bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. An experimentally determined evolutionary model dramatically improves phylogenetic fit Jesse D. Bloom Division of Basic Sciences and Computational Biology Program, Fred Hutchinson Cancer Research Center, Seattle, WA 98109, USA E-mail: [email protected]. Submitted as an Article (Methods classification) to Mol Biol Evol Abstract All modern approaches to molecular phylogenetics require a quantitative model for how genes evolve. Unfortunately, existing evolutionary models do not realistically represent the site-heterogeneous selection that governs actual sequence change. Attempts to remedy this problem have involved augmenting these models with a burgeoning number of free parameters. Here I demonstrate an alternative: experimental determination of a parameter-free evolutionary model via mutagenesis, functional selection, and deep sequencing. Using this strategy, I create an evolutionary model for influenza nucleoprotein that describes the gene phylogeny far better than existing models with dozens or even hundreds of free parameters. Emerging high-throughput experimental strategies such as the one employed here provide fundamentally new information that has the potential to transform the sensitivity of phylogenetic and genetic analyses. 1 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. Introduction The phylogenetic analysis of gene sequences is one of the most important and widely used computational techniques in all of biology. All modern phylogenetic algorithms require a quantitative evolutionary model that specifies the rate at which each site substitutes from one identity to another. These evolutionary models can be used to calculate the statistical likelihood of the sequences given a particular phylogenetic tree (Felsenstein, 1973). Phylogenetic relationships are typically inferred by finding the tree that maximizes this likelihood (Felsenstein, 1981) or by combining the likelihood with a prior to compute posterior probabilities of possible trees (Huelsenbeck et al., 2001). Actual sequence evolution is governed by the rates at which mutations arise and the selection that subsequently acts upon them (Thorne et al., 2007; Halpern and Bruno, 1998). Unfortunately, neither of these aspects of the evolutionary process are traditionally known a priori. The standard approach in molecular phylogenetics is therefore to assume that sites evolve independently and identically, and then construct an evolutionary model that contains free parameters designed to represent features of mutation and selection (Goldman and Yang, 1994; Kosiol et al., 2007; Yang, 1994; Yang et al., 2000) This approach suffers from two major problems. First, although adding parameters enhances a model’s fit to data, the parameter values must be estimated from the same sequences that are being analyzed phylogenetically – and so complex models can overfit the data (Posada and Buckley, 2004). Second, even complex models do not contain enough parameters to realistically represent selection, which is highly idiosyncratic to specific sites within a protein. Attempts to predict site-specific selection from protein structure have had limited success (Rodrigue et al., 2009; Kleinman et al., 2010), probably because even sophisticated computer programs cannot reliably predict the impact of mutations (Potapov et al., 2009). Approximating selection via additional site-specific parameters can improve phylogenetic fit (Lartillot and Philippe, 2004; Le et al., 2008; Wu et al., 2013; Wang et al., 2008), but further exacerbates the proliferation of free parameters that already plagues simpler models. Here I demonstrate a radically different approach for constructing quantitative evolutionary models: direct experimental measurement. Specifically, using influenza nucleoprotein (NP) as an example, I experimentally estimate mutation rates via limiting-dilution passage and experimentally estimate site-specific selection via deep mutational scanning (Fowler et al., 2010; Araya and Fowler, 2011), a combination of high-throughput mutagenesis, functional selection, and deep sequencing. I then show that these experimental measurements can be used to create 2 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. a parameter-free evolutionary model describes the NP gene phylogeny far better than existing models with numerous free parameters. Finally, I discuss how the increasing availability of data from high-throughput experimental strategies such as the one employed here has the potential to transform analyses of genetic data by augmenting generic statistical models of evolution with detailed molecular-level information. Results Components of an experimentally determined evolutionary model A phylogenetic evolutionary model specifies the rate at which one genotype is replaced by another. These rates of genotype substitution are determined by the underlying rates at which new mutations arise and the subsequent selection that acts upon them (Thorne et al., 2007; Halpern and Bruno, 1998). A standard assumption in molecular phylogenetics is that the rate of genotype substitution can be decomposed into independent substitution rates at individual sites. Here I make this assumption at the level of codon sites, and use Pr,xy to denote the rate that site r substitutes from codon x to y given that the identity is already x. I further assume that it is possible to decompose Pr,xy as Pr,xy = Qxy × Fr,xy , (Equation 1) where Qxy is the rate of mutation from x to y (assumed to be constant across sites) and Fr,xy is the site-specific probability that a mutation from x to y will fix at site r if it arises. Both are assumed to be constant over time. An objection that can be raised to Equation 1 is that it does not allow interdependence of sites (Pollock et al., 2012) – however, the motivating idea of the work here is that accurately accounting for the site-specific fixation probabilities Fr,xy can lead to major improvements without including interdependence among sites. This idea is supported by experimental work for the specific case of the NP protein: experiments have shown that evolutionary constraints on NP mutations tend to be mediated by generic aspects of protein folding and stability rather then specific interactions among sites (Gong et al., 2013), and that mutational effects on NP protein stability themselves are mostly conserved over evolutionary time (Ashenberg et al., 2013). However, the ultimate justification for Equation 1 is provided by the results below, which show that using this evolutionary model with experimentally determined parameters dramatically improves phylogenetic fit to real protein sequences. 3 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. Given the evolutionary model described by Equation 1, the challenge is to experimentally estimate the mutation rates Qxy and the fixation probabilities Fr,xy . In the following sections, I describe these experiments. Measurement of mutation rates A general challenge in quantifying mutation rates is the difficulty of separating mutations from the subsequent selection that acts upon them. To decouple mutation from selection, I utilized a previously described method for growing influenza viruses that package GFP in the PB1 segment (Bloom et al., 2010). The GFP does not contribute to viral growth and so is not under functional selection – therefore, substitutions in this gene accumulate at the mutation rate. To drive the rapid accumulation of substitutions in the GFP gene, I performed limitingdilution mutation-accumulation experiments (Halligan and Keightley, 2009). Specifically, I passaged 24 replicate populations of GFP-carrying influenza viruses by limiting dilution in tissue culture, at each passage serially diluting the virus to the lowest concentration capable of infecting target cells. Because each limiting dilution bottlenecks the population to one or a few infectious virions, mutations fix rapidly. After 25 rounds of passage, the GFP gene was Sanger sequenced for each replicate to identify 24 substitutions (Table 1, Table 2), for an overall rate of 5.6 × 10−5 mutations per nucleotide per tissue-culture generation – a value similar to that estimated previously by others using a somewhat different experimental approach (Parvin et al., 1986). The rates of different types of mutations are in Table 3, and possess expected features such as an elevation of transitions over transversions. Because an observed mutation of A→G can arise from either this change on the sequenced strand or a change of T→C on the complementary strand, then assuming that the same molecular mutation process affects both strands, there are only the six different mutation rates shown in Table 3. Specifically, let Rm→n represent the rate at which nucleotide m mutates to n given that the identity is already m, and let mc denote the complement of m (so for example Ac is T). The assumption that the same molecular mutation process affects both strands means that Rm→n = Rmc →nc . An additional empirical observation from Table 3 is that the mutation rates for influenza are approximately symmetric, with the rate of each mutation approximately equal to its reversal (Rm→n + Rmc →nc ≈ Rn→m + Rnc →mc ). Because it somewhat simplifies computational aspects of the subsequent phylogenetic analyses, I enforce this empirical observation of approximately symmetric mutation rates to be exactly true by taking the rates of mutations and 4 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. their reversals to be the average of the two. With the further assumption that codon mutations occur a single nucleotide at a time, the mutation rates Qxy from codon x to y are estimated from the experimental data in Table 3 as Qxy 0 4.7 × 10−5 = 1.84 × 10−5 6.0 × 10−6 3.8 × 10−6 if x and y differ by more than one nucleotide, if x and y differ by A→G, T→C, G→A, or C→T, if x and y differ by A→C, T→G, C→A, or G→T, (Equation 2) if x and y differ by A→T or T→A, if x and y differ by G→C or C→G. These mutation rates define the first term in the evolutionary model specified by Equation 1. Deep mutational scanning to assess effects of mutations on NP Estimation of the fixation probabilities Fr,xy in Equation 1 requires quantifying the effects of all ≈ 104 possible amino-acid mutations to NP. Such large-scale assessments of mutational effects are feasible with the advent of deep mutational scanning, a recently developed experimental strategy of high-throughput mutagenesis, selection, and deep sequencing (Fowler et al., 2010; Araya and Fowler, 2011) that has now been applied to several genes (Fowler et al., 2010; Melamed et al., 2013; Traxlmayr et al., 2012; Starita et al., 2013; Roscoe et al., 2013). Applying this experimental strategy to NP requires creating large libraries of random gene mutants, using these genes to generate pools of mutant influenza viruses which are then passaged at low multiplicity of infection to select for functional variants, and finally using Illumina sequencing to assess the frequency of each mutation in the input mutant genes and the resulting viruses. Mutations that interfere with NP function or stability impair or ablate viral growth, since NP plays an essential role in influenza genome packaging, replication, and transcription (Ye et al., 2006; Portela and Digard, 2002). Such mutations will therefore be depleted in the mutant viruses relative to the input mutant genes. Most previous applications of deep mutational scanning have examined single-nucleotide mutations to genes, since such mutations can easily be generated by error-prone PCR or other nucleotide-level mutagenesis techniques. However, many amino-acid mutations are not accessible by single-nucleotide changes. I therefore used a PCR-based strategy to construct codonmutant libraries that contained multi-nucleotide (i.e. GGC→ACT) as well as single-nucleotide 5 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. (i.e. GGC→AGC) mutations. The use of codon-mutant libraries has an added benefit during the subsequent analysis of the deep sequencing when trying to separate true mutations from errors, since the majority (54 of 63) possible codon mutations involve multi-nucleotide changes whereas sequencing and PCR errors generate almost exclusively single-nucleotide changes. I used identical experimental procedures to construct two codon-mutant libraries of NP from the wild type (WT) human H3N2 strain A/Aichi/2/1968, and two from a variant of this NP with a single amino-acid substitution (N334H) that enhances protein stability (Gong et al., 2013; Ashenberg et al., 2013). These codon-mutant libraries are termed WT-1, WT-2, N334H-1, and N334H-2. Each of these four mutant libraries contained > 106 unique plasmid clones. Sanger sequencing of 30 clones drawn roughly equally from the four libraries revealed that the number of codon mutations per clone followed a Poisson distribution with a mean of 2.7 (Figure 1). These codon mutations were distributed roughly uniformly along the gene sequence and showed no obvious biases towards specific mutations (Figure 1). Most of the ≈ 104 unique amino-acid mutations to NP therefore occur in numerous different clones in the four libraries, both individually and in combination with other mutations. To assess effects of the mutations on viral replication, the plasmid mutant libraries were used to create pools of mutant influenza viruses by reverse genetics (Hoffmann et al., 2000). The viruses were passaged twice in tissue culture at low multiplicity of infection to enforce a linkage between genotype and phenotype. The NP gene was reverse-transcribed and PCRamplified from viral RNA after each passage, and similar PCR amplicons were generated from the plasmid mutant libraries and a variety of controls designed to quantify errors associated with sequencing, reverse transcription, and viral passage (Figure 2). The entire process outlined in Figure 2 was performed in parallel but separately for each of the four mutant libraries (WT-1, WT-2, N334H-1, and N334H-2) in what will be termed one experimental replicate. This entire process of viral creation, passaging, and sequencing was then repeated independently for all four libraries in a second experimental replicate. The two independent replicates will be termed replicate A and replicate B. The mutation frequencies in all sample were quantified by Illumina sequencing, using overlapping paired-end reads to reduce errors (Figure 3). Each sample produced ≈ 107 paired reads that could be aligned to NP, providing an average of ≈ 5 × 105 calls per codon (Figure 4). Sequencing of unmutated NP plasmid revealed a low rate of errors, which were almost exclusively single-nucleotide changes (Figure 5). As expected, the plasmid mutant libraries contained a high frequency of single and multi-nucleotide codon mutations (Figure 5). Muta6 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. tion frequencies for unmutated RNA or viruses created from unmutated NP plasmid were only slightly above the sequencing error rate (Figure 5), indicating that reverse-transcription and viral replication introduced few mutations relative to the targeted mutagenesis in the plasmid libraries. Mutation frequencies were reduced in the mutant viruses relative to the mutant plasmids used to create these viruses, particularly for nonsynonymous and stop-codon mutations (Figure 5) – consistent with selection purging deleterious mutations. These results indicate that the deep mutational scanning experiment successfully introduced many of the NP variants in the plasmid mutant libraries into mutant viruses which were then subjected to purifying selection against mutations that interfered with viral replication. A key question is the extent to which the possible mutations were sampled in both the plasmid mutant libraries and the