PASTURE QUALITY VISUAL ASSESSMENT 0800 BEEFLAMB (0800 233 352) | WWW.BEEFLAMBNZ.COM INVESTMENT BY NEW ZEALAND SHEEP + BEEF FARMERS CONTENTS Visual pasture quality assessment 2 When should visual pasture quality assessments be done? 2 What are the assessments? 2 How accurate do the assessments need to be? 2 Visual assessment of a paddock 2 How is each component assessed? 2 Interpreting the assessments with Q-Graze 3 3DVWXUHDVVHVVPHQWGHÀQLWLRQVDQGELDVHV 3 Pasture dry matter yield 3 Dead matter 4 Clover and herbs 5 Green grass leaf 5 6DPSOLQJDQGPHDVXUHPHQWSURWRFROV 6 Measuring pasture dry matter yield 6 Sampling for component and quality analysis 7 Calculations 8 Field recording sheets 9 FURTHER READING 400 plus - a guide to improved lamb growth. (Beef + Lamb New Zealand) A guide to feed planning for sheep farmers. (Beef + Lamb New Zealand ) Disclaimer: The information in this publication has been prepared with all reasonable skill and care. Nevertheless, neither AgResearch or Beef + Lamb New Zealand accept any liability, whether direct, indirect or consequential, arising out of the use and interpretation of the information in this publication. Notice of Copyright: AgResearch holds the copyright for the information contained in this publication. Material may not be reproduced without the prior consent of Beef + Lamb New Zealand and AgResearch. This material was developed by AgResearch under contract for Beef + Lamb New Zealand. First published by AgResearch January 2002. Redesigned and reprinted by Beef + Lamb New Zealand June 2012. 1 VISUAL PASTURE QUALITY ASSESSMENT Visual pasture quality assessment is achieved by observing key pasture features. These features have been used to develop the visual pasture quality assessment protocol and the accompanying software Q-Graze7KHÀHOGDVVHVVPHQWUHVXOWVDUHXVHGE\ Q-Graze to predict the quality of the pasture, the intake of young growing sheep and cattle, and their liveweight gain. WHEN SHOULD VISUAL PASTURE QUALITY ASSESSMENTS BE DONE? VISUAL ASSESSMENT OF A PADDOCK To make a visual assessment of a paddock, walk DFURVVLWWRÀQGDQDUHDRIDERXWP2 that represents the average pasture dry matter yield and quality of the paddock. In hill country, more than one area may be required to represent different slope and aspect combinations. The ÀQDOUHVXOWPD\QHHGWREHDGMXVWHGIRUWKHEDODQFHRI slope and aspect. Avoid gateways, troughs and camps. Pasture may be assessed at any time, but visual pasture quality assessment may be most effective during summer when feed quality is particularly important. Look around and assess the dry matter yield, dead matter, clover percentage and green grass percentage of the sward. Shadows on the pasture can alter your perceptions. WHAT ARE THE ASSESSMENTS? The visual assessments are: Field assessments are recorded and transferred to the computer programme Q-Graze or compared with the feed quality tables in the back of this manual. 1. Pasture dry matter yield, in kg DM/ha to ground level. HOW IS EACH COMPONENT ASSESSED? 