQLPHQWRGHLWHPSLGLDWWHVD'*53DUPDH
SURYLQFLDDQQR
$WWHVD
7RWDOH PHGLDQD
;ŐŐͿ
ULFRYHUL
3$50$
7HPSLGLDWWHVDYDORULSHUFHQWXDOL
JJ JJJJJJJJ JJ
!
JJ
$UHDRQFRORJLFD
&KHPLRWHUDSLD'+
$]263
7RWDOH
,QWHUYHQWRFKLUXUJLFRWXPRUH
SROPRQH52
$]263
7RWDOH
,QWHUYHQWRFKLUXUJLFRWXPRUH
XWHUR52
$]263
7RWDOH
,QWHUYHQWRFKLUXUJLFRWXPRUH
FRORQUHWWR52
$]263
7RWDOH
,QWHUYHQWRFKLUXUJLFRWXPRUH
SURVWDWD52
$]263
7RWDOH
,QWHUYHQWRFKLUXUJLFRWXPRUH $]263
PDPPHOODPDVWHFWRPLD52
7RWDOH
(QGRDUWHULHFWRPLDFDURWLGHD
52
$]263
7RWDOH
$QJLRSODVWLFD37&$52
$]263
7RWDOH
7RWDOH
$]263
7RWDOH
$]263
7RWDOH
5LSDUD]LRQHHUQLDLQJXLQDOH
'+
$]263
7RWDOH
(PRUURLGHFWRPLD'+
$]263
%\3DVVDRUWRFRURQDULFR52 $]263
7RQVLOOHFWRPLD52
,QWHUYHQWRSURWHVLDQFD52
7RWDOH
%LRSVLDSHUFXWDQHDGHOIHJDWR $]263
'+
7RWDOH
'DOFRQWHJJLRYLHQHHVFOXVRLOWHPSRQHFHVVDULRSHUHYHQWXDOLWHUDSLHDGLXYDQWLRSUHSDUDWRULHDOO¶DWWRFKLUXUJLFR
FDOFRODWLVXOWRWDOHGHLULFRYHULFRQWHPSLGLDWWHVDVXSHULRULDJLRUQL
1RWDWHPSLGLDWWHVDFDOFRODWLVHFRQGRODGDWDGLSUHQRWD]LRQHULSRUWDWDVXOWUDFFLDWRGHOIOXVVR6'2
)RQWHEDQFD'DWL6'25(5
5LWRUQRDOFDSLWROR
ƉƉĞŶĚŝĐĞ
s/
7DEHOOD3LDQRUHJLRQDOHVXOFRQWHQLPHQWRGHLWHPSLGLDWWHVD'*55HJLRQH
(PLOLD5RPDJQDDQQR
727$/(5(*,21(
$WWHVD
PHGLDQ
7RWDOH
D
ULFRYHUL
JJ
7HPSLGLDWWHVDYDORULSHUFHQWXDOL
JJ
!
JJ
JJ JJ
JJ
JJ
JJ
$UHDRQFRORJLFD
$]86/ 3ULYDWR
&KHPLRWHUDSLD'+
$]263
5L]]ROL
7RWDOH
$]86/
,QWHUYHQWR
FKLUXUJLFRWXPRUH
SROPRQH52
,QWHUYHQWR
FKLUXUJLFRWXPRUH
XWHUR52
3ULYDWR
$]263
7RWDOH
$]86/
$]263
7RWDOH
3ULYDWR
,QWHUYHQWR
FKLUXUJLFRWXPRUH
FRORQUHWWR52
$]86/
,QWHUYHQWR
FKLUXUJLFRWXPRUH
SURVWDWD52
$]86/
3ULYDWR
3ULYDWR
$]263
7RWDOH
$]263
7RWDOH
,QWHUYHQWR
FKLUXUJLFRWXPRUH
PDPPHOOD
PDVWHFWRPLD52
$]86/
3ULYDWR
$]263
7RWDOH
$]86/
(QGRDUWHULHFWRPLD
FDURWLGHD52
3ULYDWR
$]263
7RWDOH
$]86/
$QJLRSODVWLFD37&$
3ULYDWR
52
$]263
%\3DVV
DRUWRFRURQDULFR
52
7RWDOH
3ULYDWR
$]263
7RWDOH
$]86/
7RQVLOOHFWRPLD52 3ULYDWR
$]263
$]86/
3ULYDWR
7RWDOH
,QWHUYHQWRSURWHVL
DQFD52
$]263
7RWDOH
s//
ƉƉĞŶĚŝĐĞ
5LSDUD]LRQHHUQLD
LQJXLQDOH'+
$]86/
3ULYDWR
$]263
7RWDOH
$]86/
(PRUURLGHFWRPLD
'+
3ULYDWR
$]263
7RWDOH
$]86/
%LRSVLDSHUFXWDQHD
3ULYDWR
GHOIHJDWR'+
$]263
7RWDOH
'DOFRQWHJJLRYLHQHHVFOXVRLOWHPSRQHFHVVDULRSHUHYHQWXDOLWHUDSLHDGLXYDQWLRSUHSDUDWRULHDOO¶DWWRFKLUXUJLFR
FDOFRODWLVXOWRWDOHGHLULFRYHULFRQWHPSLGLDWWHVDVXSHULRULDJLRUQL
1RWDWHPSLGLDWWHVDFDOFRODWLVHFRQGRODGDWDGLSUHQRWD]LRQHULSRUWDWDVXOWUDFFLDWRGHOIOXVVR6'2
)RQWHEDQFD'DWL6'25(5
5LWRUQRDOFDSLWROR
ƉƉĞŶĚŝĐĞ
s///
$SSHQGLFH 4XDOLWjGHOO
DVVLVWHQ]DHGHIILFLHQ]D
JHVWLRQDOH(IILFLHQ]DJHVWLRQDOH±SDU3LDQLILFD]LRQH
GHOO¶DWWLYLWjQHJR]LDOHHSROLWLFKHGLDFTXLVWR
5(/$=,21($9(1
,OSURFHVVRGLLQWHJUD]LRQHWUDOH$]LHQGHGL$UHD9DVWDqSURVHJXLWRQHOULVSHWWRGLTXDQWRLQGLFDWRGDJOL
LQGLUL]]LUHJLRQDOLHGLQXQDORJLFDGLFRQWLQXLWjFRQOHHVSHULHQ]HJLjPDWXUDWHQHJOLDQQLSUHFHGHQWL*OL
RELHWWLYL GHOO¶$UHD 9DVWD (PLOLD 1RUG VRQR VWDWL GHILQLWL LQ FRHUHQ]D FRQ JOL LQGLUL]]L UHJLRQDOL H SRVVRQR
HVVHUHUDJJUXSSDWLLQWUHDUHHGLLQWHUYHQWRSHUFLDVFXQDGHOOHTXDOLVLGjGLVHJXLWRLQPRGRVLQWHWLFR
FRQWRGHOOHSULQFLSDOLDWWLYLWjVYLOXSSDWH
$WWLYD]LRQHGHOVLVWHPDGLORJLVWLFDLQWHJUDWDGLDUHDYDVWD
/D SULPD SDUWH GHOO¶DQQR q VWDWD GHGLFDWD DOO¶DOOHVWLPHQWR LQWHUQR GHO QXRYR PDJD]]LQR GL $UHD 9DVWD
6RQR VWDWL LQIDWWL FRPSOHWDWL L ODYRUL LPSLDQWLVWLFL FKH DQFRUD UHVLGXDYDQR H VL SURYYHGXWR
DOO¶DSSURQWDPHQWR GHOOH DUHH SHU OD JHVWLRQH GHOOR VWRFN H GHO SLFNLQJ GHL EHQL JHVWLWL $OO¶LQWHUQR GL WDOL
DUHHVRQRVWDWHHIIHWWXDWHVFHOWHWHFQRORJLFKHGLIIHUHQ]LDWHLQEDVHDOOHFDUDWWHULVWLFKHILVLFKHGHLSURGRWWL
SHVRYROXPHWHPSHUDWXUDGLFRQVHUYD]LRQHHGDOORURRWWLPDOHLQGLFHGLURWD]LRQH