mutant viruses created from these plasmids. The deep mutational scanning would not achieve its goal if only a small fraction of possible mutations are sampled by the mutant plasmids or by the mutant viruses created from these plasmids (the latter might be the case if there is a bottleneck during virus creation such that all viruses are generated from only a few plasmids). Fortunately, Figure 6 shows that the sampling of mutations was quite extensive in both the mutant plasmids and the mutant viruses. Specifically, Figure 6 suggests that for each replicate, nearly all codon mutations were sampled numerous times in the plasmid mutant libraries, and that over 75% of codon mutations were sampled by the mutant viruses. Figure 6 also suggests that replicate A was technically superior to replicate B in the thoroughness with which mutations were sampled by the mutant viruses. Because most amino acids are encoded by multiple codons, the fraction of amino-acid mutations sampled in each replicate is even higher than the > 75% of sampled codon mutations. So while the experiments may not have exhaustively examined every possible codon mutation, the thoroughness of sampling is certainly sufficient to make the sort of statistical inferences about mutational effects that are necessary to construct a quantitative evolutionary model. Inference of site-specific amino-acid preferences Qualitatively, it is obvious that changes in mutation frequencies between the plasmid mutant libraries and the resulting mutant viruses reflect selection. But it is less obvious how to quantitatively analyze this information. Selection acts on the full genomes of all viruses in the population. In contrast, the experiments only measure site-independent mutation frequencies averaged over the population. Here I have chosen to analyze this data by assuming that each 7 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. site has an inherent preference for each possible amino acid. The motivation for envisioning site-heterogenous but site-independent amino-acid preferences comes from experiments suggesting that the dominant constraint on mutations that fix during NP evolution relates to protein stability (Gong et al., 2013), and that mutational effects on stability tend to be conserved in a site-independent manner (Ashenberg et al., 2013). Because the experiments generally examine each mutation in combination with several other mutations (the average clone has between 2 and 3 codon mutations; Figure 1), the site-specific amino-acid preferences are not simply selection coefficients for specific mutations. Instead, they reflect the effect of each mutation averaged over a set of genetic backgrounds. P Specifically, let πr,a denote the preference of site r for amino-acid a, with πr,a = 1. a Figure 5 indicates that most observed mutations are the result of the desired codon mutagenesis, but that there is also a low rate of apparent mutations arising from Illumina sequencing errors and reverse transcription. The expected frequency fr,x of mutant codon x at site r in the mutant viruses is related to the preference πr,A(x) for its encoded amino-acid A (x) by fr,x = r,x +ρr,x + µ ×πr,A(x) P r,x where µr,x is the frequency that site r is mutagenized to codon x in the plasmid µr,y ×π y r,A(y) mutant library, r,x is the frequency the site is erroneously identified as x during sequencing, ρr,x is the frequency the site is mutated to x during reverse transcription, y is summed over all codons, and the probability that a site experiences multiple mutations or errors in the same clone is taken to be negligibly small. The observed codon counts are multinomially distributed around these expected frequencies, so by placing a symmetric Dirichlet-distribution prior over πr,a and jointly estimating the error (r,x and ρr,x ) and mutation (µr,x ) rates from the appropriate samples in Figure 2, it is possible to infer the posterior mean for all amino-acid preferences by MCMC (see the Methods section). A basic check on the consistency of the overall experimental and computational approach is to compare the amino-acid preferences inferred from different replicates, or different viral passages of the same replicate. Figure 7A,B shows that the preferences inferred from the first and second viral passages within each replicate are extremely similar, indicating that most selection occurs during initial viral creation and passage and that technical variation (preparation of samples, stochasticity in sequencing, etc) has little impact. A more crucial comparison is between the preferences inferred from the two independent experimental replicates. This comparison (Figure 7C) shows that preferences from the independent replicates are substantially but less perfectly correlated – probably the imperfect correlation is because the mutant viruses created by reverse genetics independently in each replicate are different incomplete samples 8 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. of the many clones in the plasmid mutant libraries. Nonetheless, the substantial correlation between replicates shows that the sampling is sufficient to clearly reveal inherent preferences despite these experimental imperfections. Presumably better inferences can be made by aggregating data via averaging of the preferences from both replicates. Figure 7D shows such average preferences from the first passage of both replicates. These preferences are consistent with existing knowledge about NP function and stability. For example, at the conserved residues in NP’s RNA binding interface (Ye et al., 2006), the amino acids found in natural sequences tend to be the ones with the highest preferences (Table 4). Similarly, for mutations that have been experimentally characterized as having large effects on NP protein stability (Gong et al., 2013; Ashenberg et al., 2013), the stabilizing amino acid has the higher preference (Table 5). The experimentally determined evolutionary model The final step is to use the amino-acid preferences to estimate the fixation probabilities Fr,xy , which can then be combined with the mutation rates to create a fully experimentally determined evolutionary model. Intuitively, it is obvious that the amino-acid preferences provide information about the fixation probabilities. For instance, it seems reasonable to expect that a mutation from x to y at site r will be more likely to fix (relatively larger value of Fr,xy ) if amino-acid A (y) is preferred to A (x) at this this site (if πr,A(y) > πr,A(x) ) and less likely to fix if πr,A(y) < πr,A(x) . However, the exact relationship between the amino-acid preferences and the fixation probabilities is unclear. A rigorous derivation would require knowledge of unknown and probably unmeasurable population-genetics parameters for both the deep mutational scanning experiment and the naturally evolving populations that gave rise to the sequences being analyzed phylogenetically. Instead, I provide two heuristic relationships. Both relationships satisfy detailed balance (reversibility), such that πr,A(x) × Fr,xy = πr,A(y) × Fr,yx , meaning that Fr,xy defines a Markov process with πr,A(x) proportional to its stationary state when all aminoacid interchanges are equally probable. Other relationships between the amino-acid preferences and the fixation probabilities are certainly possible, and so this paper provides the raw data to enable others to explore such relationships ad naseum. It is helpful to first consider what the amino-acid preferences values actually represent. Most NP variants in the deep mutational scanning libraries contain multiple mutations, so the aminoacid preferences represent the mutational effects averaged over the nearby genetic neighborhood of the parent protein. Therefore, one interpretation is that a preference is proportional to the 9 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. fraction of genetic backgrounds in which a mutation is tolerated, such that a mutation from x to y is always tolerated if πr,A(y) > πr,A(x) , but is only sometimes tolerated if πr,A(x) < πr,A(y) . In this interpretation, there should be strong selection during initial viral growth depending on whether the mutation is tolerated in the particular genetic background in which it occurs, and then there should be little further enrichment or depletion during subsequent viral passages – loosely consistent with Figure 7A,B, which shows that the amino-acid preferences inferred after two viral passages are very similar to those inferred after one passage. Note that this interpretation can be related to the the selection-threshold evolutionary dynamics described in (Bloom et al., 2007). An equation that describes this scenario is Fr,xy 1 = πr,A(y) πr,A(x) if πr,A(y) ≥ πr,A(x) otherwise. (Equation 3) This equation is equivalent to the Metropolis acceptance criterion (Metropolis et al., 1953). An alternative interpretation is that πr,A(x) reflects the selection coefficient for the aminoacid A (x) at site r. In this case, if the πr,a values represent the expected amino-acid equilibrium frequencies in a hypothetical evolving population in which all amino-acid interchanges are equally likely, and assuming (probably unrealistically) that this hypothetical population and the actual population in which NP evolves are in the weak-mutation limit and have identical constant effective population sizes, then Halpern and Bruno (1998) derive Fr,xy 1 πr,A(y) = ln πr,A(x) 1− πr,A(x) πr,A(y) if πr,A(x) = πr,A(y) otherwise. (Equation 4) Given one of these definitions for the fixation probabilities and the mutation rates defined by Equation 2, the experimentally determined evolutionary model is defined by Equation 1. For the mutation rates and fixation probabilities used here, this evolutionary model defines a stochastic process with a unique stationary state for each site r. These stationary states give the expected amino-acid frequencies at evolutionary equilibrium. These evolutionary equilibrium frequencies are shown in Figure 8, and are somewhat different than the amino-acid preferences since they also depend on the structure of the genetic code (and the mutation rates when these are non-symmetric). For example, if arginine and lysine have equal preferences at a site, arginine 10 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. will be more evolutionarily abundant since it has more codons. Phylogenetic analyses The experimentally determined evolutionary model can be used to compute phylogenetic likelihoods, thereby enabling its comparison to existing models. I used codonPhyML (Gil et al., 2013) to infer maximum-likelihood trees (Figure 9) for NP sequences from human influenza using the Goldman-Yang (GY94) (Goldman and Yang, 1994) and the Kosiol et al. (KOSI07) (Kosiol et al., 2007) codon substitution models. In the simplest form, GY94 contains 11 free parameters (9 equilibrium frequencies plus transition-transversion and synonymous-nonsynonymous ratios), while KOSI07 contains 62 parameters (60 frequencies plus transition-transversion and synonymous-nonsynonymous ratios). More complex variants add parameters allowing variation in substitution rate (Yang, 1994) or synonymous-nonsynonymous ratio among sites or lineages (Yang et al., 2000; Yang and Nielsen, 1998). For all these models, HYPHY (Pond et al., 2005) was used to calculate the likelihood after optimizing branch lengths for the tree topologies inferred by codonPhyML. Comparison of these likelihoods strikingly validates the superiority of the experimentally determined model (Table 6 and Table 7). Adding free parameters generally improves a model’s fit to data, and this is true within GY94 and KOSI07. But the parameter-free experimentally determined evolutionary model describes the sequence phylogeny with a likelihood far greater than even the most highly parameterized GY94 and KOSI07 variants. Interpreting the aminoacid preferences as the fraction of genetic backgrounds that tolerate a mutation (Equation 3) outperforms interpreting them as selection coefficients (Equation 4), although either interpretation yields evolutionary models for NP far superior to GY94 or KOSI07. Comparison using Aikake information content (AIC) to penalize parameters (Posada and Buckley, 2004) even more emphatically highlights the superiority of the experimentally determined models. There is a clear correlation between the quality and volume of experimental data and the phylogenetic fit: models from individual experimental replicates give lower likelihoods than both replicates combined, and the technically superior replicate A (Figure 6) gives a better likelihood than replicate B (Table 6 and Table 7). The superiority of the experimentally determined model is due to measurement of site-specific amino-acid preferences: randomizing preferences among sites gives likelihoods far worse than any other model. 11 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. Discussion These results clearly establish that an experimentally determined evolutionary model is far superior to existing models for describing the phylogeny of NP gene sequences. The extent of this superiority is striking – the parameter-free evolutionary model outperforms even the most highly parameterized existing model by over 400 log-likelihood units before correcting for the differences in the number of parameters (Table 6). The reason for this superiority is easy to understand: proteins have strong and fairly conserved preferences for specific amino acids at different sites (Ashenberg et al., 2013), but these site-specific preferences are ignored by most existing phylogenetic models. Inspection of the overlaid bars in Figure 7D illustrates the inadequacy of trying to capture these preferences simply by classifying sites based on gross features of protein structure (Thorne et al., 1996; Goldman et al., 1998) – the site-specific amino-acid preferences are not simply related to secondary structure or solvent accessibility. The complexity of the preferences in Figure 7D also show the limitations of attempting to infer amino-acid preference parameters for a limited number of site classes from sequence data (Lartillot and Philippe, 2004; Le et al., 2008; Wu et al., 2013; Wang et al., 2008), as it is clear that each site is unique. Direct experimental measurement therefore represents a highly attractive method for determining the idiosyncratic constraints that affect the evolution of each site in a gene. Another appealing aspect of an experimentally determined evolutionary model is interpretability. One of the more frustrating aspects of existing evolutionary models is the inability to assign meaningful interpretations to many of their proliferating free parameters. For instance, many models infer a shape parameter describing a gamma-distribution of rates – the biological meaning of such a parameter at the molecular level is completely unclear. Similarly, the equilibrium frequency parameters used by most existing models reflect some unknown combination of mutation and selection. On the other hand, all aspects of the parameter-free experimentally determined evolutionary model described here can be related to direct measurements. So even if such a model were eventually augmented with a few free parameters, this could be done in a way that allowed these parameters to be directly interpreted in terms of the molecular processes of biology and evolution. The major drawback of the experimentally determined evolutionary model described here is its lack of generality. While this model is clearly superior for influenza NP, it is entirely unsuitable for other genes. At first blush, it might seem that the arduous experiments described here provide data that is unlikely to ever become available for most situations of interest. However, it 12 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. is worth remembering that today’s arduous experiment frequently becomes routine in just a few years. For example, the very gene sequences that are the subjects of molecular phylogenetics were once rare pieces of data – now such sequences are so abundant that they easily overwhelm modern computers. The experimental ease of the deep mutational scanning approach used here is on a comparable trajectory: similar approaches have already been applied to several proteins (Fowler et al., 2010; Melamed et al., 2013; Traxlmayr et al., 2012; Starita et al., 2013; Roscoe et al., 2013), and there continue to be rapid improvements in techniques for mutagenesis (Firnberg and Ostermeier, 2012; Jain and Varadarajan, 2014) and sequencing (Hiatt et al., 2010; Schmitt et al., 2012; Lou et al., 2013). It is therefore especially encouraging that the phylogenetic fit of the NP evolutionary model improves with the quality and volume of experimental data from which it is derived (Table 6). The increasing availability and quality of similar high-throughput data for a vast range of proteins has the potential to transform phylogenetic analyses by greatly increasing the accuracy of evolutionary models, while at the same time replacing a plethora of free parameters with experimentally measured quantities that can be given clear biological and evolutionary interpretations. 