2. Dead matter, as a % of theWRWDOGU\ZHLJKW. WRWDOGU\ZHLJKW= dead + clover and herbs + green grass leaf + seedhead and weeds Please see the “Calibration Photographs” also provided as part of the Beef + Lamb New Zealand Pasture Quality Workshop. 3. Clover and herbs, as a % of the JUHHQGU\ZHLJKW. JUHHQGU\ZHLJKW = clover and herbs + green grass leaf + seedhead and weeds The pasture components are estimated in the following order: 4. Green Grass leaf, as a % RIWKHUHVW. WKHUHVW= green grass leaf + seedhead and weeds PASTURE DRY MATTER YIELD 7KHÀQDOIUDFWLRQVHHGKHDGDQGZHHGVLVFDOFXODWHG as the remainder. $VVHVVSDVWXUHGU\PDWWHU\LHOGWRJURXQGOHYHO (including any residual that may be left after grazing) in kg DM/ha. HOW ACCURATE DO THE ASSESSMENTS NEED TO BE? The visual assessments of dead matter, clover and herbs, and grass leaf need to be to the nearest 5%. The pasture dry matter yield assessment to ground level needs to be accurate to approximately 200 kg/ ha because the model converts the visual quality assessments into liveweight gain based on feed eaten. If the feed is not there to be eaten then the outcome will not be accurate. 8VHDWHFKQLTXHWKDW\RXDUHIDPLOLDUZLWK &KHFNWKHFDOLEUDWLRQVDQGELDVHVLQWKHWHFKQLTXH that you are using. DEAD MATTER 2SHQWKHSDVWXUHXSDQGORRNLQWRWKHEDVH $VVHVVGHDGPDWWHUDVDSURSRUWLRQRIWKHWRWDO dry matter. ,QFOXGHGHDGOHDIGHDGVWHPDQGGHDGSDUWV of leaves. 'HDGPDWWHULVQRUPDOO\XQGHUHVWLPDWHGHVSHFLDOO\ in summer. (VWDEOLVKDUDQJHIRUHDFKVHDVRQ 2 PASTURE ASSESSMENT: DEFINITIONS AND BIASES CLOVER AND HERBS &ORVHWKHSDVWXUHXSDQGORRNDWWKHVXUIDFH $VVHVVWKHFORYHUDQGKHUEVDVDSURSRUWLRQRI the green material you can see. 5HPHPEHUWKDWFORYHULVXVXDOO\RYHUHVWLPDWHG EHFDXVHRILWVÁDWOHDI PASTURE DRY MATTER YIELD DEFINITION: Pasture dry matter yield is the dry weight of pasture in kilograms per hectare above ground level. /RQJSDVWXUHVDSSHDUWRKDYHOHVVFORYHU BACKGROUND: +HUEVLQFOXGHWKHHGLEOHSODQWVVXFKDVFKLFRU\ and plantain. Many New Zealand farmers now routinely use visual assessment of pasture dry matter yield. Pastures can usually be successfully ranked from low to high dry matter yield. Q-Graze (the computer model for integrating dry matter yield and quality of pasture to predict intake) requires a total dry matter yield estimate so this measurement must be as accurate as possible. GREEN GRASS LEAF /RRNDWWKHSDVWXUHIURPWKHWRS $VVHVVWKHJUHHQJUDVVOHDIDVDSURSRUWLRQRI the grass and weed content of the pasture. 5HPHPEHUWRDVVHVVWKHVHHGKHDGDQG weeds together. :HHGVLQFOXGHLQHGLEOHSODQWVVXFKDVWKLVWOHV 2QFHWKHVHHGKHDGKDVGLHGRIILWLVSDUWRI the dead matter. INTERPRETING THE ASSESSMENTS WITH Q-GRAZE Q-Graze is a computer programme that has been designed to incorporate the principles of pasture quality to predict liveweight gains for young sheep and cattle. The Q-Graze programme uses the visual pasture quality assessments to estimate the intake and feeding value of the pasture and then predicts liveweight gains for young growing sheep and cattle. To use Q-Graze, the visual pasture quality assessments are entered along with the pasture dry matter yield, on the input page.The full