,QSDUWLFRODUH
SHU L SURGRWWL D YROXPH PHGLR DOWD URWD]LRQH HG DOWD TXDQWLWj GL SUHOLHYR VRQR VWDWH PRQWDWH
VFDIIDODWXUHDJUDYLWj
•
SHU L SURGRWWL D YROXPH PHGLR DOWD URWD]LRQH H EDVVD TXDQWLWj GL SUHOLHYR QRQFKp SHU SURGRWWL D
EDVVD URWD]LRQH q VWDWR LQVWDOODWR XQ VLVWHPD DXWRPDWL]]DWR D FDVVHWWH WUDVOR HOHYDWRUH
FDUDWWHUL]]DWR GD XQ¶DOWD SURGXWWLYLWj SUHOLHYL RUD SHU SRVWD]LRQH DWWLYD SHU XQ PDVVLPR GL SRVWD]LRQLHGXQDFDSDFLWjGLVWRFNGLROWUHFDVVHWWH
•
QHOO¶DUHDGHGLFDWDDLSURGRWWLDGDOWRYROXPHRDOWRSHVRVRQRVWDWHFROORFDWHVFDIIDODWXUHSRUWDSDOOHW
SRFRPHQRGLSRVWD]LRQL
/¶DWWLYLWj GHO QXRYR PDJD]]LQR GL $UHD 9DVWD KD DYXWR LQL]LR O¶ OXJOLR FRQFOXVR LO ODYRUR GL DOOHVWLPHQWR
LQWHUQRHGKDULJXDUGDWRQHOO¶LPPHGLDWRWUH$]LHQGH$]LHQGD86/GL5HJJLR(PLOLD$]LHQGD2VSHGDOLHUD
GL 5HJJLR (PLOLD $]LHQGD 86/ GL 0RGHQD LQ TXRWD SDUWH 7DOL $]LHQGH XWLOL]]DYDQR JLj L VHUYL]L GHO
PDJD]]LQRSUHFHGHQWHPHQWHDWWLYRSUHVVRO¶$]LHQGD86/GL5HJJLR(PLOLD
•
$OOD PHWj GL VHWWHPEUH VL q FRPSOHWDWR O¶LQJUHVVR GHOO¶$]LHQGD 86/ GL 0RGHQD WHUULWRULR HG 2VSHGDOL GL
9LJQROD H 3DYXOOR QHO ULVSHWWR GHO SURJUDPPD GHILQLWR &RQWHPSRUDQHDPHQWH q VWDWD DVVXQWD DQFKH OD
FRPSOHWD JHVWLRQH GHOOD PHUFH LQ WUDQVLWR GHOOH $]LHQGH LQ TXHVWLRQH /H DOWUH $]LHQGH HQWUHUDQQR
VHFRQGRLOSURJUDPPDVWDELOLWRQHOFRUVRGHOO¶DQQR
/¶LQJUHVVR GL FLDVFXQD $]LHQGD SHU TXDQWR SDU]LDOH KD FRPSRUWDWR XQ SUHOLPLQDUH LQWHQVR H SXQWXDOH
ODYRURVXWUHYHUVDQWL
PHVVD D SXQWR GHOOH LQWHUIDFFH LQIRUPDWLFKH SHU OD JHVWLRQH GHJOL VFDPEL LQIRUPDWLYL WUD L JHVWLRQDOL
D]LHQGDOLHTXHOORGHOPDJD]]LQR
•
DOOLQHDPHQWRGHOOHFRGLILFKHGHLSURGRWWLD]LHQGDOLFRQTXHOOHGHOPDJD]]LQR
•
DVVXQ]LRQHGDSDUWHGHOO¶$]LHQGD86/GL5HJJLR(PLOLDGHOODJHVWLRQHDPPLQLVWUDWLYDFRQWUDWWLSUH]]L
IRUQLWRULGLFRPSHWHQ]DGLFLDVFXQDGHOOHD]LHQGHVHUYLWHGDOPDJD]]LQR
4XHVWDIDVHKDFRPSRUWDWRODGHILQL]LRQHGLXQDPHWRGRORJLDGLDSSURFFLRHVXFFHVVLYDPHQWHXQODYRUR
RSHUDWLYRFKHKDQQRLPSHJQDWRULOHYDQWLULVRUVH
•
/y
ƉƉĞŶĚŝĐĞ
$ ILQH DQQR LO PDJD]]LQR DYHYD ROWUH UHIHUHQ]D D VFRUWD H JHVWLYD FLUFD RUGLQL LQ WUDQVLWR DO
JLRUQR
$FTXLVWLFHQWUDOL]]DWL
,OVHWWRUHGHJOLDFTXLVWLqVWDWRVLFXUDPHQWHXQDPELWRSULRULWDULRGHOO¶DWWLYLWjGL$9(1SHUO¶DQQR/D
VRWWRVFUL]LRQH GHOOD &RQYHQ]LRQH $WWXDWLYD DYYHQXWD LQ FRUVR G¶DQQR LVWLWXWLYD GHO 'LSDUWLPHQWR
,QWHUD]LHQGDOH$FTXLVWL',$DYDOHQ]DJHVWLRQDOHKDSHUPHVVRGDXQODWRGLFRQVROLGDUHXOWHULRUPHQWH
O¶DWWLYLWj FRPXQH GL DFTXLVWR GL EHQL H VHUYL]L GDOO¶DOWUR GL DYYLDUH XQ SHUFRUVR GL UD]LRQDOL]]D]LRQH
RUJDQL]]DWLYDGHVWLQDWRDSURGXUUHLSULPLULVXOWDWLQHOFRUVRGHO
&RQPDJJLRUHIRU]DqVWDWRSRVVLELOHDYYLDUHXQSURFHVVRGLSURJUDPPD]LRQHFRHUHQWHHGLQWHJUDWRWUDOH
GLYHUVH $]LHQGH H VHPSUH SL VWUHWWDPHQWH FRQQHVVR HG LQWHUGLSHQGHQWH FRQ TXHOOR GHOOD FHQWUDOH GL
FRPPLWWHQ]DUHJLRQDOH,QWHUFHQW(5
6X TXHVW¶XOWLPR YHUVDQWH LQWHQVD q VWDWD O¶DWWLYLWj GL FRRUGLQDPHQWR H GL UDFFRUGR WUD OD 'LUH]LRQH
2SHUDWLYD $9(1 OD GLUH]LRQH GHO ',$ H TXHOOD GL ,QWHUFHQW(5 FRVu FRPH FRQWLQXD OD SDUWHFLSD]LRQH GHL
SURIHVVLRQLVWLQRPLQDWLGDOOH'LUH]LRQL$]LHQGDOLDOOHDWWLYLWjGHOOHFRPPLVVLRQLHJUXSSLGLODYRURFRQYRFDWL
GD,QWHUFHQW(5
(¶ VWDWR SHUIH]LRQDWR XQR VWUXPHQWR SHU ULOHYDUH H JRYHUQDUH OH WHPSLVWLFKH GL JDUD SHU JDUDQWLUQH XQ
PLJOLRUDPHQWRPHGLDQWHORVYLOXSSRGHOOHFDSDFLWjGLIDUODYRUDUHLQVLQHUJLDLYDULSURIHVVLRQLVWLFRLQYROWL
QHOOH SURFHGXUH GL JDUD FRQ SDUWLFRODUH ULIHULPHQWR D FRORUR FOLQLFL IDUPDFLVWL LQJHJQHUL FOLQLFL FKH
SUHVLHGRQRDOOHIDVLGLVHOH]LRQHYDOXWD]LRQHGHLSURGRWWLGHILQL]LRQHGHLUHTXLVLWLHGHOOHHVLJHQ]HFOLQLFKH