13 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. Methods Contents of methods Availability of data and computer code . . . . . . . . . . Experimental measurement of mutation rates . . . . . . . Construction of NP codon-mutant libraries . . . . . . . . Viral growth and passage . . . . . . . . . . . . . . . . . . Sample preparation and Illumina sequencing . . . . . . . Read alignment and quantification of mutation frequencies Inference of the amino-acid preferences . . . . . . . . . . Phylogenetic analyses . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14 15 16 19 21 24 25 31 Availability of data and computer code • The Illumina sequencing data are available at the SRA under accession SRP036064 at http://www.ncbi.nlm.nih.gov/sra/?term=SRP036064. • A detailed description of the computational process used to analyze the sequencing data and infer the amino-acid preferences is at http://jbloom.github.io/mapmuts/ example_2013Analysis_Influenza_NP_Aichi68.html. The source code itself is at https://github.com/jbloom/mapmuts. NOTE: the link to the description is accessible now; access to the source code itself will be made publicly available upon publication of the paper. If you are a reviewer and would like to see the source code, please contact the editor to relay the request for access to the author. • A detailed description of the computational process used for the phylogenetic analyses is available at http://jbloom.github.io/phyloExpCM/example_2013Analysis_ Influenza_NP_Human_1918_Descended.html. The source code itself is at https://github.com/jbloom/phyloExpCM. NOTE: the link to the description is accessible now; access to the source code itself will be made publicly available upon publication of the paper. If you are a reviewer and would like to see the source code, please contact the editor to relay the request for access to the author. 14 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. Experimental measurement of mutation rates To measure mutation rates, I generated GFP-carrying viruses with all genes derived from A/WSN/1933 (H1N1) by reverse genetics as described previously (Bloom et al., 2010). These viruses were repeatedly passaged at limiting dilution in MDCK-SIAT1-CMV-PB1 cells (Bloom et al., 2010) using what will be referred to as low serum media (Opti-MEM I with 0.5% heat-inactivated fetal bovine serum, 0.3% BSA, 100 U/ml penicillin, 100 µg/ml streptomycin, and 100 µg/ml calcium chloride) – a moderate serum concentration was retained and no trypsin was added because viruses with the WSN HA and NA are trypsin independent (Goto and Kawaoka, 1998). These passages were performed for 27 replicate populations. For each passage, a 100 µl volume containing the equivalent of 2 µl of virus collection was added to the first row of a 96-well plate. The virus was then serially diluted 1:5 down the plate such that at the conclusion of the dilutions, each well contained 80 µl of virus dilution, and the final row contained the equivalent of (0.8 × 2 µl) /57 ≈ 2 × 10−5 µl of the original virus collection. MDCK-SIAT1-CMV-PB1 cells were then added to each well in a 50 µl volume containing 2.5 × 103 cells. The plates were grown for approximately 80 hours, and wells were examined for cytopathic effect indicative of viral growth. Most commonly the last well with clear cytopathic effect was in row E or F (corresponding to an infection volume of between (0.8 × 2 µl) /54 ≈ 3 × 10−3 and (0.8 × 2 µl) /55 ≈ 5 × 10−4 µl, although this varied somewhat among the replicates and passages. The last well with cytopathic effect was collected and used as the parent population for the next round of limiting-dilution passage. After 25 limiting-dilution passages, 10 of the 27 viral populations no longer caused any visible GFP expression in the cells in which they caused cytopathic effect, indicating fixation of a mutation that ablated GFP fluorescence. The 17 remaining populations all caused fluorescence in infected cells, although in some cases the intensity was visibly reduced – these populations therefore must have retained at least a partially functional GFP. Total RNA was purified from each viral population, the PB1 segment was reverse-transcribed using the primers CATGATCGTCTCGTATTAGTAGAAACAAGGCATTTTTTCATGAAGGACAAGC and CATGATCG TCTCAGGGAGCGAAAGCAGGCAAACCATTTGATTGG, and the reverse-transcribed cDNA was amplified by conventional PCR using the same primers. For 22 of the 27 replicate viral populations, this process amplified an insert with the length expected for the full GFP-carrying PB1 segment. For 2 of the replicates, this amplified inserts between 0.4 and 0.5 kb shorter than the expected length, suggesting an internal deletion in part of the segment. For 3 replicates, this failed to amplify any insert, suggesting total loss of the GFP-carrying PB1 segment, a very large 15 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. internal deletion, or rearrangement that rendered the reverse-transcription primers ineffective. For the 24 replicates from which an insert could be amplified, the GFP coding region of the PCR product was Sanger sequenced to determine the consensus sequence. The results are in Table 1 and Table 2. To estimate Rm→n , it is necessary to normalize by the nucleotide composition of the GFP gene. The numbers of each nucleotide in this gene are: NA = 175, NT = 103, NC = 241, and NG = 201. Given that the counts in Table 2 come after 25 passages of 24 replicates: Rm→n = Rmc →nc = 1 Nm→n + Nmc →nc + C × 24 × 25 × 2 Nm + Nm c (Equation 5) where C is a pseudocount that is added to the observed counts to avoid estimating rates of zero and Nm→n is the number of observed mutations from m to n in Table 2. The values of Rm→n estimated from Equation 5 give the probability that a nucleotide that is already m will mutate to n in a single tissue-culture generation. Using a value of C = 1 (a pseudocount of one) gives the rates in Table 3. Construction of NP codon-mutant libraries The goal was to construct a mutant library with an average of two to three random codon mutations per gene. Most techniques for creating mutant libraries of full-length genes, such as error-prone PCR (Cirino et al., 2003) and chemical mutagenesis (Neylon, 2004), introduce mutations at the nucleotide level, meaning that codon substitutions involving multiple nucleotide changes occur at a negligible rate. There are established methods for mutating specific sites at the codon level with synthetic oligonucleotides that contain triplets of randomized NNN nucleotides (Georgescu et al., 2003). However, these oligo-based codon mutagenesis techniques are typically only suitable for mutating a small number of sites. Recently, several groups have developed strategies for introducing codon mutations along the lengths of entire genes (Firnberg and Ostermeier, 2012; Jain and Varadarajan, 2014, J. Kitzman and J. Shendure - personal communication). Most of these strategies are designed to create exactly one codon mutation per gene. For the purpose of my experiments, it was actually desirable to introduce a distribution of around one to four codon mutations per gene to examine the average effects of mutations in a variety of closely related genetic backgrounds. Therefore, I devised a codon-mutagenesis protocol specifically for this purpose. This technique involved iterative rounds of low-cycle PCR with pools of mutagenic syn16 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. thetic oligonucleotides that each contain a randomized NNN triplet at a specific codon site. Two replicate libraries each of the wildtype and N334H variants of the Aichi/1968 NP were prepared in full biological duplicate, beginning each with independent preps of the plasmid templates pHWAichi68-NP and pHWAichi68-NP-N334H. The sequences of the NP genes in these plasmids are provided in (Gong et al., 2013). To avoid cross-contamination, all purification steps used an independent gel for each sample, with the relevant equipment thoroughly washed to remove residual DNA. First, for each codon except for that encoding the initiating methionine in the 498-residue NP gene, I designed an oligonucleotide that contained a randomized NNN nucleotide triplet preceded by the 16 nucleotides upstream of that codon in the NP gene and followed by the 16 nucleotides downstream of that codon in the NP gene. I ordered these oligonucleotides in 96well plate format from Integrated DNA Technologies, and combined them in equimolar quantities to create the forward-mutagenesis primer pool. I also designed and ordered the reverse complement of each of these oligonucleotides, and combined them in equimolar quantities to create the reverse-mutagenesis pool. The primers for the N334H variants differed only for those that overlapped the N334H codon. I also designed end primers that annealed to the termini of the NP sequence and contained sites appropriate for BsmBI cloning into the influenza reversegenetics plasmid pHW2000 (Hoffmann et al., 2000). These primers are 5’-BsmBI-Aichi68-NP (catgatcgtctcagggagcaaaagcagggtagataatcactcacag) and 3’-BsmBI-Aichi68NP (catgatcgtctcgtattagtagaaacaagggtatttttcttta). I set up PCR reactions that contained 1 µl of 10 ng/µl template pHWAichi68-NP plasmid (Gong et al., 2013), 25 µl of 2X KOD Hot Start Master Mix (product number 71842, EMD Millipore), 1.5 µl each of 10 µM solutions of the end primers 5’-BsmBI-Aichi68-NP and 3’BsmBI-Aichi68-NP, and 21 µl of water. I used the following PCR program (referred to as the amplicon PCR program in the remainder of this paper): 1. 2. 3. 4. 5. 6. 7. 95 ◦ C for 2 minutes 95◦ C for 20 seconds 70◦ C for 1 second 50◦ C for 30 seconds cooling to 50◦ C at 0.5◦ C per second. 70◦ C for 40 seconds Repeat steps 2 through 5 for 24 additional cycles Hold 4◦ C The PCR products were purified over agarose gels using ZymoClean columns (product number 17 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. D4002, Zymo Research) and used as templates for the initial codon mutagenesis fragment PCR. Two fragment PCR reactions were run for each template. The forward-fragment reactions contained 15 µl of 2X KOD Hot Start Master Mix, 2 µl of the forward mutagenesis primer pool at a total oligonucleotide concentration of 4.5 µM, 2 µl of 4.5 µM 3’-BsmBI-Aichi68-NP, 4 µl of 3 ng/µl of the aforementioned gel-purified linear PCR product template, and 7 µl of water. The reverse-fragment reactions were identical except that the reverse mutagenesis pool was substituted for the forward mutagenesis pool, and that 5’-BsmBI-Aichi68-NP was substituted for 3’-BsmBI-Aichi68-NP. The PCR program for these fragment reactions was identical to the amplicon PCR program except that it utilized a total of 7 rather than 25 thermal cycles. The products from the fragment PCR reactions were diluted 1:4 in water. These dilutions were then used for the joining PCR reactions, which contained 15 µl of 2X KOD Hot Start Master Mix, 4 µl of the 1:4 dilution of the forward-fragment reaction, 4 µl of the 1:4 dilution of the reverse-fragment reaction, 2 µl of 4.5 µM 5’-BsmBI-Aichi68-NP, 2 µl of 4.5 µM 3’-BsmBIAichi68-NP, and 3 µl of water. The PCR program for these joining reactions was identical to the amplicon PCR program except that it utilized a total of 20 rather than 25 thermal cycles. The products from these joining PCRs were purified over agarose gels. The purified products of the first joining PCR reactions were used as templates for a second round of fragment reactions followed by joining PCRs. These second-round products were used as templates for a third round. The third-round products were purified over agarose gels, digested with BsmBI (product number R0580L, New England Biolabs), and ligated into a dephosphorylated (Antarctic Phosphatase, product number M0289L, New England Biolabs) BsmBI digest of pHW2000 (Hoffmann et al., 2000) using T4 DNA ligase. The ligations were purified using ZymoClean columns, electroporated into ElectroMAX DH10B T1 phage-resistant competent cells (product number 12033-015, Invitrogen) and plated on LB plates supplemented with 100 µg/ml of ampicillin. These transformations yielded between 400,000 and 800,000 unique transformants per plate, as judged by plating a 1:4,000 dilution of the transformations on a second set of plates. Transformation of a parallel no-insert control ligation yielded approximately 50-fold fewer colonies, indicating that self ligation of pHW2000 only accounts for a small fraction of the transformants. For each library, I performed three transformations, grew the plates overnight, and then scraped the colonies into liquid LB supplemented with ampicillin and mini-prepped several hours later to yield the plasmid mutant libraries. These libraries each contained in excess of 106 unique transformants, most of which will be unique codon mutants of the NP gene. 18 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. I sequenced the NP gene for 30 individual clones drawn from the four mutant libraries. As shown in Figure 1, the number of mutations per clone was approximately Poisson distributed and the mutations occurred uniformly along the primary sequence. If all codon mutations are made with equal probability, 9/63 of the mutations should be single-nucleotide changes, 27/63 should be two-nucleotide changes, and 27/63 should be three-nucleotide changes. This is approximately what was observed in the Sanger-sequenced clones. The nucleotide composition of the mutated codons was roughly uniform, and there was no tendency for clustering of multiple mutations in primary sequence. The full results of the Sanger sequencing and analysis are https://github.com/jbloom/SangerMutantLibraryAnalysis/tree/v0.1. The results of this Sanger sequencing are compatible with the mutation frequencies obtained from deep sequencing the mutDNA samples after subtracting off the sequencing error rate estimated from the DNA samples (Figure 5), especially considering that the statistics from the Sanger sequencing are subject to sampling error due to the limited number of clones analyzed. Viral growth and passage As described in the main text, two independent replicates of viral growth and passage were performed (replicate A and replicate B). The experimental procedures were mostly identical between replicates, but there were a few small differences. In the actual experimental chronology, replicate B was performed first, and the modifications in replicate A were designed to improve the sampling of the mutant plasmids by the created mutant viruses. These