instructions for Q-Graze are printed in “The Pasture Quality Workshops, Principles and Management, and the Q-Graze Manual”. Q-Graze users can input paddock sizes and stock details (number, weight, sex, breed) to examine the effects of management decisions such as grazing time on animal growth. The absolute value assigned to a particular pasture dry matter yield can differ widely between observers, especially in summer and autumn. Historically this has arisen because of a lack of standardisation between training organisations (universities, research organisations, consultants, pasture measurement manufacturers) in the height at which pasture is cut relative to ground level. Calibration must be accurate. Calibration equations on measurement devices and visual assessments must match the season. Local consultants or the manufacturer may be able to help if further information is required. Ideally these tools should be calibrated to your farm each season. Details on how to do calibration cuts are SURYLGHGODWHULQWKLVPDQXDO2QFHSDVWXUHTXDOLW\ is integrated with dry matter yield assessments it is important to measure “actual” total dry matter yield. Measurement devices will struggle with pastures with very high dead matters regardless of the calibration chosen. For example, the modern capacitance probes don’t measure “dry” dead material and will give higher readings when pasture is wet than when dry. In these conditions (often dry summer/autumn periods), it may be preferable to rely solely on visual assessments or height measurements (pasture rulers). Pasture rulers give separate calibrations for different seasons for dry matter yield. When visually assessing pasture there are a few common biases: +LJKGHDGPDWWHUSDVWXUHVDUHXQGHUHVWLPDWHG +LJKGU\PDWWHU\LHOGSDVWXUHVDUHXQGHUHVWLPDWHG /RZIHUWLOLW\VZDUGVZLWKD´PDWµDUH under-estimated. 8SULJKWORZGHQVLW\VZDUGVDUHRYHUHVWLPDWHG 3 6ZDUGVZLWKKLJKOHJXPHFRQWHQWDUHRYHUHVWLPDWHG :KHQWKHSDVWXUHLVKLJKO\YDULDEOH\RXUH\HZLOOEHGUDZQWRWKHORQJHUSDVWXUH 3DVWXUHVORRNORQJHUZKHQWKHVXQLVORZEHFDXVHRIWKHVKDGRZV 3DVWXUHVDSSHDURIKLJKHUGU\PDWWHU\LHOGZKHQORRNLQJGRZQKLOOEHFDXVH\RXVHHWKHFDPSDQGWUDFNDUHDV ACCURACY: Pasture dry matter yield measurement should be to within 200 kgDM/ha. DEAD MATTER DEFINITION: Dead matter is the percentage of the total dry weight that is dead material, including dead leaf material, dead seedhead as well as dead parts of leaves. BACKGROUND: Dead matter is the main determinant of pasture quality and is the most important component to get right. The dead matter in the pasture is often underestimated. It is normally at the base of the pasture and is out of sight. Initially the observer must open up the pastures to get an appreciation of how much dead matter it contains. Alternatively, the pasture can be cut to ground level and blended. This makes the dead matter more obvious and easy to see. Accuracy is improved by establishing a range over which the dead matter is assessed. Recorded dead matter UDQJHVFROOHFWHGLQIRXUUHJLRQVIURPSDVWXUHVXVHGWRJUD]HÀQLVKLQJVWRFNDUHVKRZQLQ7DEOH Most