/H SHUIRUPDQFH FRPSOHVVLYH ULOHYDWH SHU TXDQWR OHJJHUPHQWH PLJOLRUDWH ULVSHWWR DOO¶DQQR SUHFHGHQWH
SUHVHQWDQRDQFRUDVLJQLILFDWLYLPDUJLQLGLRWWLPL]]D]LRQH
1HOOR VSHFLILFR LQROWUH YD VRWWROLQHDWR LO FRQWULEXWR IRUQLWR DOOR VYROJLPHQWR GHOOH JDUH GDO JUXSSR GHL
IDUPDFLVWLFRQVSHFLILFDFRPSHWHQ]DHFRQRVFHQ]DQHOVHWWRUHGHL'LVSRVLWLYL0HGLFL'0HGDTXHOORGHJOL
,QJHJQHUL&OLQLFL
(¶ VWDWR LQROWUH FRPSOHWDWR LO ODYRUR SHU OD PHVVD D SXQWR GL XQ VLVWHPD SHU OD SURGX]LRQH GL XQD
UHSRUWLVWLFDLQHUHQWHJOLHVLWLGLJDUDHODYDOXWD]LRQHGHOODSHUIRUPDQFHGLWDOHDWWLYLWj
&RQ ULIHULPHQWR DOOH SROLWLFKH GL DFTXLVWR GL EHQL H VHUYL]L FRHUHQWHPHQWH FRQ TXDQWR JLj SUDWLFDWR
QHJOL DQQL VFRUVL H FRQ JOL LQGLUL]]L UHJLRQDOL OH $]LHQGH $9(1 KDQQR RSHUDWR SHU UDJJLXQJHUH O¶RELHWWLYR
GHOOD SURJUHVVLYD ULGX]LRQH GHOOH JDUH D]LHQGDOL DIDYRUH GHOO¶DGHVLRQH DOOHJDUH DJJUHJDWH $UHD 9DVWD R
,QWHUFHQW(5/D7DEHOODFKHVHJXHULDVVXPHQXPHULFDPHQWHO¶DWWLYLWjVYROWDUHODWLYDPHQWHDOOHJDUHGL
$UHD9DVWDHGLULVXOWDWLHFRQRPLFLFRQVHJXLWL
1*DUHSURJUDPPDWHSHULOELHQQLR±
1*DUHDJJLXGLFDWHQHOO¶DQQR
1*DUHQRQDJJLXGLFDWHRGHVHUWH
13URFHGXUHLQFRUVRGLVYROJLPHQWRDO
13URFHGXUHLQFRQWHQ]LRVRDPPLQLVWUDWLYR
1*DUHDYYLDWHDO
1*DUHSURJUDPPDWHDQFRUDGDDYYLDUH
9DORUH GHL FRQWUDWWL GHILQLWL QHO FRUVR GHOO¶DQQR
6WLPDGHLULVSDUPLLQGRWWL
13URFHGXUHGL3URURJD5LQQRYRFRQFOXVHQHO
5HODWLYDPHQWH DOOH DGHVLRQL DOOH FRQYHQ]LRQL ,QWHUFHQW ± (5 LO YDORUH FRPSOHVVLYR GHJOL ³RUGLQDWLYL GL
IRUQLWXUD´ HPHVVL GDOOH $]LHQGH DVVRFLDWH DOO¶$9(1 ULVXOWD SDUL DG ¼ VL DOOHJD WDEHOOD
ULDVVXQWLYD UHODWLYD DOOH DGHVLRQL GHOOH GLYHUVH D]LHQGH DOOD VSHFLILFKH FRQYHQ]LRQL DYYHQXWH QHO FRUVR
GHOO
DQQR
ƉƉĞŶĚŝĐĞ
,QWHJUD]LRQHLQDPELWRDPPLQLVWUDWLYR±JHVWLRQDOHHFOLQLFRDVVLVWHQ]LDOH
6RQR SURVHJXLWH VLD SXUH FRQ PRGDOLWj GLYHUVLILFDWH IUD JUXSSR H JUXSSR OH DWWLYLWj ILQDOL]]DWH DO
UDJJLXQJLPHQWR GL RELHWWLYL GL LQWHJUD]LRQH VLD LQ DPELWR DPPLQLVWUDWLYR±JHVWLRQDOH FKH FOLQLFR±
DVVLVWHQ]LDOH
y
,Q SDUWLFRODUH VRQR VWDWH VRWWRVFULWWH GDL 'LUHWWRUL *HQHUDOL TXDWWUR &RQYHQ]LRQL $WWXDWLYH ROWUH D TXHOOD
UHODWLYDDO'LSDUWLPHQWR,QWHUD]LHQGDOH$FTXLVWLDYDOHQ]DJHVWLRQDOHGLFXLVLqWUDWWDWRLQSUHFHGHQ]DFRQ
O¶LQWHQWRGLUDIIRU]DUHODFROODERUD]LRQHLQDPELWLULWHQXWLVWUDWHJLFL
JHVWLRQH FRPXQH GHL FRQFRUVL UHODWLYL DO SHUVRQDOH GHO FRPSDUWR q VWDWR GHFLVR SHU HFRQRPLD GL
JHVWLRQH HG HIILFDFLD GHOOD VWHVVD GL FRQGLYLGHUH SURFHGXUH FRPXQL SHU OR VYROJLPHQWR GHL FRQFRUVL
UHODWLYL DO SHUVRQDOH GHO FRPSDUWR $OO¶LQWHUQR GHOOD &RQYH]LRQH VRQR VWDWH GHILQLWH OH PRGDOLWj
RSHUDWLYHSHUORVYROJLPHQWRFRPXQHGHLFRQFRUVLHGLOVXFFHVVLYRXWLOL]]RGHOOHJUDGXDWRULH
•
&RRUGLQDPHQWR GHL 'LSDUWLPHQWL6HUYL]L )DUPDFHXWLFL FRQ O¶RELHWWLYR GL JDUDQWLUH XQD FRVWDQWH
LQWHJUD]LRQH WUD OH $]LHQGH UHODWLYDPHQWH DOOH FRPSHWHQ]H GL DPELWR IDUPDFHXWLFR QRQFKp XQ
DGHJXDWRVXSSRUWRDOSURFHVVRGLFHQWUDOL]]D]LRQHGHJOLDFTXLVWL
•
&RRUGLQDPHQWR GHL 6HUYL]L GL ,QJHJQHULD &OLQLFD SHU JDUDQWLUH XQD FRQWLQXD FROODERUD]LRQH SHU OH
DWWLYLWj FRQQHVVH DOO¶DFTXLVL]LRQH H JHVWLRQH GHOOH DSSDUHFFKLDWXUHWHFQRORJLH VDQLWDULH QRQFKp OD
JHVWLRQHXQLWDULDHGLQWHJUDWDGHOOHDWWLYLWjFRQQHVVHDOO¶DFTXLVWRGHOOHDSSDUHFFKLDWXUHVDQLWDULHHGHL
GLVSRVLWLYLPHGLFLGLFRPSHWHQ]D
•
&RRUGLQDPHQWR GHL 6HUYL]L )RUPD]LRQH D FXL DIILGDUH OD SURJHWWD]LRQH H OD UHDOL]]D]LRQH GL HYHQWL
IRUPDWLYLGLLQWHUHVVHFRPXQHHODSURJHWWD]LRQHHUHDOL]]D]LRQHFRQJLXQWDGHLFRUVL)$'
, JUXSSL DWWLYL VLD GL DUHD DPPLQLVWUDWLYRJHVWLRQDOH FKH FOLQLFRJHVWLRQDOH KDQQR VYLOXSSDWR XQ SURILFXR
ODYRURGLFRQIURQWRODFXLDWWLYLWjSXzHVVHUHULFRQGRWWDDGDOFXQLDPELWLSULQFLSDOL