modifications may be the reason why replicate A slightly outperforms replicate B by two objective measures: the viruses more completely sample the codon mutations (Figure 6), and the evolutionary model derived solely from replicate A gives a higher likelihood than the evolutionary model derived solely from replicate B (Table 6 and Table 7). For replicate B, I used reverse genetics to rescue viruses carrying the Aichi/1968 NP or one of its derivatives, PB2 and PA from the A/Nanchang/933/1995 (H3N2), a PB1 gene segment encoding GFP, and HA / NA / M / NS from A/WSN/1933 (H1N1) strain. With the exception of the variants of NP used, these viruses are identical to those described in (Gong et al., 2013), and were rescued by reverse genetics in 293T-CMV-Nan95-PB1 and MDCK-SIAT1-CMV-Nan95PB1 cells as described in that reference. The previous section describes four NP codon-mutant libraries, two of the wildtype Aichi/1968 gene (WT-1 and WT-2) and two of the N334H variant (N334H-1 and N334H-2). I grew mutant viruses from all four mutant libraries, and four 19 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. paired unmutated viruses from independent preps of the parent plasmids. A major goal was to maintain diversity during viral creation by reverse genetics – the experiment would obviously be undermined if most of the rescued viruses derived from a small number of transfected plasmids. I therefore performed the reverse genetics in 15 cm tissue-culture dishes to maximize the number of transfected cells. Specifically, 15 cm dishes were seeded with 107 293T-CMVNan95-PB1 cells in D10 media (DMEM with 10% heat-inactivated fetal bovine serum, 2 mM L-glutamine, 100 U/ml penicillin, and 100 µg/ml streptomycin). At 20 hours post-seeding, the dishes were transfected with 2.8 µg of each of the eight reverse-genetics plasmids. At 20 hours post-transfection, about 20% of the cells expressed GFP (indicating transcription by the viral polymerase of the GFP encoded by pHH-PB1flank-eGFP), suggesting that many unique cells were transfected. At 20 hours post-transfection, the media was changed to the low serum media described above. At 78 hours post-transfection, the viral supernatants were collected, clarified by centrifugation at 2000xg for 5 minutes, and stored at 4◦ C. The viruses were titered by flow cytometry as described previously (Gong et al., 2013) – titers were between 1 × 103 and 4 × 103 infectious particles per µl. A control lacking the NP gene yielded no infectious virus as expected. The virus was then passaged in MDCK-SIAT1-CMV-Nan95-PB1 cells. These cells were seeded into 15 cm dishes, and when they had reached a density of 107 per plate they were infected with 106 infectious particles (MOI of 0.1) of the transfectant viruses in low serum media. After 18 hours, 30-50% of the cells were green as judged by microscopy, indicating viral spread. At 40 hours post-transfection, 100% of the cells were green and many showed clear signs of cytopathic effect. At this time the viral supernatants were again collected, clarified, and stored at 4◦ C. NP cDNA isolated from these viruses was the source the deep-sequencing samples virus-p1 and mutvirus-p1 in Figure 2. The virus was then passaged a second time exactly as before (again using an MOI of 0.1). NP cDNA from these twice-passaged viruses constituted the source for the samples virus-p2 and mutvirus-p2 in Figure 2. For replicate A, all viruses (both the four mutant viruses and the paired unmutated controls) were re-grown independently from the same plasmids preps used for replicate B. The experimental process was identical to that used for replicate B except for the following: • Standard influenza viruses (rather than the GFP-carrying variants) were used, so plasmid pHW-Nan95-PB1 (Gong et al., 2013) was substituted for pHH-PB1flank-eGFP during reverse genetics, and 293T and MDCK-SIAT1 cells were substituted for the PB1-expressing variants. 20 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. • Rather than creating the viruses by transfecting a single 15-cm dish, each of the eight virus samples was created by transfecting two 12-well dishes, with the dishes seeded at 3 × 105 293T and 5 × 104 MDCK-SIAT1 cells prior to transfection. The passaging was then done in four 10 cm dishes for each sample, with the dishes seeded at 4×106 MDCKSIAT1 cells 12-14 hours prior to infection. The passaging was still done at an MOI of 0.1. These modifications were designed to increase diversity in the viral population. • The viruses were titered by TCID50 rather than flow cytometry. Sample preparation and Illumina sequencing For each sample, a PCR amplicon was created to serve as the template for Illumina sequencing. The steps used to generate the PCR amplicon for each of the seven sample types (Figure 2) are listed below. Once the PCR template was generated, for all samples the PCR amplicon was created using the amplicon PCR program described above in 50 µl reactions consisting of 25 µl of 2X KOD Hot Start Master Mix, 1.5 µl each of 10 µM of 5’-BsmBI-Aichi68-NP and 3’-BsmBIAichi68-NP, the indicated template, and ultrapure water. A small amount of each PCR reaction was run on an analytical agarose gel to confirm the desired band. The remainder was then run on its own agarose gel without any ladder (to avoid contamination) after carefully cleaning the gel rig and all related equipment. The amplicons were excised from the gels, purified over ZymoClean columns, and analyzed using a NanoDrop to ensure that the absorbance at 260 nm was at least 1.8 times that at 230 nm and 280 nm. The templates were as follows: • DNA: The templates for these amplicons were 10 ng of the unmutated independent plasmid preps used to create the codon mutant libraries. • mutDNA: The templates for these amplicons were 10 ng of the plasmid mutant libraries. • RNA: This amplicon quantifies the net error rate of transcription and reverse transcription. Because the viral RNA is initially transcribed from the reverse-genetics plasmids by RNA polymerase I but the bidirectional reverse-genetics plasmids direct transcription of RNA by both RNA polymerases I and II (Hoffmann et al., 2000), the RNA templates for these amplicons were transcribed from plasmids derived from pHH21 (Neumann et al., 1999), which only directs transcription by RNA polymerase I. The unmutated WT and N334H NP genes were cloned into this plasmid to create pHH-Aichi68-NP and pHH-Aichi68NP-N334H. Independent preparations of these plasmids were transfected into 293T cells, 21 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. transfecting 2 µg of plasmid into 5 × 105 cells in 6-well dishes. After 32 hours, total RNA was isolated using Qiagen RNeasy columns and treated with the Ambion TURBO DNAfree kit (Applied Biosystems AM1907) to remove residual plasmid DNA. This RNA was used as a template for reverse transcription with AccuScript (Agilent 200820) using the primers 5’-BsmBI-Aichi68-NP and 3’-BsmBI-Aichi68-NP. The resulting cDNA was quantified by qPCR specific for NP (see below), which showed high levels of NP cDNA in the reverse-transcription reactions but undetectable levels in control reactions lacking the reverse transcriptase, indicating that residual plasmid DNA had been successfully removed. A volume of cDNA that contained at least 2 × 106 NP cDNA molecules (as quantified by qPCR) was used as template for the amplicon PCR reaction. Control PCR reactions using equivalent volumes of template from the no reverse-transcriptase control reactions yielded no product. • virus-p1: This amplicon was derived from virus created from the unmutated plasmid and collected at the end of the first passage. Clarified virus supernatant was ultracentrifuged at 64,000 x g for 1.5 hours at 4 ◦ C, and the supernatant was decanted. Total RNA was then isolated from the viral pellet using a Qiagen RNeasy kit. This RNA was used as a template for reverse transcription with AccuScript using the primers 5’-BsmBI-Aichi68-NP and 3’BsmBI-Aichi68-NP. The resulting cDNA was quantified by qPCR, which showed high levels of NP cDNA in the reverse-transcription reactions but undetectable levels in control reactions lacking the reverse transcriptase. A volume of cDNA that contained at least 107 NP cDNA molecules (as quantified by qPCR) was used as template for the amplicon PCR reaction. Control PCR reactions using equivalent volumes of template from the no reverse-transcriptase control reactions yielded no product. • virus-p2, mutvirus-p1, mutvirus-p2: These amplicons were created as for the virus-p1 amplicons, but used the appropriate virus as the initial template as outlined in Figure 2. An important note: it was found that the use of relatively new RNeasy kits with β-mercaptoethanol (a reducing agent) freshly added per the manufacturer’s instructions was necessary to avoid what appeared to be oxidative damage to purified RNA. The overall experiment only makes sense if the sequenced NP genes derive from a large diversity of initial template molecules. Therefore, qPCR was used to quantify the molecules produced by reverse transcription to ensure that a sufficiently large number were used as PCR templates to create the amplicons. The qPCR primers were 5’-Aichi68-NP-for (gcaacagctggtctgactcaca) 22 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. and 3’-Aichi68-NP-rev (tccatgccggtgcgaacaag). The qPCR reactions were performed using the SYBR Green PCR Master Mix (Applied Biosystems 4309155) following the manufacturer’s instructions. Linear NP PCR-ed from the pHWAichi68-NP plasmid was used as a quantification standard – the use of a linear standard is important, since amplification efficiencies differ for linear and circular templates (Hou et al., 2010). The standard curves were linear with respect to the amount of NP standard over the range from 102 to 109 NP molecules. These standard curves were used to determine the absolute number of NP cDNA molecules after reverse transcription. Note that the use of only 25 thermal cycles in the amplicon PCR program provides a second check that there are a substantial number of template molecules, as this moderate number of thermal cycles will not lead to sufficient product if there are only a few template molecules. In order to allow the Illumina sequencing inserts to be read in both directions by paired-end 50 nt reads (Figure 3), it was necessary to us an Illumina library-prep protocol that created NP inserts that were roughly 50 nt in length. This was done via a modification of the Illumina Nextera protocol. First, concentrations of the PCR amplicons were determined using PicoGreen (Invitrogen P7859). These amplicons were used as input to the Illumina Nextera DNA Sample Preparation kit (Illumina FC-121-1031). The manufacturer’s protocol for the tagmentation step was modified to use 5-fold less input DNA (10 ng rather than 50 ng) and two-fold more tagmentation enzyme (10 µl rather than 5 µl), and the incubation at 55 ◦ C was doubled from 5 minutes to 10 minutes. Samples were barcoded using the Nextera Index Kit for 96-indices (Illumina FC121-1012). For index 1, the barcoding was: DNA with N701, RNA with N702, mutDNA with N703, virus-p1 with N704, mutvirus-p1 with N705, virus-p2 with N706, and mutvirus-p2 with N707. After completion of the Nextera PCR, the samples were subjected to a ZymoClean purification rather than the bead cleanup step specified in the Nextera protocol. The size distribution of these purified PCR products was analyzed using an Agilent 200 TapeStation Instrument. If the NP sequencing insert is exactly 50 nt in size, then the product of the Nextera PCR should be 186 nt in length after accounting for the addition of the Nextera adaptors. The actual size distribution was peaked close to this value. The ZymoClean-purified PCR products were quantified using PicoGreen and combined in equal amounts into pools: a WT-1 pool of the seven samples for that library, a WT-2 pool of the seven samples for that library, etc. These pools were subjected to further size selection by running them on a 4% agarose gel versus a custom ladder containing 171 and 196 nt bands created by PCR from a GFP template using the forward primer gcacggggccgtcgccg and the reverse primers tggggcacaagctggagtacaac (for the 23 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. 171 nt band) and gacttcaaggaggacggcaacatcc (for the 196 nt band). The gel slice for the sample pools corresponding to sizes between 171 and 196 nt was excised, and purified using a ZymoClean column. A separate clean gel was run for each pool to avoid cross-contamination. Library QC and cluster optimization were performed using Agilent Technologies qPCR NGS Library Quantification Kit (Agilent Technologies, Santa Clara, CA, USA). Libraries were introduced onto the flow cell using an Illumina cBot (Illumina, Inc., San Diego, CA, USA) and a TruSeq Rapid Duo cBot Sample Loading Kit. Cluster generation and deep sequencing was performed on an Illumina HiSeq 2500 using an Illumina TruSeq Rapid PE Cluster Kit and TruSeq Rapid SBS Kit. A paired-end, 50 nt read-length (PE50) sequencing strategy was performed in rapid run mode. Image analysis and base calling were performed using Illumina’s Real Time Analysis v1.17.20.0 software, followed by demultiplexing of indexed reads and generation of FASTQ files, using Illumina’s CASAVA v1.8.2 software (http://www.illumina. com/software.ilmn). These FASTQ files were uploaded to the SRA under accession SRP036064 (see http://www.ncbi.nlm.nih.gov/sra/?term=SRP036064). Read alignment and quantification of mutation frequencies A custom Python software package, mapmuts, was created to quantify the frequencies of mutations from the Illumina sequencing. A detailed description of the software as utilized in the present work is at http://jbloom.github.io/mapmuts/example_2013Analysis_ Influenza_NP_Aichi68.html. The source code is at https://github.com/jbloom/ mapmuts. Briefly: 1. Reads were discarded if either read in a pair failed the Illumina chastity filter, had a mean Q-score less than 25, or had more than two ambiguous (N) nucleotides. 2. The remaining paired reads were aligned to each other, and retained only if they shared at least 30 nt of overlap, disagreed at no more than one site, and matched the expected terminal Illumina adaptors with no more than one mismatch. 3. The overlap of the paired reads was aligned to NP, disallowing alignments with gaps or more than six nucleotide mismatches. A small fraction of alignments corresponded exclusively to the noncoding termini of the viral RNA; the rest contained portions of the NP coding sequence. 24 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. 