pastures, even well managed pastures, contain high levels of dead matter during dry, warm conditions due to accelerated death rates and accumulated dead matter at the base of the sward. During these conditions, the dead matter will also have a much higher dry matter percentage. AREA SEASON )HE0DU $SULO0D\ -XQH-XO\ $XJ6HS 2FW1RY 'HF-DQ 31 (21-49) 42 (17-76) 23 (7-43) 12 (6-20) 15 (9-23) 20 (15-30) 6WK1RUWK,VODQG 35 (9-43) 19 (6-38) 11 (2-16) 8 (0-19) 6 (1-13) 19 (6-55) &DQWHUEXU\ 24 (0-35) 17 (4-44) 36 (11-60) 13 (3-34) 8 (1-23) 14 (3-25) 6RXWKODQG 15 (2-38) 10 (4-20) 16 (2-37) 9 (2-16) 4 (2-8) 8 (2-10) :DLNDWR 7DEOHAverage dead matter (minimum and maximum) from pastures collected from 4-5 farms per region each month in 1999/2000. Dead matter that has occurred as a result of aging, “old dead”, in moist conditions has a lower quality than “snap dried” leaves that have died prematurely due to water stress. This results in different animal performance depending on the conditions. The programme Q-Graze allows a choice of “old dead” or “snap dried”. The use of snap dried for the type of dead will depend on the weather conditions and the prevalence of dead matter before the onset of drought. “Snap dried” is usually reserved for dead matter that was previously fresh green leaf, which has dried off quickly due to drought. The high quality dead matter is normally restricted to eastern parts of New Zealand following sudden dry hot spells. The quality of this type of dead declines rapidly once it rains. ACCURACY: Aim to be within 5% of the actual dead matter content. 4 CLOVER AND HERBS DEFINITION: The amount of green clover and herbs as a percentage of green dry weight. BACKGROUND: To simplify the assessment process, herbs such as chicory, plantain and dandelions are included as “clover and herbs”. The “clover and herbs” is an important determinant of diet quality, but in most sheep and beef pastures LWGRHVQRWPDNHDPDMRUFRQWULEXWLRQWRWKHFXWWRJURXQG0-0(EHFDXVHLWQRUPDOO\RFFXUVDWORZOHYHOV7KH average clover content of sheep and beef pasture as a percentage of total dry matter yield is 10%. 7KHFORYHUFRQWHQWRISDVWXUHVLVLQLWLDOO\RYHUHVWLPDWHGE\YLVXDODVVHVVPHQWEHFDXVHLWVOHDYHVDUHÁDW$VLQJOH clover leaf and stem makes a similar contribution to dry matter yield as a single grass leaf. The easiest way to demonstrate this bias is to assess the pasture, cut and mix the pasture and then visually assess again. The mixing WDNHVDZD\WKHÁDWRULHQWDWLRQDQGWKHFORYHUVHHPVWRGLVDSSHDU Clover is assessed as a percentage of the green pasture. Ask yourself: “What proportion of the green is clover?” As pastures increase in height, visual assessors must decrease their assessment of clover because grass weighs proportionately more at higher dry matter yields than clover. Alternatively, very short pastures (<1000 kg DM/ha) contain proportionately more clover and the assessment must increase. ACCURACY: Aim to be within 5% of clover and herbs content. GREEN GRASS LEAF DEFINITION: The amount of grass leaf as a percentage of grass leaf, grass seedhead and weeds. BACKGROUND: Green grass leaf excludes seedhead. Seedhead includes stem with, or which has had (when removed by grazing), DVHHGKHDG,WLVH[WUHPHO\GLIÀFXOWWRYLVXDOO\DVVHVVLPPDWXUHVWHPVWHPLQZKLFKWKHÁRZHULQJKHDGKDVQRW\HW emerged) so this is included as leaf. Weeds include thistles, docks and other inedible or unpalatable components of the pasture. The green grass leaf is assessed as a proportion of green grass, for example, 95% leaf with 5% seedhead and weeds. Seedhead is normally present in the sward only from November to February. After this time the seedhead dies and is included in the dead component. Indicative levels of green grass leaf are shown in Table 2. AREA SEASON 2FW 1RY 'HF Jan )HE 97 (92-100) 91 (84-100) 71 (40-96) 85 (76-100) 76 (51-100) 95 (91-100) S 1RUWK,VODQG 100 98 (95-100) 87 (62-95) 93 (71-100) 94 (87-100) 100 &DQWHUEXU\ 99 (98-100) 96 (93-98) 73 (55-83) 62 (37-82) 97 (95-100) 70 (31-100) 100 97 (94-100) 73 (63-90) 88 (82-100) 91 (76-100) 88 (32-100) :DLNDWR 6RXWKODQG Mar 7DEOHAverage green grass leaf (minimum and maximum) from pastures collected from 4-5 farms per region each month over 1999/2000. It is important to realise that variation in seedhead during late spring is large and depends on both management DQGZHDWKHUFRQGLWLRQV7KHYDULDWLRQFDQEHVHHQLQWKHÀJXUHVLQEUDFNHWVRQWKHWDEOHLQGLFDWLQJWKDWHDFK paddock must be assessed individually. ACCURACY: Aim to be within 5% of green grass leaf content. 5 SAMPLING AND MEASUREMENT PROTOCOLS Calibrating visual pasture quality assessments helps to ensure that results and predictions are accurate. This section provides a basic set of guidelines for those who wish to do their own calibration. Please read all of this section before beginning, as all aspects are related. MEASURING PASTURE DRY MATTER YIELD USING A PLATE OR PROBE 7RHVWLPDWHSDVWXUHGU\PDWWHU\LHOGWRNJ'0 ha, a minimum of 40 measurements provides good accuracy when the paddock is relatively even. 2YHUPHDVXUHPHQWVPD\EHQHHGHGLIWKH paddock is patchy. :DONDFURVVDUHSUHVHQWDWLYHWUDQVHFWWDNLQJD measurement at predetermined intervals, for example, every second step. &KRRVHWKHDSSURSULDWHFDOLEUDWLRQIRUWKHVHDVRQ and conditions. VISUAL ESTIMATES (QVXUHWKDWWKHHQWLUHSDGGRFNLVWDNHQLQWR DFFRXQWLQFOXGLQJDQDGMXVWPHQWIRUVORSH and aspect. &DOLEUDWH\RXUVHOIDJDLQVWRWKHUPHWKRGVRU assessors each season for greatest accuracy. HEIGHT MEASUREMENTS +HLJKWPD\EHXVHGDVORQJDVWKHDSSURSULDWH calibration is used. CALIBRATING &KRRVLQJFDOLEUDWLRQVLWHV 7KHVLWHVQHHGWRUHSUHVHQWWKHUDQJHRISDVWXUH dry matter yields and pasture type that will be measured. $WOHDVWÀYHVLWHVZLOOEHQHHGHGUDQJLQJIURPORZ to high pasture dry matter yield. ,IWKHSDVWXUHW\SHVYDU\JUHDWO\VXFKDVROG Browntop versus Italian ryegrass, separate calibrations will be needed for each pasture. 2. Cutting grass 7KHJUD]LQJPRGHOXVHVDFXWWRJURXQGEDVLVWR assess both pasture components and pasture dry matter yield. :KHQSDVWXUHLVFXWWRJURXQGOHYHOQRJUHHQ material remains and the plant material is cut at the soil surface. 7KLVQRUPDOO\UHTXLUHVFXWWLQJZLWKDQHOHFWULF hand piece. 