•
LQWHUSUHWD]LRQH HG DSSOLFD]LRQH RPRJHQHD GHOOD QRUPDWLYD LQ TXHVWR DPELWR VL VHJQDODQR LQ
SDUWLFRODUHOHDWWLYLWjVYROWHGDLJUXSSLGHLUHVSRQVDELOLGHOSHUVRQDOHGHOODOLEHUDSURIHVVLRQHHGHJOL
RGRQWRLDWUL(¶VWDWRDYYLDWRXQFRQIURQWRDQFKHLQPDWHULDGLWUDVSDUHQ]DHGDQWLFRUUX]LRQH
•
HODERUD]LRQHGLVSHFLILFLSURJHWWLYDQQRULFRUGDWLTXHOOLLQWUDSUHVLGDOJUXSSRGHLODERUDWRULVWLJDUHLQ
FRPXQH PRQLWRUDJJLR DSSURSULDWH]]D HG DFFHQWUDPHQWRHVDPL UDUL H GDO JUXSSR GHL )LVLFL 6DQLWDUL
VWXGLRULVFKLRUDGLRORJLFRHVRUYHJOLDQ]DGRVLPHWULFDVWXGLRPRGDOLWjGLFRQWUROORDWWLYLWjGHOOH501
,O JUXSSR 5LDELOLWD]LRQH H TXHOOR 3HUFRUVR 1DVFLWD KDQQR FRQWLQXDWR OD ORUR DWWLYLWj VHFRQGR TXDQWR
SUHYLVWRGDOOHOLQHHGLLQGLUL]]RUHJLRQDOH
•
FRQIURQWRVXWHPLVSHFLILFLSHUO¶DGR]LRQHGHOOHPLJOLRULSUDWLFKHLQGLYLGXDWHSDUWLFRODUPHQWHDWWLYLLQ
PDWHULD LO JUXSSR JHVWLRQH GHO 5LVFKLR &OLQLFR H TXHOOR GHOOD 0HGLFLQD /HJDOH $QDORJDPHQWH q VWDWR
FRVWLWXLWR XQ JUXSSR SHU O¶DQDOLVL H GLIIXVLRQH GHOOH PLJOLRUL SUDWLFKH UHODWLYDPHQWH DOO¶DPELWR GHOOD
SURWHVLFD WHUULWRULDOH (¶ SURVHJXLWR LO FRQIURQWR DQFKH DOO¶LQWHUQR GHL JUXSSL GHOOH 'LUH]LRQL
,QIHUPLHULVWLFKHHGHLUHVSRQVDELOLGHOOD6SHFLDOLVWLFD
•
VYLOXSSR GL DWWLYLWj FRPXQL HG DGR]LRQH GL PRGHOOL RUJDQL]]DWLYL LQWHJUDWL ROWUH D TXHOOL OHJDWL DOOH
&RQYHQ]LRQL$WWXDWLYHGLFXLVLqGHWWR)RUPD]LRQHFRQFRUVLFRPSDUWRYDQQRULFRUGDWHOHDWWLYLWjGD
WHPSRDYYLDWHGLSURJUHVVLYDXQLILFD]LRQHGHLFRQWUDWWLGLPDQXWHQ]LRQHVLDGLDPELWRLQIRUPDWLFRFKH
UHODWLYLDOOHDSSDUHFFKLDWXUHELRPHGLFDOL
9DLQILQHVHJQDODWRFKHVLqFRQFOXVRORVWXGLRSHUODUHDOL]]D]LRQHGLXQ¶XQLFDFHQWUDOHRSHUDWLYDWUD
OH $]LHQGH GL 3LDFHQ]D 3DUPD H 5HJJLR (PLOLD HG q LQ FRUVR O¶HODERUD]LRQH GHO SURJHWWR SHU OD
UHDOL]]D]LRQHGHOFHQWURXQLFRGLSURGX]LRQHVDQJXHHGHPRFRPSRQHQWL
y/
ƉƉĞŶĚŝĐĞ
•
>>'dKE͘ϭ^,DZ/^^hEd/sK^/KEKEsE/KE//EdZEdZEEKϮϬϭϯ
OGGETTO CONVENZIONE
SERVIZIO DI TELEFONIA FISSA E TRASMISSIONE DATI
SERVIZI DI TELEFONIA MOBILE 2
ACQUISTO AUSILI PER INVALIDI
FORNITURA DI CARBURANTE PER AUTOTRAZIONE 2
FORNITURA DI ECOTOMOGRAFI
ACQUISTO VESTIARIO 2
ACQUISTO ARREDI SANITARI
SERVIZI DI VIGILANZA, PORTIERATO E MANUT.IMP.3
FORNITURA PRESIDI SOTTOV.PRELIEVO SANGUE
FORNITURA ANTISETTICI E DISINFETTANTI 2
FORNITURA DI PERSONAL COMPUTER NOTEBOOK 5
VACCINI_2011_2014
FORNITURA DI SISTEMI ANTIDECUBITO 2
FORNITURA FILGRASTIM
PERSONAL COMPUTER DESKTOP 5
SISTEMI INFUSIONALI
VACCINI_2011_2014
SOMATROPINA 2
NOLEGGIO FOTOCOPIATRICI 4
ENDOPROTESI CORONARICHE 2
CANCELLERIA 3
FORNITURA DI GAS NATURALE 3
PRODOTTI PER NUTRIZIONE ENTERALE
AUTOMEZZI 3
LENTI INTRAOCULARI E MATERIALE VISCOELASTICO
VACCINO MENINGOCOCCO
FARMACI AVEN 2017
FARMACI ESCLUSIVI 2017
SERVICE DI NUTRIZIONE ENTERALE
DIABETOLOGIA OSPEDALIERA
PC NOTEBOOK 6
GAS NATURALE 5
VACCINI ANTIINFLUENZALI
SISTEMI ANALITICI PER FOBT 2
ENERGIA ELETTRICA 6
PRODOTTI CARTARI, DETERG. E MAT. PER COMUNITA' 2
SEGNALETICA PER AZIENDE SANITARIE 2
NOLEGGIO AUTO CON CONDUCENTE
TOTALI
AUSL PC
0,00
4.336,80
0,00
0,00
128.063,10
7.618,00
150.745,50
0,00
0,00
0,00
3.031,00
0,00
0,00
0,00
0,00
0,00
0,00
0,00
0,00
98.610,00
0,00
0,00
451.109,19
63.133,00
522.741,00
0,00
20.839.286,49
0,00
0,00
94.738,25
0,00
53.536,00
251.941,51
122.200,00
1.287.815,50
156.079,48
68.769,70
0,00
24.303.754,52
AUSL PR
0,00
7.722,00
0,00
0,00
111.016,60
15.908,38
46.055,00
0,00
0,00
0,00
4.872,00
12.337,00
3.570,00
0,00
52.730,60
53.100,00
19.530,00
105.094,50
89.498,40
0,00
140.000,00
0,00
90.121,52
215.707,00
418.115,00
3.800,00
12.622.320,04
0,00
2.523.457,80
69.716,80