4. For every paired read that aligned with NP, the codon identity was called if both reads concurred for all three nucleotides in the codon. If the reads disagreed or contained an ambiguity in that codon, the identity was not called. A summary of alignment statistics and read depth is in Figure 4. The mutation frequencies are summarized in Figure 5, and the counts for mutations in Figure 6. Full data can be accessed via http://jbloom.github.io/mapmuts/example_2013Analysis_Influenza_ NP_Aichi68.html. Inference of the amino-acid preferences The approach described here is based on the assumption that there is an inherent preference for each amino acid at each site in the protein. This assumption is clearly not completely accurate, as the effect of a mutation at one site can be influenced by the identities of other sites. However, experimental work with NP (Gong et al., 2013) and other proteins (Serrano et al., 1993; Bloom et al., 2005; Bershtein et al., 2006; Bloom et al., 2006) suggests that at an evolutionary level, sites interact mostly through generic effects on stability and folding. Furthermore, the effects of mutations on stability and folding tend to be conserved during evolution (Ashenberg et al., 2013; Serrano et al., 1993). So one justification for assuming site-specific but site-independent preferences is that selection on a mutation is mostly determined by whether the protein can tolerate its effect on stability or folding, so stabilizing amino acids will be tolerated in most genetic backgrounds while destabilizing amino acids will only be tolerated in some backgrounds, as has been described experimentally (Gong et al., 2013) and theoretically (Bloom et al., 2007). A more pragmatic justification is that the work here builds off this assumption to create evolutionary models that are much better than existing alternatives. Assume that the preferences are entirely at the amino-acid level and are indifferent to the specific codon (the study of preferences for synonymous codons is an interesting area for future work). Denote the preference of site r for amino-acid a as πr,a , where X πr,a = 1. (Equation 6) a Define πr,a /πr,a0 as the expected ratio of amino-acid a to a0 after viral growth if both are initially introduced into the mutant library at equal frequency. Mutations that enhance viral growth will have larger values of πr,a , while mutations that hamper growth will have lower values of πr,a . 25 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. However, πr,a /πr,a0 cannot be simply interpreted as the fitness effect of mutating site r from a to a0 : because most clones have multiple mutations, this ratio summarizes the effect of a mutation in a variety of related genetic backgrounds. A mutation can therefore have a ratio greater than one due to its inherent effect on viral growth or its effect on the tolerance for other mutations (or both). This analysis does not separate these factors, but experimental work (Gong et al., 2013) has shown that it is fairly common for one mutation to NP to alter the tolerance to a subsequent one. The most naive approach is to set πr,a proportional to the frequency of amino-acid a in mutvirus-p1 divided by its frequency in mutDNA, and then apply the normalization in Equation 6. However, such an approach is problematic for several reasons. First, it fails to account for errors (PCR, reverse-transcription) that inflate the observed frequencies of some mutations. Second, estimating ratios by dividing finite counts is notoriously statistically biased (Pearson, 1910; Ogliore et al., 2011). For example, in the limiting case where a mutation is counted once in mutvirus-p1 and not at all in mutDNA, the ratio is infinity – yet in practice such low counts give little confidence that enough variants have been assayed to estimate the true effect of the mutation. To circumvent these problems, I used an approach that explicitly accounts for the sampling statistics. The approach begins with prior estimates that the πr,a values are all equal, and that the error and mutation rates for each site are equal to the library averages. Multinomial likelihood functions give the probability of observing a set of counts given the πr,a values and the various error and mutation rates. The posterior mean of the πr,a values is estimated by MCMC. Use the counts in DNA to quantify errors due to PCR and sequencing. Use the counts in RNA to quantify errors due to reverse transcription. Assume that transcription of the viral genes from the reverse-genetics plasmids and subsequent replication of these genes by the influenza polymerase introduces a negligible number of new mutations. The second of these assumptions is supported by the fact that the mutation frequency in virus-p1 is close to that in RNA (Figure 5). The first of these assumptions is supported by the fact that stop codons are no more frequent in RNA than in virus-p1 (Figure 5) – deleterious stop codons arising during transcription will be purged during viral growth, while those arising from reverse-transcription and sequencing errors will not. At each site r, there are ncodon codons, indexed by i = 1, 2, . . . ncodon . Let wt (r) denote the wildtype codon at site r. Let NrDNA be the total number of sequencing reads at site r in DNA, P DNA and let nDNA nr,i = NrDNA . r,i be the number of these reads that report codon i at site r, so that i 26 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. Similarly, let NrmutDNA , NrRNA , and Nrmutvirus be the total number of reads at site r and let nmutDNA , r,i RNA mutvirus nr,i , and nr,i be the total number of these reads that report codon i at site r in mutDNA, RNA, and mutvirus-p1, respectively. First consider the rate at which site r is erroneously read as some incorrect identity due to PCR or sequencing errors. Such errors are the only source of non-wildtype reads in the sequencing of DNA. For all i 6= wt (r), define r,i as the rate at which site r is erroneously read P as codon i in DNA. Define r,wt(r) = 1 − r,i to be the rate at which site r is correctly i6=wt(r) DNA where E denotes read as its wildtype identity of wt (r) in DNA. Then r,i = E nDNA r,i /Nr −− → → − DNA DNA the expectation value. Define r = (r,1 , . . . , r,ncodon ) and nr = nr,1 , . . . , nDNA r,ncodon as −− → − DNA given → r and NrDNA is vectors of the r,i and nDNA r,i values, so the likelihood of observing nr −−→ −−→ − − DNA → DNA DNA → , ; N = Mult n , | N Pr nDNA r r r r r r (Equation 7) where Mult denotes the multinomial distribution. Next consider the rate at which site r is erroneously copied during reverse transcription. − These reverse-transcription errors combine with the PCR / sequencing errors defined by → r to create non-wildtype reads in RNA. For all i 6= wt (r), define ρr,i as the rate at which site r P is miscopied to i during reverse transcription. Define ρr,wt(r) = 1 − ρr,i as the rate at i6=wt(r) which site r is correctly reverse transcribed. Ignore as negligibly rare the possibility that a site is subject to both a reverse-transcription and sequencing / PCR error within the same clone (a reasonable assumption as both r,i and ρr,i are very small for i 6= wt (r)). Then r,i + ρr,i − RNA /N where δi,wt(r) is the Kronecker delta (equal to one if i = wt (r) and δi,wt(r) = E nRNA r r,i −−→ − − given → ρr , → r , and NrRNA is zero otherwise). The likelihood of observing nRNA r −−→ −−→ → − − → − − → − RNA → RNA RNA → Pr nRNA | N , ρ , = Mult n ; N , + ρ − δr . r r r r r r r r (Equation 8) → − where δr = δ1,wt(r) , . . . , δncodon ,wt(r) is a vector that is all zeros except for the element wt (r). Next consider the rate at which site r is mutated to some other codon in the plasmid mutant − library. These mutations combine with the PCR / sequencing errors defined by → r to create nonwildtype reads in mutDNA. For all i 6= wt (r), define µr,i as the rate at which site r is mutated P to codon i in the mutant library. Define µr,wt(r) = 1 − µr,i as the rate at which site r is not i6=wt(r) mutated. Ignore as negligibly rare the possibility that a site is subject to both a mutation and a 27 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. sequencing / PCR error within the same clone. Then µr,i +r,i −δi,wt(r) = E nmutDNA /NrmutDNA . r,i −−−−→ − − The likelihood of observing nmutDNA given → µr , → r , and NrmutDNA is r −−−−→ −−−−→ → − − → − − → − mutDNA → mutDNA mutDNA → , µ + − δr . ; N , µ , = Mult n | N Pr nmutDNA r r r r r r r r (Equation 9) Finally, consider the effect of the preferences of each site r for different amino acids, as denoted by the πr,a values. Selection due to these preferences is manifested in mutvirus. This selection acts on the mutations in the mutant library (µr,i ), although the actual counts in mutvirus are also affected by the sequencing / PCR errors (r,i ) and reverse-transcription errors (ρr,i ). Again ignore as negligibly rare the possibility that a site is subject to more than one of these sources of mutation and error within a single clone. Let A (i) denote the amino acid encoded → − − by codon i. Let → πr be the vector of πr,a values. Define the vector-valued function C as → − → C (− πr ) = πr,A(1) , . . . , πr,A(ncodon ) , (Equation 10) − so that this function returns a ncodon -element vector constructed from → πr . Because the selection in mutvirus due to the preferences πr,A(i) occurs after the mutagenesis µr,i but before the mutvirus = /N reverse-transcription errors ρr,i and the sequencing / PCR errors r,i , then E nmutvirus r −1 r,i −1 P → − − → r,i + ρr,i + γr × πr,A(i) × µr,i − 2 × δi,wt(r) where γr = πr,A(i) µr,i = C (→ πr ) · − µr i (where · denotes the dot product) is a normalization factor that accounts for the fact that changes in the frequency of one variant due to selection will influence the observed frequency of other −−−−→ − − − − given → µr , → r , → ρr , → πr , and Nrmutvirus is therefore variants. The likelihood of observing nmutvirus r ! → − → −−−−→ − → − − − − − → → − C ( π ) ◦ µ r r − − − − − − Pr nmutvirus |→ µr , → r , → ρr , → πr , Nrmutvirus = Mult nmutvirus ; Nrmutvirus , → r + → ρr + → − 2 δr . r r − → − C (− πr ) · → µr (Equation 11) where ◦ is the Hademard (entry-wise) product. − − − − Specify priors over → r , → ρr , → µr , and → πr in the form of Dirichlet distributions (denoted here by − Dir). For the priors over the mutation rates → µr , I choose Dirichlet-distribution parameters such that the mean of the prior expectation for the mutation rate at each site r and codon i is equal to the average value for all sites, estimated as the frequency in mutDNA minus the frequency in DNA (Figure 5), denoted by µ. So the prior is − − →) Pr (→ µr ) = Dir (→ µr ; ncodon · σµ · − α−µ,r 28 (Equation 12) bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. → is the n where − α−µ,r codon -element vector with elements αµ,r,i = µ + δi,wt(r) (1 − ncodon µ) and σµ is the scalar concentration parameter. For the priors over r,i and ρr,i , the Dirichlet-distribution parameters again represent the average value for all sites, but now also depend on the number of nucleotide changes in the codon mutation since sequencing / PCR and reverse-transcription errors are far more likely to lead to single-nucleotide codon changes than multiple-nucleotide codon changes (Figure 5). Let M (wt (r) , i) be the number of nucleotide changes in the mutation from codon wt (r) to codon i. For example, M (GCA, ACA) = 1 and M (GCA, ATA) = 2. Let 1 , 2 , and 3 be the average error rates for one-, two-, and three-nucleotide codon mutations, respectively – these are estimated as the frequencies in DNA. So the prior is − − Pr (→ r ) = Dir (→ r ; ncodon · σ · − α→ ,r ) (Equation 13) where − α→ ,r is the ncodon -element vector with elements α,r,i = M(wt(r),i) where 0 = 1 − 9 × 1 − 27 × 2 − 27 × 3 , and where σ is the scalar concentration parameter. Similarly, let ρ1 , ρ2 , and ρ3 be the average reverse-transcription error rates for one-, two-, and three-nucleotide codon mutations, respectively – these are estimated as the frequencies in RNA minus those in DNA. So the prior is − − Pr (→ ρr ) = Dir (→ ρr ; ncodon · σρ · − α−→ ρ,r ) (Equation 14) where − α−→ ρ,r is the ncodon -element vector with elements αρ,r,i = ρM(wt(r),i) where ρ0 = 1 − 9 × ρ1 − 27 × ρ2 − 27 × ρ3 , and where σρ is the scalar concentration parameter. − Specify a symmetric Dirichlet-distribution prior over → πr (note that any other prior, such as one that favored wildtype, would implicitly favor certain identities based empirically on the wildtype sequence, and so would not be in the spirit of the parameter-free derivation of the πr,a values employed here). Specifically, use a prior of → − − − π r ; σπ · 1 Pr (→ πr ) = Dir → (Equation 15) → − where 1 is the naa -element vector that is all ones, and σπ is the scalar concentration parameter. It isnnow possible to writ expressions for the likelihoods and posterior probabilities. Let −− → −− −−→ −− → −− −−→ DNA mutDNA RNA mutvirus o DNA mutDNA RNA mutvirus Nr = nr , nr , nr , nr , Nr , Nr , Nr , Nr denote the full set of counts for site r. The likelihood of Nr given values for the preferences and mutation / error 29 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. rates is −−→ −−→ − → − − − − − − RNA → RNA DNA → , , ρ × | N , × Pr n | N Pr (Nr | → πr , → r , → ρr , → µr ) = Pr nDNA r r r r r r r −−−−→ − − Pr nmutDNA | NrmutDNA , → r , → µr × r −−−−→ − → − → − → − mutvirus → mutvirus , r , ρr , µr , πr (Equation 16) | Nr Pr nr where the likelihoods that compose Equation 16 are defined by Equations Equation 7, Equation 8, Equation 9, and Equation 11. The posterior probability of a specific value for the preferences and mutation / error rates is − − − − − − − − Pr (→ πr , → r , → ρr , → µr | Nr ) = Cr × Pr (Nr | → πr , → r , → ρr , → µr ) × (Equation 17) − − − − Pr (→ ) × Pr (→ ρ ) × Pr (→ µ ) × Pr (→ π )(Equation 18) r r r r where Cr is a normalization constant that does not need to be explicitly calculated in the MCMC − approach used here. The posterior over the preferences → πr can be calculated by integrating over Equation 17 to give − Pr (→ πr | Nr ) = Z Z Z − − − − − − − Pr (→ πr , → r , → ρr , → µr | Nr ) d→ r d→ ρr d→ µr , (Equation 19) where the integration is performed by MCMC. The posterior is summarized by its mean, − h→ πr i = Z − → − − πr × Pr → πr | Nrk | 1 ≤ k ≤ R d→ πr . (Equation 20) In practice, each replicate consists of four libraries (WT-1, WT-2, N334H-1, and N334H-2) – the posterior mean preferences inferred for each library within a replicate are averaged to give the estimated preferences for that replicate. The preferences within each replicate are highly correlated regardless of whether mutvirus-p1 or mutvirus-p2 is used as the mutvirus data set (Figure 7A,B). This correlation between passages is consistent with the interpretation of the preferences as the fraction of genetic backgrounds that tolerate a mutation (if it was a selection coefficient, there should be further enrichment upon further passage). The preferences averaged over both replicates serve as the “best” estimate, and are displayed in Figure 7D. This figure was created using the WebLogo 3 program (Schneider and Stephens, 1990; Crooks et al., 2004). Figure 7D also shows relative solvent accessibility (RSA) and secondary structure for residues 30 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. present in chain C of NP crystal structure PDB 2IQH (Ye et al., 2006). The total accessible surface area (ASA) and the secondary structure for each residue in this monomer alone was calculated using DSSP (Kabsch and Sander, 1983; Joosten et al., 2011). The RSAs are the total ASA divided by the maximum ASA defined in (Tien et al., 2013). The secondary structure codes returned by DSSP were grouped into three classes: helix (DSSP codes G, H, or I), strand (DSSP codes B or E), and loop (any other DSSP code). A full description of the algorithm used to infer the preferences along with complete data can be accessed at http://jbloom.github.io/mapmuts/example_2013Analysis_ Influenza_NP_Aichi68.html. Phylogenetic analyses A detailed description of the phylogenetic analyses is available at http://jbloom.github. io/phyloExpCM/example_2013Analysis_Influenza_NP_Human_1918_Descended. html. The source code is at https://github.com/jbloom/phyloExpCM. A set of NP coding sequences was assembled for human influenza lineages descended from a close relative the 1918 virus (H1N1 from 1918 to 1957, H2N2 from 1957 to 1968, H3N2 from 1968 to 2013, and seasonal H1N1 from 1977 to 2008). All full-length NP sequences from the Influenza Virus Resource (Bao et al., 2008) were downloaded, and up to three unique sequences per year from each of the four lineages described above were retained. These sequences were aligned using EMBOSS needle (Rice et al., 2000). Outlier sequences that correspond to heavily lab-adapted strains, lab recombinants, mis-annotated sequences, or zoonotic transfers (for example, a small number of human H3N2 strains are from zoonotic swine variant H3N2 rather than the main human H3N2 lineage) were