Supplementary Figures: Figure S1 Audiograms of three familiar patients selected for WES (Red indicates the right ear, and blue indicates the left ear. Symbols ‘‘O’’ and “×’’ denote air conduction pure-tone thresholds at different frequencies in the right and left ear. dB, decibels; Hz, Hertz). Figure S2 The distribution of per-base sequencing depth in target regions for each sample. Y-axis indicated the percentage of total target region under a given sequencing depth. Figure S3 Cumulative depth distribution in target regions for each sample. X-axis denotes sequencing depth, and Y-axis indicated the fraction of bases that achieves at or above a given sequencing depth. Figure S4 The BLAST results of wild and mutated types of OSBPL2 Figure S5 The BLAST results of OSBPL2 (1) and Osh3 holo-form protein (PDB ID: 4INQ) (2). The red frame-labed amino acids were the conserved OSBP-fingerprint motif. Figure S6 The Ramachandran plot and statistical results of predicted OSBPL2 structure. Figure S7 Expression of the Osbpl2 gene in mouse tissues. RT-PCR analyses of Osbpl2 expression in the mouse heart, liver, spleen, lung, kidney, muscle, brain and cochlea with 468 bp products. β-actin was used as an internal control for cDNA quantification. 250 500 1000 2000 -10 4000 8000 Hz 250 500 1000 2000 -10 4000 8000 Hz 250 0 0 10 10 20 20 20 Hearing Level in dBHL Hearing Level in dBHL 40 40 50 50 50 60 60 60 70 70 70 80 80 80 90 90 90 100 100 100 110 110 110 120 120 V:5, male,49 yrs 2000 30 30 40 1000 Hearing Level in dBHL 0 10 30 500 -10 120 VI:4, male,23 yrs Figure S1 VI:32, male,17 yrs 4000 8000 Hz V: 4 V: 5 VI: 4 VI: 32 Figure S2 V: 4 V: 5 VI: 4 VI: 32 Figure S3 ATG Codon 51-53: CCC TCT CAA MNGEEEFFDAVTGFDSDNSSGEFSEANQKVTGMIDLDTSKNNRIGKTGERPSQENGIQKHRTSLPAPMFSRSDFSVWTILKKCVGLELSKITMPIAFNEPLSF LQRITEYMEHVYLIHRASCQPQPLERMQSVAAFAVSAVASQWERTGKPFNPLLGETYELIREDLGFRFISEQVSHHPPISAFHSEGLNHDFLFHGSIYPKLKF WGKSVEAEPRGTITLELLKHNEAYTWTNPTCCVHNVIIGKLWIEQYGTVEILNHRTGHKCVLHFKPCGLFGKELHKVEGHIQDKNKKKLFMIYGKWTECL WGIDPVSYESFKKQERRGDHLRKAKLDEDSGKADSDVADDVPVAQETVQVIPGSKLLWRINTRPPNSAQMYNFTSFTVSLNELETGMEKTLPPTDCRLRP DIRGMENGNMDLASQEKERLEEKQREARRERAKEEAEWQTRWFYPGNNPYTGTPDWLYAGDYFERNFSDCPDIY* (A) Wild Type OSBPL2 Protein (480 amino acid residues) (CT and Q indicated the position of c.153_154delCT, p. Gln53Arg fs*100; L indicated the position of c.583C>A, p.Leu195Met) ATG Codon 51-53: CCC TCA AGA MNGEEEFFDAVTGFDSDNSSGEFSEANQKVTGMIDLDTSKNNRIGKTGERPSRERNSETQDIAAGSHVQQKRLQRVDHPEEVCWPGAVQDHDANRLQRAS ELLAADHGVHGARVPHPQGLLPAPAPGEDAVCGCFCCFGCGFPVGEDRQTI* Codon 152 (Stop) (B) Mutant Type OSBPL2 Protein (151 amino acid residues) [A two base pair de novo deletion, c.153_154delCT in OSBPL2 resulting in a frameshift of translation from codon 53 to 151 and terminate translation at codon 152 (p. Gln53Argfs*100)] Figure S4 Figure S5 Figure S6 Figure S7
© Copyright 2026 Paperzz