16.320,00
0,00
299.913,95
220.900,00
947.579,80
133.146,24
0,00
0,00
18.222.532,63
AOU PR
0,00
23.413,20
0,00
0,00
20.162,50
0,00
236.792,00
0,00
0,00
6.812,50
0,00
0,00
0,00
32.550,00
9.150,20
0,00
2.473,80
0,00
14.279,16
439.401,30
0,00
0,00
28.562,95
20.952,00
917.310,00
0,00
21.670.847,99
0,00
0,00
94.609,40
0,00
0,00
0,00
0,00
2.777.739,30
186.023,30
11.615,57
0,00
26.492.695,17
AUSL RE
0,00
1.840,00
0,00
164.855,00
8.488,00
0,00
10.030,00
740.906,70
0,00
0,00
0,00
0,00
0,00
0,00
0,00
0,00
0,00
437.505,60
301.904,60
0,00
180.000,00
0,00
661.941,33
1.301.388,00
1.042.960,00
0,00
89.101.091,59
2.577.966,51
1.702.952,10
442.064,40
0,00
0,00
371.677,70
75.200,00
1.627.108,67
0,00
14.504,45
0,00
100.764.384,64
AO RE
49.495,00
68.270,40
262,00
0,00
178.313,48
308,00
162.195,00
0,00
1.040,00
0,00
0,00
0,00
90.000,00
0,00
0,00
0,00
0,00
0,00
90.246,80
360.950,40
0,00
0,00
0,00
0,00
252.690,00
0,00
0,00
0,00
0,00
0,00
0,00
0,00
0,00
157.920,00
1.609.977,48
0,00
0,00
0,00
3.021.668,56
AUSL MO
0,00
6.080,80
0,00
0,00
464.389,20
0,00
270.409,10
0,00
0,00
0,00
0,00
1.610,70
0,00
67.570,00
146.603,20
0,00
0,00
0,00
193.971,00
461.526,50
95.070,00
518,55
185.413,26
106.905,00
1.023.900,00
0,00
0,00
0,00
1.726.920,00
0,00
0,00
2.245.852,63
552.227,50
0,00
1.824.230,71
694.671,59
0,00
0,00
10.067.869,74
AO MO
0,00
150,00
0,00
1.589,43
26.997,71
35.908,69
12.044,50
0,00
0,00
0,00
0,00
0,00
0,00
0,00
46.212,50
0,00
0,00
0,00
26.535,40
326.672,60
128.000,00
0,00
100.047,08
0,00
357.212,60
0,00
0,00
0,00
0,00
0,00
0,00
729.942,17
840,00
0,00
804.590,53
452.719,80
0,00
49.000,00
3.098.463,01
TOTALE
49.495,00
111.813,20
262,00
166.444,43
937.430,59
59.743,07
888.271,10
740.906,70
1.040,00
6.812,50
7.903,00
13.947,70
93.570,00
100.120,00
254.696,50
53.100,00
22.003,80
542.600,10
716.435,36
1.687.160,80
543.070,00
518,55
1.517.195,33
1.708.085,00
4.534.928,60
3.800,00
144.233.546,11
2.577.966,51
5.953.329,90
701.128,85
16.320,00
3.029.330,80
1.476.600,66
576.220,00
10.879.041,99
1.622.640,41
94.889,72
49.000,00
185.971.368,27
>>'dKE͘Ϯ^/d/'ZZs^dEEKϮϬϭϯ
'()*+,'.'/01)2'
9
M
U
R
H
S
9
M
U
R
H
S
'0-6*
'0-6*
'0-6*
'0-6*
'0-6*
'0-6*
G
G '0-6*
Q
Q '0-6*
K
K '0-6*
033*440
1:;<=>?;@-@-A:BB=<=A>;@C=:<D-E=-A=A>DB=-E=-B:<=>:;@FF=:
1:;<=>?;@-@-A:BB=<=A>;@C=:<[email protected]=P@>:;=-E=-PO=N-ND;[email protected]@;:AP:N=@
'AA=A>D<C@-D-B@<?>D<C=:<D-7V-)3-.0+7524)+3
7D;W=C=-E=-B@<?>D<C=:<[email protected]:X>Y@;D-/603*2
'AA=A>D<C@-D-B@<?>D<C=:<D-7V-,@>@-/;:PDAA=<F
Z'.55[-4\*6'/]-^[[email protected]=:<D-A:>>:W?:>:_
7*6Z)()-,)-['+54*+()0+*-,-'77)74*+('-4*.+).'-1522-6)7`-/*640[04*6'/)'-*2).0),'2*
7D;W=C=-E=-B@<?>D<C=:<[email protected]=A>D<C@->DP<=P@[email protected]@;@>=-;@E=:O:F=P=-/a=O=NA
1:;<=>?;@-7:X>Y@;[email protected]=P@>=W:-ND;-=O-N;:PDAA:-E=-EDB@>D;[email protected][email protected]=:<D-ED=-E:P?BD<>=-
,56'4'- 7/*7'-'++5'-/074- 7/*7'-404'2*-/074- 7/*7'-'++5'-/6*3'6'
3'6'
3'6'
'++)
7/*7'-404'2*-/6*,)11*6*+('-'++5' ,)11*6*+('-404'2*
3'6'
JLJJ
TSMIM9MLHJTMHIJ9QLHSJLJJ
MJIRSRLKK
TMMKIQHJLJ9-
JLJJ
TSMIM9MLHJTMHIJ9QLHSJLJJ
MJIRSRLKK
TK9KIRJJLJR-
8
9
9
9
9
9
R
GHIJK9LJK
QGIGHJLJJ
MGUIHKJLJJ
R9JIRUGLSJ
H9MIRSHLJJ
HJJISHJLJJ
GHIJK9LJK
QGIGHJLJJ
MGUIHKJLJJ
R9JIRUGLSJ
H9MIRSHLJJ
MIJJMISJJLJJ
GHIJK9LJK
9RKIKSMLHJ
MKQISJQLHS
R9JIRUGLSJ
RKMIJJJLJ9
GUJIHJJLJ9
GHIJK9LJK
9RKIKSMLHJ
MKQISJQLHS
R9JIRUGLSJ
RKMIJJJLJ9
MIKMMIJJJLJR
JLJJ
TR9LRK
TQLUQ
JLJJ
RL9S
TU9LRS
9
MIKKJIUGSLJJ
MIKKJIUGSLJJ
UIJJJIJJJLJJ