removed. This was done by first removing known outliers in the influenza databases (Krasnitz et al., 2008), and then using an analysis with RAxML (Stamatakis, 2006) and Path-O-Gen (http://tree.bio.ed.ac.uk/ software/pathogen/) to remove remaining sequences that were extreme outliers from the molecular clock. The final alignment after removing outliers consisted of 274 unique NP sequences. Maximum-likelihood phylogenetic trees were constructed using codonPhyML (Gil et al., 2013). Two substitution models were used. The first was GY94 (Goldman and Yang, 1994) using CF3x4 equilibrium frequencies (Pond et al., 2010), a single transition-transversion ratio optimized by maximum likelihood, and a synonymous-nonsynonymous ratio drawn from four 31 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. discrete gamma-distributed categories with mean and shape parameter optimized by maximum likelihood (Yang et al., 2000). The second was KOSI07 (Kosiol et al., 2007) using the F method for the equilibrium frequencies, optimizing the relative transversion-transition ratio by maximum likelihood, and letting the relative synonymous-nonsynonymous ratio again be drawn from four gamma-distributed categories with mean and shape parameter optimized by maximum likelihood. The trees produced by codonPhyML are unrooted. These trees were rooted using Path-O-Gen (http://tree.bio.ed.ac.uk/software/pathogen/), and visualized with FigTree (http://tree.bio.ed.ac.uk/software/figtree/) to create the images in Figure 9. The tree topologies are extremely similar for both models. The evolutionary models were compared by using them to optimize the branch lengths of the fixed tree topologies in Figure 9 so as to maximize the likelihood using HYPHY (Pond et al., 2005) for sites 2 to 498 (site 1 was not included, since the N-terminal methionine is conserved and was not mutated in the plasmid mutant libraries). The results are shown in Table 6 and Table 7. Regardless of which tree topology was used, the experimentally determined evolutionary models outperformed all variants of GY94 and KOSI07. The experimentally determined evolutionary models performed best when using the preferences determined from the combined data from both replicates and using Equation 3 to compute the fixation probabilities. Using the data from just one replicate also outperforms GY94 and KOSI07, although the likelihoods are slightly worse. In terms of the completeness with which mutations are sampled in the mutant viruses, replicate A is superior to replicate B as discussed above – and the former replicate gives higher likelihoods. If the fixation probabilities are instead determined using the method of Halpern and Bruno (Halpern and Bruno, 1998) as in Equation 4, the experimentally determined models still outperform GY94 and KOSI07 – but the likelihoods are substantially worse. To check that the experimentally determined models really do utilize the site-specific preferences information, the preferences were randomized among sites and likelihoods were computed. These randomized models perform vastly worse than any of the alternatives. The variants of GY94 and KOSI07 that were used for the HYPHY analyses are listed in the tables of likelihoods. The parameters were counted as follows: the simplest variants contained equilibrium frequency parameters that were empirically estimated from the sequences under analysis: there are 9 such parameters for GY94 using CF3x4 (Goldman and Yang, 1994; Pond et al., 2010) and 60 such parameters for KOSI07 using F (Kosiol et al., 2007). In addition, all variants of the models contain a transition-transversion ratio optimized by likelihood, and at least a single synonymous-nonsynonymous ratio optimized by likelihood. For more complex 32 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. variants, one or more of the following is also done: • The overall substitution rate is drawn from a gamma distribution with four discrete categories to add one shape parameter (Yang, 1994). • The nonsynonymous-synonymous ratio is drawn from a gamma distribution with four discrete categories to add one shape parameter (Yang et al., 2000). • A different nonsynonymous-synonymous ratio is estimated for each branch (Yang and Nielsen, 1998) to add 547 parameters. 33 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. References Araya CL, Fowler DM. 2011. Deep mutational scanning: assessing protein function on a massive scale. Trends in biotechnology. 29:435–442. Ashenberg O, Gong LI, Bloom JD. 2013. Mutational effects on stability are largely conserved during protein evolution. Proc. Natl. Acad. Sci. USA. 110:21071–21076. Bao Y, Bolotov P, Dernovoy D, Kiryutin B, Zaslavsky L, Tatusova T, Ostell J, Lipman D. 2008. The Influenza Virus Resource at the National Center for Biotechnology Information. J. Virol. 82:596–601. Bershtein S, Segal M, Bekerman R, Tokuriki N, Tawfik DS. 2006. Robustness-epistasis link shapes the fitness landscape of a randomly drifting protein. Nature. 444:929–932. Bloom JD, Gong LI, Baltimore D. 2010. Permissive secondary mutations enable the evolution of influenza oseltamivir resistance. Science. 328:1272–1275. Bloom JD, Labthavikul ST, Otey CR, Arnold FH. 2006. Protein stability promotes evolvability. Proc. Natl. Acad. Sci. USA. 103:5869–5874. Bloom JD, Raval A, Wilke CO. 2007. Thermodynamics of neutral protein evolution. Genetics. 175:255–266. Bloom JD, Silberg JJ, Wilke CO, Drummond DA, Adami C, Arnold FH. 2005. Thermodynamic prediction of protein neutrality. Proc. Natl. Acad. Sci. USA. 102:606–611. Cirino PC, Mayer KM, Umeno D. 2003. Directed evolution library creation: methods and protocols, Humana Press, chapter Generating mutant libraries using error-prone PCR, pp. 3–9. Crooks GE, Hon G, Chandonia JM, Brenner SE. 2004. Weblogo: a sequence logo generator. Genome research. 14:1188–1190. Felsenstein J. 1973. Maximum likelihood and minimum-step methods for estimating evolutionary trees from data on discrete characters. Systematic Zoology. 22:240–249. Felsenstein J. 1981. Evolutionary trees from DNA sequences: a maximum likelihood approach. J. Mol. Evol. 17:368–376. 34 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. Firnberg E, Ostermeier M. 2012. PFunkel: efficient, expansive, user-defined mutagenesis. PLoS One. 7:e52031. Fowler DM, Araya CL, Fleishman SJ, Kellogg EH, Stephany JJ, Baker D, Fields S. 2010. Highresolution mapping of protein sequence-function relationships. Nat. Methods. 7:741–746. Georgescu R, Bandara G, Sun L. 2003. Directed evolution library creation, Springer, chapter Saturation mutagenesis, pp. 75–83. Gil M, Zanetti MS, Zoller S, Anisimova M. 2013. Codonphyml: Fast maximum likelihood phylogeny estimation under codon substitution models. Mol. Biol. Evol. 30:1270–1280. Goldman N, Thorne JL, Jones DT. 1998. Assessing the impact of secondary structure and solvent accessibility on protein evolution. Genetics. 149:445–458. Goldman N, Yang Z. 1994. A codon-based model of nucleotide substitution probabilities for protein-coding DNA sequences. Mol. Biol. Evol. 11:725–736. Gong LI, Suchard MA, Bloom JD. 2013. Stability-mediated epistasis constrains the evolution of an influenza protein. eLife. 2:e00631. Goto H, Kawaoka Y. 1998. A novel mechanism for the acquisition of virulence by a human influenza a virus. Proc. Natl. Acad. Sci. USA. 95:10224–10228. Halligan DL, Keightley PD. 2009. Spontaneous mutation accumulation studies in evolutionary genetics. Annual Review of Ecology, Evolution, and Systematics. 40:151–172. Halpern AL, Bruno WJ. 1998. Evolutionary distances for protein-coding sequences: modeling site-specific residue frequencies. Mol. Biol. Evol. 15:910–917. Hiatt JB, Patwardhan RP, Turner EH, Lee C, Shendure J. 2010. Parallel, tag-directed assembly of locally derived short sequence reads. Nat. Methods. 7:119–122. Hoffmann E, Neumann G, Kawaoka Y, Hobom G, Webster RG. 2000. A DNA transfection system for generation of influenza A virus from eight plasmids. Proc. Natl. Acad. Sci. USA. 97:6108–6113. Hou Y, Zhang H, Miranda L, Lin S. 2010. Serious overestimation in quantitative pcr by circular (supercoiled) plasmid standard: microalgal pcna as the model gene. PLoS One. 5:e9545. 35 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. Huelsenbeck JP, Ronquist F, Nielsen R, Bollback JP. 2001. Bayesian inference of phylogeny and its impact on evolutionary biology. Science. 294:2310–2314. Jain PC, Varadarajan R. 2014. A rapid, efficient, and economical inverse polymerase chain reaction-based method for generating a site saturation mutant library. Analytical Biochemistry. 449:90–98. Joosten RP, te Beek TA, Krieger E, Hekkelman ML, Hooft RW, Schneider R, Sander C, Vriend G. 2011. A series of pdb related databases for everyday needs. Nucleic Acids Res. 39:D411– D419. Kabsch W, Sander C. 1983. Dictionary of protein secondary structure: pattern recognition of hydrogen-bonded and geometrical features. Biopolymers. 22:2577–2637. Kleinman CL, Rodrigue N, Lartillot N, Philippe H. 2010. Statistical potentials for improved structurally constrained evolutionary models. Mol. Biol. Evol. 27:1546–1560. Kosiol C, Holmes I, Goldman N. 2007. An empirical codon model for protein sequence evolution. Mol. Biol. Evol. 24:1464–1479. Krasnitz M, Levine AJ, Rabadan R. 2008. Anomalies in the influenza virus genome database: new biology or laboratory errors? J. Virology. 82:8947–8950. Lartillot N, Philippe H. 2004. A Bayesian mixture model for across-site heterogeneities in the amino-acid replacement process. Mol. Biol. Evol. 21:1095–1109. Le SQ, Lartillot N, Gascuel O. 2008. Phylogenetic mixture models for proteins. Phil. Trans. R. Soc. B. 363:3965–3976. Lou DI, Hussmann JA, McBee RM, Acevedo A, Andino R, Press WH, Sawyer SL. 2013. Highthroughput dna sequencing errors are reduced by orders of magnitude using circle sequencing. Proc. Natl. Acad. Sci. USA. 110:19872–19877. Marsh GA, Rabadán R, Levine AJ, Palese P. 2008. Highly conserved regions of influenza a virus polymerase gene segments are critical for efficient viral rna packaging. J. Virology. 82:2295–2304. Melamed D, Young DL, Gamble CE, Miller CR, Fields S. 2013. Deep mutational scanning of an rrm domain of the saccharomyces cerevisiae poly (a)-binding protein. RNA. 19:1537–1551. 36 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. Metropolis N, Rosenbluth AW, Rosenbluth MN, Teller AH, Teller E. 1953. Equation of state calculations by fast computing machines. Journal of Chemical Physics. 21:1087–1092. Neumann G, Watanabe T, Ito H, et al. (12 co-authors). 1999. Generation of influenza A viruses entirely from cloned cDNAs. Proc. Natl. Acad. Sci. USA. 96:9345–9350. Neylon C. 2004. Chemical and biochemical strategies for the randomization of protein encoding DNA sequences: library construction methods for directed evolution. Nucleic Acids Research. 32:1448–1459. Ogliore R, Huss G, Nagashima K. 2011. Ratio estimation in sims analysis. Nuclear Instruments and Methods in Physics Research Section B: Beam Interactions with Materials and Atoms. 269:1910–1918. Parvin J, Moscona A, Pan W, Leider J, Palese P. 1986. Measurement of the mutation rates of animal viruses: influenza a virus and poliovirus type 1. J. Virology. 59:377–383. Pearson K. 1910. On the constants of index-distributions as deduced from the like constants for the components of the ratio, with special reference to the opsonic index. Biometrika. 7:531–541. Pollock DD, Thiltgen G, Goldstein RA. 2012. Amino acid coevolution induces an evolutionary stokes shift. Proceedings of the National Academy of Sciences. 109:E1352–E1359. Pond SK, Delport W, Muse SV, Scheffler K. 2010. Correcting the bias of empirical frequency parameter estimators in codon models. PLoS One. 5:e11230. Pond SL, Frost SD, Muse SV. 2005. Hyphy: hypothesis testing using phylogenies. Bioinformatics. 21:676–679. Portela A, Digard P. 2002. The influenza virus nucleoprotein: a multifunctional rna-binding protein pivotal to virus replication. Journal of General Virology. 83:723–734. Posada D, Buckley TR. 2004. Model selection and model averaging in phylogenetics: advantages of akaike information criterion and bayesian approaches over likelihood ratio tests. Systematic Biology. 53:793–808. 37 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. Potapov V, Cohen M, Schreiber G. 2009. Assessing computational methods for predicting protein stability upon mutation: good on average but not in the details. Prot. Eng. Des. Sel. 22:553–560. Rice P, Longden I, Bleasby A. 2000. Emboss: the european molecular biology open software suite. Trends in Genetics. 16:276–277. Rodrigue N, Kleinman CL, Philippe H, Lartillot N. 2009. Computational methods for evaluating phylogenetic models of coding sequence evolution with dependence between codons. Mol. Biol. Evol. 26:1663–1676. Roscoe BP, Thayer KM, Zeldovich KB, Fushman D, Bolon DN. 2013. Analyses of the effects of all ubiquitin point mutants on yeast growth rate. J. Mol. Biol. . Schmitt MW, Kennedy SR, Salk JJ, Fox EJ, Hiatt JB, Loeb LA. 2012. Detection of ultra-rare mutations by next-generation sequencing. Proc. Natl. Acad. Sci. USA. 109:14508–14513. Schneider TD, Stephens RM. 1990. Sequence logos: a new way to display consensus sequences. Nucleic Acids Res. 18:6097–6100. Serrano L, Day AG, Fersht AR. 1993. Step-wise mutation of barnase to binase: a procedure for engineering increased stability of proteins and an experimental analysis of the evolution of protein stability. J. Mol. Biol. 233:305–312. Stamatakis A. 2006. Raxml-vi-hpc: maximum likelihood-based phylogenetic analyses with thousands of taxa and mixed models. Bioinformatics. 22:2688–2690. Starita LM, Pruneda JN, Lo RS, Fowler DM, Kim HJ, Hiatt JB, Shendure J, Brzovic PS, Fields S, Klevit RE. 2013. Activity-enhancing mutations in an e3 ubiquitin ligase identified by high-throughput mutagenesis. Proc. Natl. Acad. Sci. USA. 110:E1263–E1272. Thorne JL, Choi SC, Yu J, Higgs PG, Kishino H. 2007. Population genetics without intraspecific data. Mol. Biol. Evol. 24:1667–1677. Thorne JL, Goldman N, Jones DT. 1996. Combining protein evolution and secondary structure. Mol. Biol. Evol. 13:666–673. Tien M, Meyer AG, Spielman SJ, Wilke CO. 2013. Maximum allowed solvent accessibilites of residues in proteins. PLoS One. 8:e80635. 38 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. Traxlmayr MW, Hasenhindl C, Hackl M, Stadlmayr G, Rybka JD, Borth N, Grillari J, Rüker F, Obinger C. 2012. Construction of a stability landscape of the ch3 domain of human igg1 by combining directed evolution with high throughput sequencing. J. Mol. Biol. . Wang HC, Li K, Susko E, Roger AJ. 2008. A class frequency mixture model that adjusts for site-specific amino acid frequencies and improves inference of protein phylogeny. BMC evolutionary biology. 8:331. Wu CH, Suchard MA, Drummond AJ. 2013. Bayesian selection of nucleotide substitution models and their site assignments. Mol. Biol. Evol. 30:669–688. Yang Z. 1994. Maximum likelihood phylogenetic estimation from dna sequences with variable rates over sites: approximate methods. J. Mol. Evol. 39:306–314. Yang Z, Nielsen R. 1998. Synonymous and nonsynonymous rate variation in nuclear genes of mammals. J. Mol. Evol. 46:409–418. Yang Z, Nielsen R, Goldman N, Pedersen AMK. 2000. Codon-substitution models for heterogeneous selection pressure at amino acid sites. Genetics. 155:431–449. Ye Q, Krug RM, Tao YJ. 2006. The mechanism by which influenza a virus nucleoprotein forms oligomers and binds rna. Nature. 444:1078–1082. 39 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. Acknowledgments Thanks to D. Fowler, J. Kitzman, A. Adey, O. Ashenberg, and T. Bedford for helpful discussions. This work was supported by the National Institute of General Medical Sciences of the National Institutes of Health (grant number R01 GM102198). 