7RPHDVXUHSDVWXUHGU\PDWWHU\LHOGDTXDGUDW (commonly 0.12-0.2 m2) is placed over the sward. ,ISRVVLEOHDYRLGKDUYHVWLQJODUJHDPRXQWVRIGLUW 7KHVDPSOHPD\QHHGWREHZDVKHGWRUHPRYH dirt before weighing. This can be important as small amounts of dirt can contribute a large dry weight. 'U\LQJDQGZHLJKLQJ $OOHVWLPDWHVDUHRQDGU\PDWWHUEDVLVVRVDPSOHV must be dried before working out yields and relative contributions. +HLJKWGU\PDWWHU\LHOGUXOHUVDUHDYDLODEOHZLWK general calibrations for each season. 5HPHPEHUWRZHLJKWKHGU\PDWWHUVDPSOHEHIRUH drying to determine dry matter percentage (see Calculations). 2SHQSDVWXUHVDUHRIORZHUGU\PDWWHU\LHOGSHU unit height, while dense pastures are of higher dry matter yield. 6DPSOHVIRUGU\PDWWHUSHUFHQWDJHDQGSDVWXUH composition should be dried at 80ºC for a minimum of 12 hours. 3DVWXUHVZLWKODUJHWLOOHUVOLNH,WDOLDQU\HJUDVV or cocksfoot, have a low dry matter yield per unit height. 6DPSOHVGULHGEHIRUH1,5DQDO\VLVVKRXOGRQO\EH dried at 60ºC for 24 hours. 7KHSRLQWVLQWKHVHFWLRQ´8VLQJDSODWHRUSUREHµ also apply to using a ruler. 2QUHPRYDOIURPWKHRYHQGULHGVDPSOHVZLOODEVRUE moisture so immediate weighing is required. 'U\PDWWHUVDPSOHVDUHZHLJKHGWRJDQG dissections to 0.01 g. $FFXUDWHGLJLWDOVFDOHVDUHQHHGHG6RPHGLJLWDO kitchen scales are suitable. 6 0LFURZDYHGU\LQJ 0LFURZDYHGU\LQJLVDJRRGWHFKQLTXHWRXVHLQ most farm situations. $IUHVKVDPSOHRIJLVZHLJKHGDQGVSUHDG evenly across the microwave plate. $JODVVRIZDWHULVSODFHGLQWKHEDFNRIWKH microwave and must have water in it at all times WRSUHYHQWDÀUHZKHQWKHVDPSOHLVFORVHWRGU\ 0LFURZDYHRQKLJKIRUÀYHPLQXWHVIRUD 700 W oven). 6DPSOHVIRUODERUDWRU\IHHGDQDO\VLV1,5VKRXOGEH greater than 100 g (half a bread bag). )RUGU\PDWWHUSHUFHQWDJHGHWHUPLQDWLRQDERXW 100 g is an ideal size. $ERXWJLVQHHGHGIRUGLVVHFWLRQVDOWKRXJKWKLV PD\EHOHVVIRUÀQHOHDYHGSDVWXUHVVXFKDVWKRVH that have been set stocked. 3DVWXUHFRPSRVLWLRQE\GLVVHFWLRQ 7KRURXJKO\PL[WKHVDPSOHRQDÁDWVXUIDFH &KHFNWKHGU\ZHLJKWDQGGU\IRUDQRWKHU one minute. 7KHQRQWKHÁDWVXUIDFHGLYLGHWKHVDPSOH into quarters. :HLJKDJDLQDQGLIQRIXUWKHUZHLJKWFKDQJH is recorded, the sample is dry. 'LVFDUGWZRGLDJRQDOO\RSSRVLQJTXDUWHUVUHPL[DQG repeat the process until the required size sample (up to 20 g) remains. ,IVRPHZHLJKWFKDQJHZDVUHFRUGHGGU\DIXUWKHU one minute and repeat the procedure until no weight change is recorded. SAMPLING FOR COMPONENT AND QUALITY ANALYSIS COLLECTING A PASTURE SAMPLE :KHQFROOHFWLQJDVDPSOHUHSUHVHQWDWLYHRIWKH paddock, walk across a representative part (e.g. 100 m diagonal) of the paddock. (YHU\VHFRQGRUWKLUGVWHSVWRSDQGFXWVFLVVRUV clippers, electric hand piece or sharpened spoon) three small samples of the pasture to ground level. &XWDVPDOOVDPSOHRIWKHSDVWXUHDGMDFHQWWRHDFK foot and then a sample midway between each foot. <RXZLOOUHTXLUHVDPSOHVWRHVWLPDWH Metabolisable Energy to 0.5 MJME/kgDM. 7KLVPHWKRGFDQEHXVHGIRUDVVHVVLQJGU\PDWWHU percentage and botanical composition or for sampling for laboratory feed quality analysis. SAMPLE SIZE REQUIREMENTS 7KHVDPSOHFROOHFWHGLQWKHSDGGRFNZLOOEHODUJH 7KLVLVQHHGHGWRDFFRXQWIRUWKHYDULDWLRQLQWKH paddock. 