UIJJJIJJJLJJ
TKISMRLJJ-
TKISMRLJJ-
TJLUM
M
MIQRRIKKJLHU
HISQKIKQ9LJS
UIJHGIUKMLMU
SI99RIGQRLRS
TM9MIRJ9LGJ-
TRMRIQJULRJ-
TSLKH
@BBIW=
7D;W=C=-E=-B@<?>D<C=:<[email protected]@-7:X>Y@;D-7)+10
1:;<=>?;@-E=-AD>-P:BN@>=b=O=-P:<-/:BND-4*65[0
1:;<=>?;@-7?NN:;>=-ND;-4D;@N=@
1:;<=>?;@-E=-7:<ED-ND;-<?>;=C=:<D->;@<[email protected]>;=P@-E=F=?<@[email protected]?O>=-D-NDE=@>;=P=
1:;<=>?;@-7D>-P:<[email protected]=O=-P:BN@>=b=O=-P:<->=;@O@>>D-B:EDOO:-7=BNa:<c-D-7Y=<F
,=AN:A=>=W=-B:<:?A:-ND;-;DP?ND;:-N:O=N=-D-P:;N=-DA>;@<D=--=<-D<E:AP:N=@
1:;<=>?;@-PO=N-DB:A>@>=P@-;=N:A=C=:<@b=OD-ND;-D<E:AP:N=@-E=FDA>=W@
1=O:-3?=E@-Z)7)32),*
1:;<=>?;@[email protected]:DB?AO=X=P@>:;DdW=>;DP>:B:-N:A>D;=:;D-7>DOO@;=A/.
1@;[email protected]:-DA>D;:-',.*46)7
[@>D;[email protected]=-P:<A?B:-^`=>_-ND;-Z=>;DP>:B:-'2.0+-)4'2)'
U
MJIQMMLSG
SMIRSQLJJ
MJIQMMLSG
SMIRSQLJJ
JLJJ
JLJJ
JLJJ
M
9
M
U
M
U
U
U
M
9
M
MGGIHKHLRJ
KI9GSLJJ
HJIKKMLUJ
URIJQJLJJ
S9IRQQLJJ
HRIMRJLJJ
HGISQJLJJ
KSIUHJLJJ
9RKIJJJLJJ
RQUIMQHLJJ
MQSI9GJLJJ
HHHI9KJLQJ
KI9GSLJJ
9J9IKQRLSJ
9JMIMRJLJJ
9MMIKGSLJJ
9SMIGMJLJJ
9GUIJRJLJJ
MQKIJHJLJJ
MKQIJJJLJJ
RQUIMQHLJJ
HGMIURJLJJ
MGGIHKHLRJ
KI9GSLJJ
H9IH9MLRU
UGIGHRLRQ
GUIMJJLJJ
KUIJHHLJJ
HQIQJJLJJ
KSIUHJLJJ
9RKIJJJLJJ
RQUIMQHLJJ
URQIRQJLJJ
HHHI9KJLQJ
KI9GSLJJ
9JUIJMRLQS
99UIMSULRR
9RSIRJJLJJ
MGKI9SHLJJ
9GSIRJJLJJ
MQKIJHJLJJ
MKQIJJJLJJ
RQUIMQHLJJ
SKSIKSJLJJ
JLJJ
JLJJ
THMJL9UTUISGRLRQT99IG9MLJJTUQIQ9HLJJT9I9MJLJJJLJJ
JLJJ
JLJJ
TSMIU9JLJJ-
JLJJ
JLJJ
T9IJRJLMST99IJMULRRTMUIRMRLJJT99SIRRHLJJTUIUSJLJJJLJJ
JLJJ
JLJJ
T9MRISMJLJJ-
JLJJ
JLJJ
T9LJ9
TKLGU
T9SLJJ
TR9LG9
T9LKJ
JLJJ
JLJJ
JLJJ
T9GLQQ
M9 99 '05-[0
7D;W=C=-E=-B@<?>D<C=:<[email protected]>DP<=P@-*2*`4'
M
R9GIJHMLJ9
QURI9JRLJM
RJSIQQJLJJ
Q9UIGSJLJJ
9JI9GMLJ9
MJIURRLJM
MLHJ
MM 9M '05-[0
7*6Z)()-,)-['+54*+()0+*-*,-'77)74*+('-4*.+).'-,)44'-/*+4'e
M
SHMIUSQLRS
9IUJRIGUSLKM
SHQIUSQLRS
9IU9SIGUSLKM
TSIJJJLJJ-
T9MIJJJLJJ-
TJLK9
MU 9U '05-[0
7*6Z)()-,)-['+54*+()0+*-*,-'77)74*+('-4*.+).'-,)44'-02][/57
M
QKMISRRLSG
9IGQHIMQKLUR
K9HIHUMLKQ
9IQU9IJSHLKS
TMMIQQQLU9-
TRHIGGSLSM-
TMLHJ
MR 9R '05-[0
MH 9 '05-/6
MS M '05-/6
MG U '05-/6
MQ R '05-/6
MK H '05-/6
UJ S '05-/6
'AA=A>D<C@-D-B@<?>D<C=:<D-7V-,*,'257
7D;W=C=-E=-B@<?>D<C=:<[email protected]>DP<=P@-['f5*4
7D;W=C=-E=-B@<?>D<C=:<[email protected]>DP<=P@-*7'04*
7D;[email protected][email protected];F:O:F=@
7D;W=C=-E=-B@<?>D<C=:<[email protected]>DP<=P@-7)*[*+7
/;:>DA=-0;>:NDE=PaD-ND;-@<P@-^'0-/6_
7D;W=C=-E=-B@<?>D<C=:<[email protected]@->DP<=P@[email protected]=PD>;@AB=>>D<>=-D-6D>[email protected]=:
M
R
R
R
R
U
R
9IRHRIMQULUJ
U9RIQ9KLHR
SJRIUKULSU
QKKIQHULSJ
MIJ9SIKSKL9G
GIGSSIKJQLSG
9HJIRQJLJJ
MIKJQIHSSLSJ
9IMHKIMGQL9S
MIR9GIHGRLHM
UIHKKIR9RLRJ
QIJSGIQGSLSQ
MUIUJJIGMSLJJ
SJ9IKMJLJJ
9IHSUIJSRLKJ
UHQISQSLKH
GJSI9RKLQM
KM9IJJJLJJ
MIJRHIMJSLGR
SIJUJIQGULHJ
9HMIJJJLJJ
UI9MSI9MKLQJ
9IRURIGRGLQJ
MIQMRIHKKLMQ
UISQRIJJJLJJ
QI9QJIQMSLKS
9QIJKMISMJLHJ
SJQIJJJLJJ
T9JQIGQ9LSJTRUIQSGLR9T9J9IGHSL9KTM9I9RSLRJTMQIMUGLHGT9IGUSIJUHL9GT9IHMJLJJ-
TM9GIHSULMJT9GHIRSKLSRTRJGIJMRLGSTQRIHQHLSJT99MIKHJLMQTHIMJQI9JHLHJTSIJQJLJJ-
TSLKS
T9MLMU
T9RLR9
TMLUJ
T9LUQ
TMMLUH
T9LJJ
ƉƉĞŶĚŝĐĞ
9J 9J '0-6*
99 9 '05-[0
9M M '05-[0
9U U '05-[0
9R R '05-[0
9H H '05-[0
9S S '05-[0
9G G '05-[0
9Q Q '05-[0
9K K '05-[0
MJ 9J '05-[0
y//
U9
9 '572-[0
033*440
7*6Z)()-,)-['+54*+()0+*-*,-'77)74*+('-4*.+).'-g0\+70+-h-
g0\+70+-[*,).'2
M '572-[0 .'64*-7'+)4'6)*-06)3)+'2)-70+]-*-[)475i)7\)
,*1)i6)22'406)-)[/)'+4'i)2`)-[6)-.0[/'4)i)2)-[0,I-25['e-,)44'U '572-[0
i)0460+).