40 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. clone Clone 1 Clone 2 Clone 3 Clone 4 Clone 5 Clone 6 Clone 7 Clone 8 Clone 9 Clone 10 Clone 11 Clone 12 Clone 13 Clone 14 Clone 15 Clone 16 Clone 17 Clone 18 Clone 19 Clone 20 Clone 21 Clone 22 Clone 23 Clone 24 mutations G62T (G21V), T693C (synonymous), del153-522 (indel) None C29T (T10I) None None G429A (synonymous), C447T (synonymous) None None C646A (R216S) G471T (K157N), G703A (D235N) T111C (synonymous), T718G (*240E) T25C (F9L), T26C (F9S) C45T (synonymous), C549T (synonymous) T319C (Y107H), C372T (synonymous), C539T (A180V) A488C (K163T) G274T (G92C) None None None G527A (S176N), A676G (T226A) G4A (V2I) T266C (M89T) None C30T (synonymous), del45-590 (indel) Table 1: Mutations identified by sequencing the 720 nucleotide GFP gene packaged in the PB1 segment after 25 limiting-dilution passages for 24 independent replicates. The numbering is sequential beginning with the first nucleotide of the GFP start codon. For nonsynonymous mutations, the induced amino-acid change is indicated in parentheses. 41 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. mutation type total substitutions transversions transitions nonsynonymous synonymous stop codons indels T→G T→C T→A G→T G→C G→A C→T C→G C→A A→T A→G A→C number of occurrences 24 6 18 15 8 1 2 1 6 0 3 0 4 7 0 1 0 1 1 Table 2: Counts for different types of mutations after the 25 limiting-dilution passages. The numbers are calculated from Table 1. Given that GFP is 720 nucleotides long, the data suggest a viral mutation rate of 5.6 × 10−5 mutations per nucleotide per tissue-culture generation. 42 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. mutation type A→G, T→C (transition) G→A, C→T (transition) A→C, T→G (transversion) C→A, G→T (transversion) A→T, T→A (transversion) G→C, C→G (transversion) rate 2.4 × 10−5 2.3 × 10−5 9.0 × 10−6 9.4 × 10−6 3.0 × 10−6 1.9 × 10−6 Table 3: Influenza mutation rates. Numbers represent the probability a site that has the parent identity will mutate to the specified nucleotide in a single tissue-culture generation, and are calculated from Table 1 and Table 2 after adding one pseudocount to each mutation type. Mutations are in pairs because an observed change of A→G can derive either from this mutation on the sequenced strand or a T→C on the complementary strand, and so the paired mutations are indistinguishable assuming that the same mutational process applies to both strands of the replicated nucleic acid molecule. The numbers are the estimated rates of each individual mutation, so for example the observed rate of change from A→G is 2 × (2.4 × 10−5 ) since this change can arise from either of the two mutations A→G and T→C. 43 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. residue 150 frequencies in natural sequences R (0.83), K (0.17) R (1.00) 152 156 174 175 195 199 R (1.00) R (1.00) R (1.00) R (1.00) R (1.00) R (1.00) 213 214 R (1.00) R (0.72), K (0.28) 221 236 R (1.00) R (0.94), K (0.06) R (1.00) K (0.56), Q (0.44) R (1.00) R (1.00) Y (1.00) 65 355 357 361 391 148 experimentally measured amino-acid preferences R (0.40), K (0.10), N (0.06) expected equilibrium evolutionary frequencies from experiments R (0.58), S (0.07) R (0.46), K (0.06), P (0.05), L (0.05) R (0.52), K (0.07), Q (0.07) R (0.52), Q (0.06) R (0.58), N (0.06), T (0.05) R (0.46), K (0.16) R (0.51) R (0.44), M (0.08), Y (0.06), V (0.05) R (0.51), N (0.06) K (0.24), H (0.09), R (0.09), Q (0.08), M (0.06), N (0.06), A (0.06), I (0.06) R (0.46), E (0.07), K (0.07) K (0.32), R (0.30) R (0.63), L (0.07) R (0.29), L (0.13), K (0.09) K (0.38), E (0.09), N (0.07), Y (0.05) R (0.53), V (0.13) R (0.59), K (0.09) Y (0.54), I (0.06) R (0.43), L (0.19) K (0.31), R (0.09), E (0.08), N (0.06) R (0.68), V (0.11) R (0.77) Y (0.44), I (0.07), T (0.07), P (0.06), S (0.06) R (0.71) R (0.69), S (0.06) R (0.75) R (0.66), K (0.08), S (0.05) R (0.69) R (0.64), V (0.05) R (0.69) R (0.19), K (0.17), A (0.09), H (0.07), I (0.06), L (0.06), Q (0.06) R (0.66), L (0.05) R (0.51), K (0.18) Table 4: For residues involved in NP’s RNA-binding groove, the preferences and expected evolutionary equilibrium frequencies from the experiments correlate well with the amino-acid frequencies in naturally occurring sequences. Shown are the 17 residues in the NP RNA-binding groove in (Ye et al., 2006). The second column gives the frequencies of amino acids in all 21,108 full-length NP sequences from influenza A (excluding bat lineages) in the Influenza Virus Resource as of January-31-2014. The third column gives the experimentally measured amino-acid preferences (Figure 7D). The fourth column gives the expected evolutionary equilibrium frequency of the amino acids (Figure 8). Only residues with frequencies or preferences ≥ 0.05 are listed. In all cases, the most abundant amino acid in the natural sequences has the highest expected evolutionary equilibrium frequency. In 15 of 17 cases, the most abundant amino acid in the natural sequences has the highest experimentally measured preference – in the other two cases, the most abundant amino acid in the natural sequences is among those with the highest preference. 44 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. residue stability measurement 259 L259S is destabilizing (∆Tm = −3.9◦ C) V280A is destabilizing (∆Tm = −3.5◦ C) N334H is stabilizing (∆Tm = 4.5◦ C) R384G is destabilizing (∆Tm = −4.8◦ C) 280 334 384 frequencies experimentally in natural measured sequences amino-acid preferences L (0.98), S L (0.23), S (0.04) (0.02) expected equilibrium evolutionary frequencies from experiments L (0.36), S (0.06) V (0.89), A (0.10) V (0.19), A (0.02) V (0.25), A (0.03) H (0.93), N (0.07) H (0.28), N (0.12) H (0.23), N (0.10) R (0.80), G (0.17) R (0.22), G (0.04) R (0.39), G (0.04) Table 5: For residues where mutations have previously been characterized as having large effects on the stability of the A/Aichi/2/1968 NP, the more stable amino acid has a higher preference and is also more frequent in actual NP sequences. The second column gives the experimentally measured change in melting temperature (∆Tm ) induced by the mutation to the A/Aichi/2/1968 NP as measured in (Gong et al., 2013); these mutational effects on stability are largely conserved in other NPs (Ashenberg et al., 2013). The third column gives the frequencies of the amino acids in all 21,108 full-length NP sequences from influenza A (excluding bat lineages) in the Influenza Virus Resource as of January-31-2014. The fourth column gives the experimentally measured amino-acid preferences (Figure 7D). The fifth column gives the expected evolutionary equilibrium frequency of the amino acids (Figure 8). 45 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. model experimental, combined replicates experimental, replicate A experimental, replicate B Halpern & Bruno, combined replicates Halpern & Bruno, replicate A Halpern & Bruno, replicate B GY94, branch-specific ω, multiple rates GY94, multiple ω, multiple rates KOSI07, branch-specific ω, multiple rates GY94, multiple ω, one rate KOSI07, multiple ω, multiple rates GY94, one ω, multiple rates KOSI07, multiple ω, one rate KOSI07, one ω, multiple rates GY94, one ω, one rate KOSI07, one ω, one rate randomized experimental, combined replicates randomized experimental, replicate A randomized experimental, replicate B randomized Halpern & Bruno, combined replicates randomized Halpern & Bruno, replicate B randomized Halpern & Bruno, replicate A log likelihood -12338.9 -12372.8 -12392.0 -12517.9 -12535.4 -12566.7 -12769.1 -12853.9 -12891.7 -12935.9 -12999.9 -13069.8 -13154.8 -13191.5 -13205.0 -13404.0 -14209.4 -14243.7 -14259.1 -14533.3 -14618.5 -14649.9 parameters (optimized + empirical) 0 (0 + 0) 0 (0 + 0) 0 (0 + 0) 0 (0 + 0) 0 (0 + 0) 0 (0 + 0) 556 (547 + 9) 13 (4 + 9) 607 (547 + 60) 12 (3 + 9) 64 (4 + 60) 12 (3 + 9) 63 (3 + 60) 63 (3 + 60) 11 (2 + 9) 62 (2 + 60) 0 (0 + 0) 0 (0 + 0) 0 (0 + 0) 0 (0 + 0) 0 (0 + 0) 0 (0 + 0) AIC 24677.8 24745.7 24783.9 25035.7 25070.8 25133.3 26650.1 25733.8 26997.3 25895.8 26127.7 26163.5 26435.5 26508.9 26431.9 26932.0 28418.8 28487.4 28518.2 29066.5 29236.9 29299.9 Table 6: Likelihoods computed using various evolutionary models after optimizing the branch lengths for the tree in Figure 9 inferred using the GY94 model. Experimentally determined models vastly outperform GY94 or KOSI07 despite having no free parameters. The experimentally determined models give the best fit if the amino-acid preferences are interpreted as the fraction of genetic backgrounds that tolerate a mutation (Equation 3) rather than as selection coefficients using the method of Halpern and Bruno (1998) (Equation 4). Randomizing the experimentally determined amino-acid preferences among sites makes the models far worse. All variants of GY94 and KOSI07 contain empirical equilibrium frequencies plus a transition-transversion ratio and synonymous-nonsynonymous ratio (ω) optimized by likelihood. Some variants allow multiple (four discrete gamma categories) rates or ω values, or a different ω for each branch. 46 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. model experimental, combined replicates experimental, replicate A experimental, replicate B Halpern & Bruno, combined replicates Halpern & Bruno, replicate A Halpern & Bruno, replicate B GY94, branch-specific ω, multiple rates GY94, multiple ω, multiple rates KOSI07, branch-specific ω, multiple rates GY94, multiple ω, one rate KOSI07, multiple ω, multiple rates GY94, one ω, multiple rates KOSI07, multiple ω, one rate KOSI07, one ω, multiple rates GY94, one ω, one rate KOSI07, one ω, one rate randomized experimental, combined replicates randomized experimental, replicate A randomized experimental, replicate B randomized Halpern & Bruno, combined replicates randomized Halpern & Bruno, replicate B randomized Halpern & Bruno, replicate A log likelihood -12334.6 -12368.5 -12387.7 -12513.0 -12530.3 -12562.0 -12769.0 -12850.8 -12889.6 -12932.4 -12995.2 -13069.1 -13148.2 -13188.7 -13204.7 -13401.0 -14205.2 -14239.3 -14255.3 -14528.4 -14613.6 -14645.0 parameters (optimized + empirical) 0 (0 + 0) 0 (0 + 0) 0 (0 + 0) 0 (0 + 0) 0 (0 + 0) 0 (0 + 0) 556 (547 + 9) 13 (4 + 9) 607 (547 + 60) 12 (3 + 9) 64 (4 + 60) 12 (3 + 9) 63 (3 + 60) 63 (3 + 60) 11 (2 + 9) 62 (2 + 60) 0 (0 + 0) 0 (0 + 0) 0 (0 + 0) 0 (0 + 0) 0 (0 + 0) 0 (0 + 0) AIC 24669.2 24737.1 24775.4 25026.0 25060.7 25124.0 26650.0 25727.5 26993.3 25888.8 26118.4 26162.3 26422.5 26503.5 26431.4 26926.0 28410.5 28478.7 28510.6 29056.8 29227.1 29290.0 Table 7: Likelihoods for the various evolutionary models for the tree topology inferred with codonPhyML using KOSI07. This table differs from Table 6 in that it optimizes the likelihoods on the tree topology inferred with KOSI07 rather than GY94. 47 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. actual 8 6 4 2 0 0 2 codon composition cumulative fraction 0.4 4 6 number of mutated codons C E Poisson parent codons 8 D mutant codons 0.3 0.2 0.1 0.0 1.0 0.8 A T C G nucleotide actual 1.0 0.8 number of mutations B cumulative fraction number of clones A 32 24 16 8 0 1 2 3 number of nucleotide changes in codon mutation actual cumulative distribution uniform distribution 0.6 0.4 0.2 0.0 100 200 300 codon number 400 expected 0.6 0.4 0.2 0.0 0 100 200 300 400 distance between pairs of mutations Figure 1: The codon-mutant libraries as assessed by Sanger sequencing 30 individual clones. (A) The clones have an average of 2.7 codon mutations and 0.1 indels per full-length NP coding sequence, with the number of mutated codons per gene following an approximately a Poisson distribution. (B) The number of nucleotide changes per codon mutation is roughly as expected if each codon is randomly mutated to any of the other 63 codons, with a slight elevation in singlenucleotide mutations. (C) The mutant codons have a uniform base composition. (D) Mutations occur uniformly along the primary sequence. (E) In clones with multiple mutations, there is no tendency for mutations to cluster. Shown is the actual distribution of pairwise distances between mutations in all multiply mutated clones compared to the distribution generated by 1,000 simulations where mutations are placed randomly along the primary sequence of each multiple-mutant clone. The data and code for this figure are available at https://github. com/jbloom/SangerMutantLibraryAnalysis/tree/v0.1. 48 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. , virus-p1 virus-p2 RNA on pti , > i r 6 6 c CR g RT, PCR, RT, PCR, ns tra T, Pncin sequencing sequencing Rue seq unmutated virus passage virus passage - rescued virus plasmid 1 2 viral rescue viral viral codon (transcrippassage passage mutagenesis tion, viral (viral (viral ? replication) replication) replication) mutant mutant plasmid rescued viruses viruses mutant mutant passage 1 passage 2 library viruses DNA 6 PCR, sequencing PCR, sequencing RT, PCR, sequencing ? mutvirus-p1 ? mutDNA RT, PCR, sequencing ? mutvirus-p2 Figure 2: Design of the deep mutational scanning experiment. The sequenced samples are in yellow. Blue text indicates sources of mutation and selection; red text indicates sources of errors. The comparison of interest is between the mutation frequencies in the mutDNA and mutvirus samples, since changes in frequencies between these samples represent the action of selection. However, since some of the experimental techniques have the potential to introduce errors, the other samples are also sequenced to quantify these unintended sources of error. Each of the two experimental replicates (replicate A and replicate B) involved independently repeating the entire viral rescue, viral passaging, and sequencing process for each of the four plasmid mutant libraries (WT-1, WT-2, N334H-1, and N334H-2). 49 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. A sequencing read 1 adaptor 1 NP fragment adaptor 2 sequencing read 2 B - fraction of reads 0.060 0.045 0.030 0.015 0.000 30 35 40 45 50 55 insert length 60 65 Figure 3: Illumina sequencing accuracy was increased by using overlapping paired-end reads. (A) The strategy is to shear the NP fragments to about 50 nucleotides in length, and then sequence with overlapping paired-end reads. This provides double coverage, and only codon identities for which both reads agree are called. (B) The actual length distribution of alignable paired reads that had at least 30 nucleotides of overlap (lengths between 30 and 70 nucleotides) for a typical sample. 