7KRURXJKPL[LQJDQGDFFXUDWHVXEVDPSOLQJ is needed to get accurate results from later procedures such as NIR or pasture composition analysis. 7DNHVPDOOSRUWLRQVRIWKHVXEVDPSOHDQGGLVVHFWWR completion before taking another small portion. 7KLVDOORZVVWRSSLQJSDUWZD\WKURXJKWKHGLVVHFWLRQ if sample size has been over-estimated. 'LVVHFWXVLQJWZHH]HUVLQWRWKHYDULRXVFRPSRQHQWV 5HPRYHDOOGHDGPDWWHUVWULSIURPVKHDWKUHPRYH part leaves) and put this into the dead component. 3UHSDULQJSDVWXUHIRUODERUDWRU\IHHGTXDOLW\DQDO\VLV 3DVWXUHVDPSOHVFDQEHPHDVXUHGXVLQJQHDU LQIUDUHGDQDO\VLVIRUGLJHVWLELOLW\ÀEUHFDUERK\GUDWH protein, and Metabolisable Energy (ME). 3DVWXUHVDPSOHVDUHFROOHFWHGXVLQJWKHVDPSOLQJ methods above. 5HVSLUDWLRQFRQWLQXHVDIWHUWKHJUDVVKDVEHHQFXW until it is cooled, and this uses up the carbohydrate (sugars) in the pasture. ,IJUDVVFDQ·WEHNHSWFRROLWVKRXOGEHPLFURZDYHG as soon as possible for one minute on high in a paper bag or open dish to stop respiration. 7KHJUDVVVKRXOGEHVWHDPLQJLPPHGLDWHO\DIWHU removal from the microwave. 7KHVDPSOHVKRXOGEHFRRODQGGU\DYRLGFROOHFWLQJ wet grass) when packaged in a zip-locked plastic bag for immediate mailing to the laboratory. $OWHUQDWLYHO\WKHSDVWXUHFDQEHIXOO\GULHGVHH drying section) and may be ground before submitting for NIR analysis. 'U\LQJDQGZHLJKLQJ 6HH&DOLEUDWLQJ'U\LQJDQGZHLJKLQJ 7 CALCULATIONS Pasture dry matter yield kg DM/ha = fresh weight of grass (g) x dry matter % 10 * Area quadrat (m2) 3DVWXUHIUDFWLRQVIRUQ-Graze Dead (%) = dried weight of dead (g) x 100 dried total weight (g) 1 Clover (%) = dried weight of clover and herbs (g) x 100 dried weight of green fractions (g) 2 Green grass leaf (%) = dried weight of green grass leaf (g) x 100 dried weight of grass fractions (g) 3 1 'ULHGWRWDOZHLJKW = dead + clover and herbs + green grass leaf + seedhead and low quality weeds 2 'ULHGZHLJKWRIJUHHQIUDFWLRQV = clover and herbs + green grass leaf + seedhead and low quality weeds 3 'ULHGZHLJKWRIJUDVVIUDFWLRQV = green grass leaf + seedhead and low quality weeds 8 FIELD RECORDING SHEET HERBAGE MASS AND COMPONENT ASSESSMENT Name: Mass = kg Dry Matter / ha % dead = dead as a % of total pasture Date: % legume/herb = legume/herb as a % of green pasture % green grass leaf = green grass leaf as a % of remainder Mass 3ORW GHDG OHJXPHKHUE JUHHQJUDVVOHDI estimated measured estimated measured estimated measured estimated measured estimated measured estimated measured estimated measured estimated measured estimated measured estimated measured estimated measured 9 FIELD RECORDING SHEET HERBAGE MASS AND COMPONENT ASSESSMENT Name: Mass = kg Dry Matter / ha % dead = dead as a % of total pasture Date: % legume/herb = legume/herb as a % of green pasture % green grass leaf = green grass leaf as a % of remainder Mass 3ORW estimated measured estimated measured estimated measured estimated measured estimated measured estimated measured estimated measured estimated measured estimated measured estimated measured estimated measured 10 GHDG OHJXPHKHUE JUHHQJUDVVOHDI 0800 BEEFLAMB (0800 233 352) | WWW.BEEFLAMBNZ.COM INVESTMENT BY NEW ZEALAND SHEEP + BEEF FARMERS
© Copyright 2026 Paperzz