R '572-[0 1@;[email protected]:-6*[0,52)+
H '572-[0 7*6Z)()-,)-['+54*+()0+*-*,-'77)74*+('-4*.+).'-15)g1)2[
S '572-[0 1@;[email protected]:-25.*+4)7
,DX=b;=OO@>:;=-=BN=@<>@b=O=-D-E=AN:A=>[email protected]=-P:<<[email protected]@jD;-DEG '572-[0
DOD>>;:P@>D>D;=
Q '572-[0 1:;<=>?;@-E=-4DP<:O:F=D-7@<=>@;=D-ND;-@<@O=A=-EDPD<>;@>D-^/:.4__
7D;W=PD-FDA>=:<D-P:<>;:OO@>@-EDOO@->DBND;@>?;@[email protected]=D<>D-P:<->DP<:O:F=@-=<[email protected][email protected] '572-[0
^'572-[0_
UM
UU
UR
UH
US
UG
UQ
UK
RJ 9J '572-[0 7D;W=C=-E=-B@<?>D<C=:<[email protected]@->DP<=P@-3*-7]74*[
R9
RM
RU
RR
RH
RS
RG
RQ
RK
HJ
H9
9
M
U
R
H
S
9
M
U
R
H
'572-/.
'572-/.
'572-/.
'572-/.
'572-/.
'572-/.
'572-/6
'572-/6
'572-/6
'572-/6
'572-/6
3?@<>=-=<-W=<=OD-AD<C@-N:OWD;D-A>D;[email protected]=EDA>;:
.D;@-ND;-0AA@
7D;W=C=-E=-B@<?>D<C=:<D-7:X>Y@;D-)+10T2)+*
1:;<=>?;@-bD<[email protected]:AA=E:-E=-C=<P:L-N;:E:>>=-W@;=-ND;[email protected]=:<D-DE-=F=D<D
1:;<=>?;@-E=A=<XD>>@<>=-<:<-P:BN;DA=-<DOO@-.:<WD<C=:<D-)<>D;PD<>T*6
)BNODBD<>@C=:<D-,:P7?=>DVDb-,=>>@-Z*.0[/-7:X>Y@;D
/;:PDE?;@-<DF:C=@>@-ND;-A=A>DB=-E=-ED@;>D;[email protected][email protected]=:<D-DB:N;;:=E=-4\,
7D;W=C=-'AA=P?;@>=W=-'OO-6=Aj-/;:ND;>c
2@<PD>>D-N?<F=E=>:-ND;-7j=<-/;=Pj-4DA>
1:;<=>?;@-E=-B@>D;[email protected]=-P:<A?B:-ND;-7>D;=O=CC@>;=P=-74*6)7-7]74*[
7D;W=C=-E=-B@<?>D<C=:<[email protected]>DP<=P@-.'6*746*'[
,56'4'- 7/*7'-'++5'-/074- 7/*7'-404'2*-/074- 7/*7'-'++5'-/6*3'6'
3'6'
3'6'
'++)
M
QHIMJJLGG
9GJIRJ9LHR
KKIRURLSS
7/*7'-404'2*-/6*,)11*6*+('-'++5' ,)11*6*+('-404'2*
3'6'
9KQIQSKLUM
T9RIMUULQK-
TMQIRSGLGQ-
8
T9RLU9
9
9QKIJM9LKJ
9QKIJM9LKJ
9QSIMSMLGH
9QSIMSMLGH
MIGHKL9H
MIGHKL9H
9LRQ
9
RQ9IJJJLJJ
RQ9IJJJLJJ
RQ9IJJJLJJ
RQ9IJJJLJJ
JLJJ
JLJJ
JLJJ
9
R
9
GHMI9MMLJJ
S99IQGQLHK
MIRKUIGG9L9M
GHMI9MMLJJ
MIRRGIH9RLUS
MIRKUIGG9L9M
GHMI9MMLJJ
S9GIKKGLUG
MIQKSIGJRLJJ
GHMI9MMLJJ
MIRG9IKQKLRQ
MIQKSIGJRLJJ
JLJJ
TSI99QLGQTRJMIKUMLQQ-
JLJJ
TMRIRGHL9MTRJMIKUMLQQ-
JLJJ
TJLKK
T9ULK9
U
GIQMMIKRJLJJ
MUIRSQIQMJLJJ
9MIJKSIS9GLJJ
USIMQKIQH9LJJ
TRIMGUISGGLJJ-
T9MIQM9IJU9LJJ-
TUHLUU
H
9IM99I9HQLQJ
SIJHHIGKRLJJ
9IURJIJJJLJJ
SIGJJIJJJLJJ
T9MQIQR9LMJ-
TSRRIMJSLJJ-
TKLSM
U
SJIRJJLJJ
9Q9IMJJLJJ
SJIRJJLJJ
9Q9IMJJLJJ
JLJJ
JLJJ
JLJJ
U
MIMM9IJ9HLHS
SISSUIJRSLSQ
MIMM9IJ9HLHS
SISSUIJRSLSQ
JLJJ
JLJJ
JLJJ
9
R
R
9
9
9
9
MLH
H
9
U
MHIQUKLJJ
9MIHJKLMQ
9HMIKMKLQQ
99SIJHULMH
9QRIKKULQJ
USIRJJLJJ
GJIUKJLKG
9IJHRIKHRLJQ
MRIGMMLJ9
HHGIQRMLJR
MUQI9HGLGK
MHIQUKLJJ
HJIJUGL9M
S99IG9KLHM
99SIJHULMH
9QRIKKULQJ
USIRJJLJJ
GJIUKJLKG
MISUGIUQHLMJ
9MUIS9JLJH
HHGIQRMLJR
G9RIRGULUG
MHIQUKLJJ
GKIKKKLKK
9HGISHKLSG
UJJI9KKLRJ
9KSIRMMLUJ
USIRJJLJJ
GRIKRHLKG
9I99GIJ9JLMM
R9IHSKLUJ
HHGIQRMLJR
MR9IMKGLHQ
MHIQUKLJJ
U9KIKKKLKS
SUJISUQLSQ
UJJI9KKLRJ
9KSIRMMLUJ
USIRJJLJJ
GRIKRHLKG
MIGKMIHMHLHH
MJGIQRSLHJ
HHGIQRMLJR
GMUIQKMLGR
JLJJ
TSGIRKJLG9TRIGMKLGKT9QRI9RSL9HT99IRMQLHJJLJJ
TRIHHHLJJTSMIJHSL9RT9SIQRGLMKJLJJ
TUI9UKLGK-
JLJJ
TMSKIKSMLQRT9QIK9KL9ST9QRI9RSL9HT99IRMQLHJJLJJ
TRIHHHLJJT9HHI9RJLUHTQRIMUSLRHJLJJ
TKIR9KLUG-
JLJJ
TQRLUS
TULJJ
TS9LUR
THLQM
JLJJ
TSLJQ
THLHS
TRJLHU
JLJJ
T9LUJ
HM
S '572-/6
[=P;:=<X?A:;=-E=-=<A?O=<@-D-[@>D;[email protected]=-E=-P:<A?B:-ND;[email protected]=D<>[email protected]>=P=-E:B=P=O=@;=
9
MI9RJIK9JLRJ
MI9RJIK9JLRJ
MI9RJIK9JLRJ
MI9RJIK9JLRJ
JLJJ
JLJJ
JLJJ
HU
G '572-/6
,DXO?AA:;=L-A@PPaDL-;@BNDL-;?b=<D>>=-D-N;:O?<FaD-ND;-?A:-A@<=>@;=:
H
9IJHUIHGHLRJ
HIMSGIQGGLJJ
9IRGRIHQSLJJ
GIUGMIKUJLJJ
TRM9IJ9JLSJ-
TMI9JHIJHULJJ-
TMQLHH
HR
Q '572-/6
[@>D;[email protected]=-P:<A?B:-7=A>DB@-E=-;=<>;@[email protected]=O=>!-ED=-O:>>=-EDO-B@>D;[email protected]>D;=O=CC@>:
9
MQI9J9LJJ
MQI9J9LJJ
MQI9J9LJJ
MQI9J9LJJ
JLJJ
JLJJ
JLJJ
HH
K '572-/6
M
Q9IHKJLJJ
9SUI9QJLJJ
KKIHJJLJJ
9KKIJJJLJJ
T9GIK9JLJJ-
TUHIQMJLJJ-
T9QLJJ
HS
9 '572-6*
HG
M '572-6*
HQ
U '572-6*
HK R '572-6*
SJ H '572-6*
S9 S '572-6*
SM G '572-6*
SU Q '572-6*
SR K '572-6*
SH 9J '572-6*
SS 99 '572-6*
SG 9M '572-6*
404'2)
7=A>DB=-E=-;DP?ND;:-EDO-A@<F?D-N:A>-:ND;@>:;=:-P:<-?<=>[email protected]=;@C=:<D-=<>DF;@>@^'572-/6_
/;:E:>>[email protected]<=P=-M
,=AN:A=>=W=-[DE=P=-W@;[email protected]@CC=<:-9l-4;@<PaD---6D>;@>>:;=L-,=W@;=P@>:;=L-,=AN:A=>[email protected]=:
[@>D;[email protected]@<=>@;=:-W@;=:-^'Fa=-A>D;=O=-ND;-[DA:>D;@[email protected][email protected]>;D-ND;-[DA:>D;@N=@[email protected]:<D-P:<->D;;D<:-745'64_-2:>>=-,DAD;>=
1:ED;=<D-A>D;=O=-ND;->[email protected];@
1:;<=>?;@-E=-\*[T0T20.`-.2)/-ND;-5;:O:F=@
[email protected]:O=<=-ND;-B@<:-Pa=;?;F:-M
[email protected]:<=-*B:A>@>=P=-ND;-:>:;=<:O@;=<F:=@>;=@
1:;<=>?;@-@-A:BBI<D-.@<<?OD->;@PaD:A>:B=PaD
,=AN:A=>=W=-[DE=P=-ND;-*OD>>;:B=:F;@X=@
[@>D;[email protected]@<=>@;=:-W@;=:-Q
7D;W=C=-E=-B@<?>D<C=:<D->=N:-1?OOT6=Aj-407\)i'
[email protected]=D>>=<D-E=A=<XD>>@<>=-A:<ED-DP:F;@X=PaD
3'6'-1'6['.)-'Z*+-^)+4*6.*+4I*I6I_
9
SIQRGLSM
SIQRGLSM
KI9MULJH
KI9MULJH
TMIMGHLRU-
TMIMGHLRU-
TMRLKR
U
9MIJ9JLJJ
USIJUJLJJ
9MIMMJLJJ
USISSJLJJ
TM9JLJJ-
TSUJLJJ-
T9LGM
U
9MIJ9JLJJ
USIJUJLJJ
9MIMMJLJJ
USISSJLJJ
TM9JLJJ-
TSUJLJJ-
T9LGM
U
9
U
U
M
M
M
U
M
9MIKGMLJJ
H9IHHHLMR
MRIMQ9LSM
UJIHUQLSS
S9IQMHLSJ
SRI9KRLJJ
G9IH9RLMJ
UGJIQRGLJJ
SIR9HLJJ
RSIQGQIRK9LMM-
UQIK9SLJJ
H9IHHHLMR
GMIQRRLQS
K9IS9HLKG
9MUISH9LMJ
9MQIUQQLJJ
9RUIJMQLRJ
9I99MIHR9LJJ
9MIQUJLJJ
99QIHRJIJUJLRM-
9MIHQMLQR
HJIHRMLMJ
MHI9GQLSH
S9IQSHLGJ
SSIHRMLHJ
QGIH9JLHJ
GUIR9RLJJ
UKJIUSHLMJ
SIR9HLJJ
H9IQJMISJML9Q-
UGIGRQLHM
HJIHRMLMJ
GHIHUHLKR
9QHIHKGL9J
9UUIJQHLJJ
9GHIJM9LJJ
9RSIQMQLJJ
9I9G9IJKHLSJ
9MIQUJLJJ
9UUIJQGIJ9KLGK-
UQKL9S
9IJ9ULJR
TQKGLJUTU9IUMGLJRTRIG9SLKJTMUIU9SLHJT9IQKKLQJT9KIH9QLMJJLJJ
TQIUKSI9Q9LUJ-
R
9RHIUQQIJQGLGH-
HQ9IHHMIUH9LJJ-
9HQIQQKIJQMLJJ-
SUHIHHSIUMQLJJ-
T9UIHJJIKKRLMH-
y///
9I9SGLRQ
ULJK
9IJ9ULJR
MLJJ
TMISK9LJQTULHS
TKUIKQ9L9U- THJLSR
TKIRUULQJTGLJK
TRSISUULJJ- TMSLSR
TUIGKKLSJTMLHK
THQIHHRLSJTHLJJ
JLJJ
JLJJ
TMRIKSUIMJJLUS- T9QLGS
THRIJJUIKGGLJJ-
TQLHJ
ƉƉĞŶĚŝĐĞ
'()*+,'.'/01)2'
Author
Document
Category
Uncategorized
Views
0
File Size
7 036 KB
Tags
1/--pages
Report inappropriate content