50 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. A ×107 aligned outside gene unaligned unpaired excess N low Q filtered number of read pairs 2.5 2.0 1.5 1.0 0.5 B WT-1 DNA WT-1 RNA WT-1 mutDNA WT-1 virus-p1 WT-1 mutvirus-p1 WT-1 virus-p2 WT-1 mutvirus-p2 WT-2 DNA WT-2 RNA WT-2 mutDNA WT-2 virus-p1 WT-2 mutvirus-p1 WT-2 virus-p2 WT-2 mutvirus-p2 N334H-1 DNA N334H-1 RNA N334H-1 mutDNA N334H-1 virus-p1 N334H-1 mutvirus-p1 N334H-1 virus-p2 N334H-1 mutvirus-p2 N334H-2 DNA N334H-2 RNA N334H-2 mutDNA N334H-2 virus-p1 N334H-2 mutvirus-p1 N334H-2 virus-p2 N334H-2 mutvirus-p2 0.0 aligned outside gene unaligned unpaired excess N low Q filtered 2.0 1.5 1.0 0.5 0.0 C WT-1 DNA WT-1 RNA WT-1 mutDNA WT-1 virus-p1 WT-1 mutvirus-p1 WT-1 virus-p2 WT-1 mutvirus-p2 WT-2 DNA WT-2 RNA WT-2 mutDNA WT-2 virus-p1 WT-2 mutvirus-p1 WT-2 virus-p2 WT-2 mutvirus-p2 N334H-1 DNA N334H-1 RNA N334H-1 mutDNA N334H-1 virus-p1 N334H-1 mutvirus-p1 N334H-1 virus-p2 N334H-1 mutvirus-p2 N334H-2 DNA N334H-2 RNA N334H-2 mutDNA N334H-2 virus-p1 N334H-2 mutvirus-p1 N334H-2 virus-p2 N334H-2 mutvirus-p2 number of read pairs ×107 number of reads 8 ×105 paired reads single read ambiguous 6 4 2 0 100 200 300 codon number 400 Figure 4: The number of alignable paired reads for each sample from (A) replicate A and (B) replicate B. Most read pairs passed the various filters, could be overlapped, and could have their overlap aligned to NP. (C) The read depth across the primary sequence for a typical sample. The read depth was not entirely uniform along the primary sequence, probably due to biases in fragmentation locations. The computer code used to generate these figures is available at http://jbloom.github.io/mapmuts/example_2013Analysis_ Influenza_NP_Aichi68.html. 51 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. A 8 ×10−3 synonymous 1 nucleotide mutation nonsynonymous 2 nucleotide mutations stop codon 3 nucleotide mutations fraction 6 4 B ×10−3 synonymous 1 nucleotide mutation nonsynonymous 2 nucleotide mutations Sanger 0 WT-1 DNA WT-2 DNA N334H-1 DNA N334H-2 DNA WT-1 RNA WT-2 RNA N334H-1 RNA N334H-2 RNA WT-1 mutDNA WT-2 mutDNA N334H-1 mutDNA N334H-2 mutDNA WT-1 virus-p1 WT-2 virus-p1 N334H-1 virus-p1 N334H-2 virus-p1 WT-1 mutvirus-p1 WT-2 mutvirus-p1 N334H-1 mutvirus-p1 N334H-2 mutvirus-p1 WT-1 virus-p2 WT-2 virus-p2 N334H-1 virus-p2 N334H-2 virus-p2 WT-1 mutvirus-p2 WT-2 mutvirus-p2 N334H-1 mutvirus-p2 N334H-2 mutvirus-p2 2 stop codon 3 nucleotide mutations fraction 6 4 Sanger 0 WT-1 DNA WT-2 DNA N334H-1 DNA N334H-2 DNA WT-1 RNA WT-2 RNA N334H-1 RNA N334H-2 RNA WT-1 mutDNA WT-2 mutDNA N334H-1 mutDNA N334H-2 mutDNA WT-1 virus-p1 WT-2 virus-p1 N334H-1 virus-p1 N334H-2 virus-p1 WT-1 mutvirus-p1 WT-2 mutvirus-p1 N334H-1 mutvirus-p1 N334H-2 mutvirus-p1 WT-1 virus-p2 WT-2 virus-p2 N334H-1 virus-p2 N334H-2 virus-p2 WT-1 mutvirus-p2 WT-2 mutvirus-p2 N334H-1 mutvirus-p2 N334H-2 mutvirus-p2 2 Figure 5: Per-codon mutation frequencies for each of the four libraries (WT-1, WT-2, N334H-1, N334H-2) in (A) replicate A or (B) replicate B. The seven samples for each library are named as in Figure 2. Errors due to Illumina sequencing (DNA sample), reversetranscription (RNA sample), and viral replication (virus-p1 and virus-p2 samples) are rare, and are mostly single-nucleotide changes. The codon-mutant libraries (mutDNA) contain a high frequency of single- and multi-nucleotide changes as expected from Sanger sequencing (rightmost bars of this plot and Figure 1; note that Sanger sequencing is not subject to Illumina sequencing errors that affect all other samples in this plot). Mutations are reduced in mutvirus samples relative to mutDNA plasmids used to create these mutant viruses, with most of the reduction in stop-codon and nonsynonymous mutations – as expected if deleterious mutations are purged by purifying selection. Details of the analysis used to generate these figures are available at http://jbloom.github.io/mapmuts/example_2013Analysis_ Influenza_NP_Aichi68.html. 52 Frac. ≥ this many counts bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. all 1.0 Multi-nucleotide codon mutations synonymous DNA RNA mutDNA mutvirus-p1 mutvirus-p2 virus-p1 virus-p2 0.5 Frac. ≥ this many counts 0.0 0 15 30 Mutation counts all 1.0 45 0 15 30 Mutation counts 45 Multi-nucleotide codon mutations synonymous DNA RNA mutDNA mutvirus-p1 mutvirus-p2 virus-p1 virus-p2 0.5 0.0 0 15 30 Mutation counts 45 0 15 30 Mutation counts 45 Figure 6: The completeness with which all possible mutations were sampled in the mutant plasmids and viruses, as assessed by the number of counts for each multi-nucleotide codon mutation in the combined four libraries of (A) replicate A or (B) replicate B. Restricting these plots to codon mutations that involve multiple nucleotide changes avoids confounding effects from sequencing errors, which typically generate single-nucleotide codon mutations. Very few multinucleotide codon mutations are observed more than once in the unmutagenized controls (DNA, RNA, virus-p1, virus-p2). Nearly all multi-nucleotide codon mutations are observed many times in the mutant plasmid libraries (mutDNA). A key question is how many of these plasmid mutations were actually incorporated into mutant viruses during creation of these viruses from plasmids. About half the multi-nucleotide codon mutations are found at least five times in the mutant viruses (mutvirus-p1, mutvirus-p2), indicating that at least half the possible mutations were incorporated into a virus. However, this is only a lower bound, since deleterious mutations will be absent from the mutant viruses due to purifying selection. If the analysis is restricted to synonymous multi-nucleotide codon mutations (which are less likely to be deleterious), then over 75% of the possible mutations were incorporated into a virus. This is still only a lower bound, since even synonymous mutations are sometimes strongly deleterious to influenza (Marsh et al., 2008). The completeness with which amino-acid mutations are sampled is higher than for codon mutations, since most amino acids are encoded by multiple codons. Note that replicate A is technically superior to replicate B in terms of the completeness with which the mutations are sampled by the mutant viruses. Details of the analysis used to generate these figures are available at http://jbloom.github.io/mapmuts/example_ 2013Analysis_Influenza_NP_Aichi68.html. 53 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. B 0.5 0.0 0.0 R = 0.98 P < 10−10 0.5 0.0 0.0 0.5 1.0 replicate A p1 D C 1.0 R = 0.99 P < 10−10 2 0 1.0 R = 0.79 P < 10−10 0.5 0.0 0.0 0.5 1.0 replicate B p1 amino-acid hydrophobicity 4 replicate B p1 1.0 replicate B p2 replicate A p2 A 0.5 1.0 replicate A p1 relative solvent accessibility (RSA) -2 -4 0 0.5 secondary structure (SS) 1 strand helix loop SS RSA A TKR Y SA K R S W KK Q ET T S PSR M PF R C Q HD T I DEMQ CS H LV L P Q T W G Q QN I C W M Q L QM G I VH M C K T A A F M DT V W E F K Y FCE S F Q W V SG M CY I A T DM N TRP V F Q L N L K H T T Y TC K I G S L K V V Y Y C V W R Y A W G D I L W I C Q P S L F S L K T Q D A K K W I E L H P H D Y V W Y R C V L C C F KN H H D R H W FV E E E F S D E H N W AD E F Q M Q C RH L AH T W Y W W Y H YK V P W A I D S W F EW CS F K M F E S Y V N SG QK G G F S F R G I I W G L T E L N C C WK R V N RF D N V CM I Q M Q T K M M S S F D E Y V R Y M G R H Y Y I H C P E G G W Y F M I PTD V YF R M WR P MC F PW RK C G S L AH M A K R L Q M F P L D G W Q M W N AD Q L W E I P W W G L R N H T E R T I I E K R C WET VS Y Y M D S W P P M S L K I Q T A G Q C YA V T P V KL PS W E MQ I H N M T D L W S E G A VH G P K F ETC VM N D W W V Y H S I IQNS N E EG N Q W V Y H L C K G A VG F H E F Y K V I N C M H Q M L I W L L W L P R Q R Q T Y N F S SQ K C A G V W I M H A R R QMITELK GIGR Y T P C P WP K FG R E H DQH M WH SE P H FH T N EDEP SQR I F CK R LC C A GN T I QD LM C F V I AEHM Q Y SCC EPTD DSDEG Q Y AF NG VL I R T A SQ NT RP I A T I M E M F TN H A V GTPD V M A VLGP N MQP RN F P M SM FT F AC N D I RR Q PS S E WL LRR VRNV G M V CT I Y YD W M I R AC I S QC H T A V AMK R A C I N H W E S C H SVGKMI M S V L ANT C W I RL NL E V A T A T FSLF G V QFGT AD S G KQ R MD LNSPP A Y Q G A A TK T NGG TLSLI NK GSQNIQENLISM C AH KH R T APD Y YHL C VH YDND SQ LL W AH TE NR V MV TM N K AG R A AF AC MKH V SC GD I A RR P T YD CT Q R N H LN TDN M NA I F CY F I F E L V AK K T W Q FM A Y RP FC N S W I I QC N W TR W SY YN F H P T CHG A G C T H N QR EQI M AH GPD H KLE AK VN D I M QL ML A WC WE V T NV S V CL NI V N IW M RQ E METDGE LFG YS YN R FL SS A M VH D Q F D V Y A C N F E H V 5 10 15 20 25 30 I 35 40 45 50 55 60 SS RSA RMVLSGSAFYDLRRK WRFYLEE QA I Q T N F CMH KG G Q AS NM K KTGGPIY R D Q N NP CT A N D R C A N F NPG H V VD T TDM RW QI IN K QH I C A CR DR IN F MF A TFQ A SGL HN VDN MKL TECH I SE S W CT C TP K Y SR M Y P I N Y QC I NA ES I EKN S N D P L REL L KEEIV RIWR VANNL A TD K M C M L R C WV F TL KH VPF YN VIF NFL DPI H I W K R GLKN K N VI W A VFQ QD Q E R L Q Q C S GFGV K M LV AT YLIGSL I Q C W K D Q A Y CFC N Y Y CD D L Q STPL G SES H H LQN HY F K LE G WK C YEHY M N QMN P NY SFSMF R ES T DK TE I DTCLGQEK A R AM V WD NS C MH KER W Y M R W MR G LD Y W R CS MH KK A C F FR TN A SCFFK SV I PN M NA GT Y A V VK V A Q Q WL V MGS W V MGM I I LDKDS HQF V K RS I CT SFHCMT TK TG HHHQ Q T TN V T S M R I C G FT Y VC P K D VD VE M EN K TDSC C P Y Y V GC QF ESH P SV A QG VK C HY S A Y SG LV Q AHA M W W ANCG WF C G Q V Y V HC F C M R E L S N C P L EQ R I W V F L M F R I E SQ R AH Y WDTM D H PV P M T V TM A WL AN N Q F N G T H N SS NV Q W W D LK S GQ S F I A E S C C F HYRN S W QM H W N L D H T Q TM I L T CQ G CW E Q L AL EA E L F H V CG HY G RP A M E H RH KP H K I N P W QR VK G I H L S M GS PQ A VE Y R D M L E V QM VN M VP C P Y FA I I G K S L TCG YL A HT T KG K YMW GT N H I C TD W I E HAF A VR I AF M H W MT I W AEG C G A I MW M E S I E A S P A T F L T PS W RR F MW A F H H E KH F C TN L AD D T QH I E N T P I W T N R Q W Y Q H G C Q E R Q E V C L Y S L MY V S L G G H M W F C K MY K V W D T YR H M H L V RR E H W C M I C D E I G Y F V C M F W L E N T R W L L T W G Q H N A W I M KQ T A D I H GS LV A T D H N C K Y D Q D H E A F N PT C Q F K K D Q M R E G M K R W K P F A P P P P V AK G D D D E G H C R E E S W M E F Y V A W P D E W I F H L T I Y M S W K A R Y E A I A A P S G K N D Q N K C T G W T Y T S N I C Q E V N V E I A T M W P F L H Y P Q Y L G Y G E T G H W N C Q G K S N E H Y R L D N N R P P D V Y R Q R L R C P P S H W F M I D T K E H I I S H P S S E G F A P K K L S Q Q F Y D N W S K I N Y G S C T T E R P P V K 65 70 75 80 85 P D V 90 95 Q G 100 P R 105 110 115 V 120 P 125 SS RSA YQRTRAILVRIGMDPARIASLMQGSTLPRRSGAAG AVKG LNDT GITHI MM WHSNI ST HATP G F V A NKK AIL I LE SM HS Q C C HSD V V FQFSCMH A C AI S TM S L K N DR GM K G Y Q I PKK T Q S I T I W Y TC S F F I MHNPF L K V S GM T WESQ S P FPT ST N HC L TV T V MQM VH L QP I M K E Q DC W W K WE HQ I GE I N H HV M Y W V VLR Y A M AN LL C G PTK VN I Y G V QH HT S A SLMDKD A DV TD C LM A F LQ CDK A TK GG VM N CA L N R E V K I F E G A Q M K CA A AE V LS A MGP K T VN T H F G A MC AQ S I A Q M M FN N A KG Y TK V Q I QH P GTLMV A IAS V G EHS AC QT G I D EMEFG Y THA S N A PQ SD I ST S WD M FD M HG AP H YG I VCW GV NT V Y A HME I W VS W Q VE T I I W G A SSCR HC ECTE R I N R LC T H QL WN PHCRN R G W I Q S C CE I S W P I L F M S V P Y L P MY Q V Q G VE WD DMM V YD C N H N D M EC H P QR D QCW F H E Q CQFSSQH S K A T N Q N G QDC VN M V SQ N H H V R A Q E E R I C D K C I DV G F VD DTN KK D G T P EY V W M C C W T A WEC F L N F YF K VK YF L EV G M F K Y M L KC C R S Q K C F L Y RN F Y T QN M L N DQH K W F R G MQ G QM AH Y QKK W YE L G L TK QD E K E CQ Y C H LS C F WE P L V Q C L R VH A AE I L FV I L N LQ Y I N F Q T HAP P Y Q P R N CS C M K Y R N E KFT L PQK D I L C A I N V YR I M W W F E R Q G Y V GT Q S F E M H W L P W MW C N K G N G PCS C G F A S CT MG TS W N K P E P V R E T I E G Q S S H E W G Y T HA T W R S G P YH C Y C F N K Q W D I L P T H G L H L P C M G C F M W WN F R F G K T L G R Y D D H 135 I T W H R H L K T S P T G W Y P V F R F F E R A 150 L E A N P D E I Q I M G M N P S M D M 145 P R V D N C Y E H 140 Y V C I P Y E T N T C M K E V C D KM P KH T I T I L W F L Y S F N K A G T YE P C Q R W P R H R D D Y G W F I D E P V 130 Y V L A W V K R K Y C H I N L D I Y K V M T E A S VH R D H R V P S G N K S Q Q K D V Q Y N Q Y Y P H E E Y Q L E M W M M N L P S A L P F E P L A T I F A N W R S I N K P N I W T Y Y P S R H Y L D Y A D P R R M Q P C RM E A F M S F V F R A D Q F WNV A K L A D I T CT R V Q C E L 155 160 165 170 175 180 185 190 SS RSA IN RNFW GELMGRKTRTSAYEDR MELIRMI TKR GL D R S QV L YM H T MT I DE AS QY Q C S H V R SKI Q A T Q I C V N KGKFLQ NIL AKL Q GNAEI M CP QK AM TD AC VREGRN A VD A SC P R LA MK P S H A Q T KR H HN A T Q VS TQ GL E M H S G Q SL N YD VFN TT ET V VN RY F PT NLNKNMK TMFLQK S HGFN G I I N HQ V EM K AA Y L T I I M F C A C TM Y AHY MC W N A Y D H Q CS FC H I I I Q H V Q M CV R A M I L T K F E S W Y I YL KS SW W Y T LG Q QG LQ I SH QLFH M L FCG AE MV Y N T QC V LF AH E W H VM GEDD V A VG F W WM A W T W MA V LKF SD DY M EP A M CD HVNV QFG SCCF KE DMC S H Q D PW GS SKE I S G WP GF C H I CT QH ML MSCQ Q S W E CE T WN DW F P GT T E D K I M F P I A FM D LMM C AK I E W H T A NW PT CS A W Q H N D I Y I DM V Q Y VE KN EGTR G D MT N Q E D S AM K LM ER SG V P WF N F KK F K A D NA C I N E L R A A Y TP H L V W VM S L WNYD F W W YL HG I MQP W R A F T T V A SQ V H T V AR Q LQ E M P CG W FS M VD AN Y AC Y V C I F KM L Q K V WR L N Y MV DY CY E R TG HVL N V W G N E AH W T K A C NWL H HV I L I L S V VE CA E A K A TC Q A Y K W Q C I H Y E F V N I NL V QM WK K C T G H K V G D C F R Y Q F K C YP S S E V I G F Y H L WP I P V G W R H C S D G P WE W I E S F I S T T I L G P I G H P A I T R Q E 195 200 205 210 D V P C T AP V 215 W G G C Q K E K S V K Y W R W R W L L G T V K D K G K L A G S K LSQ N T R T M T L F R H E C H D Y A N V W F S R F I M E G S H R F K D E N V P H F L M S P C N D R C R Q D F G L N R 220 L P I ET Q N Y E C D S P R T Q L N M R W C P R N G M V W F Y I RR Q E V T C W N N S K V Q E P E P P Q E I W F C D ANG Q F F F K S S Q M KRN R R S Q WE S C Y YP S E C Y QH H N YD F W M VK M E W AD H DT W F I D M Q G A P P V I N T N M G Q M YE L W I KD Q C D S P Y L I H K G C K K E C A R Q A H W H F N R R A N P A D P G W A I I G G L W G C T G R R I Y F A L T Y W NWH N EC E KC I Y G M G C H S M P D M N P E M V S K G S C D N E M E C Q C M WH C L M P Y G KFQ L YR E R E A W F P P S T P W Q Y S W Q I N Q K H S I L L K KD T N H D M Q N F F C A D WF A T S P V C V S S Q DT C N Y D R 225 Y F 230 235 240 245 250 SS RSA D FLARSTL E LL K K V AH SCLPACIVYG IL S V S L Q A AFMI GT N A I G A VV LVGI PFK V RGHDFLHQGY S GR MMI IK GA SV P QK A N YE K A YHWN I PS V Q AI S AD A SRLEGIE V ARI Y SLI L L HR N RP Q I AMM VRR CNK TMHG LD S AIQMQL TSNCQC IL N S Y Q CMF C GG M C Q K Q F W Y H QW NN TP A LE SQ Q R W FA C QD W S CG G GE WTA V CV M T A TF SM F W GD YP M CRN AS CCHM MT C A T W A CT HH T I I T VD SLC V CTF A VH SW E HSS I FH W SN TT RK NNV G N Q VCY Q LG WF P Y M I E CM K W Y S H FS FW P LCMSC W D I F VKN TR MY T G LFG I G L YN W H N FA S T QK S A N M I LH GF K CG E W H I FS LM Y SP M PN GY V EGGE M RE S I L LQ CGS Q QP C I G PC L N RQ T G C CC E QT D N I LQKL Y NV C R V W VN V VHCH AF CG Y S W G RFD G RF WK N L GA Q I S YM N L Q K N K Q M S E D T C I M I V Q N C KQ K GS NM MK T Q GNW VK M Y V C V MDM V CTPT T I A D M C R E G P I W T Y Q I N K T D C CTM C P SW V N H H W T Q P E SS C N F W A AR A AM MK T A T WF M M I F F A A Y Q H P T K S H L M R F R P P L Y Q F Q WN A I E Q I KH Q V L A V D L C R G P H E D G H K N F S T F N G I K N M S L L D T P W Y E P R 255 260 265 270 A C K E D G R E T W R L K R F M D T H V K I A V I W Q WN F E R V F P E G P R Q F V Y M NY R P M L D C R V I Q C P C H W YH V Y V Y V Y W V I Y M C Q N L G V A K V WP W L W I P C V Y Y R S Y R WH I L Q H F K N D F W T T KE K E K F E V I Q Q E RE K Y P D F Y Q F H P AH K E KG DS A RF C N N Q I R Q Y MW HYL P G L Q H P YE H AM D V F A VK M F W R P S I D V KH G T WN N E D S A E P L H A N V W WD F V M E L E T E R P C S P T KP G A E A T K S F S T F K D D E E M R V D N R YH Y K P W Y K W K R N K N QM D G PM G PC I D D AD A MTRR C TDT A CG DT S AN A HW K Q DT H V E L I I I N E P E R F K E M V I VE G M A H T F C N E KD A C M F H F G L R V K Q L P M H R G H G S Q S A N I R L N Y M ES M E M L E S S QD Y N N EHL W MG Q G S F F V D R K TH P N D Y N D L W C P D Q H W Q E W F Y Q C W L I S F I PT N R F V H H M I AHY I R L R A V G V H F ET M H P L T Q H 275 I 280 P 285 A E T 290 T 295 L 300 305 310 315 SS RSA R E P HKSQLVWMACHSLA EDLRIVLS IRG KV PRGKL TRG IA PT SN N K V H C G H A V R F Q F L M MI N H TS R RL I I N Q V P A G M M V STG GLL FDN T LT C AC M A L C DISG SNAGR G VQ IF Q S NI NIESSTL G AL S SM GR DP T E MR H ME A CL I L N AN M N R R TFLMALKE V HF C T SCK CL T A VDL SN T D Q E H VY M T NK C R M C T KF A G P W W NC A I TQ EY G K PL R W Y S W CK Y P N E F E KE FQ DHC MMT C AL F TT V CK QY I S C LM E Q Q V G DT YP Y T SSS T YD V I QM VFHGKDD SKE T H P W MA V SA I W M QH NW MTRH EQ GW QC D A Q SQN FY V Q K AD C I R W N N A C VE W MG V CGC P CH F CT Y N M H S A VD SG HA QN W WQ PCKF S I H PS D NG VC CM TN N T W T VM I LQM S Y Q D I K CT PT G R LD TH D S A YFQ G F LLE L NVH I V VN VKDSS T P WF TP G I N Q VDQ Q CE H Q N FH EQ I H M FS A VDG W A H V S VM MQEM W W MT N GY N H H P S K M E HS P P F S WN K S F N P Q L KL TM CN FC V M V DA I M S Q W AE A Q T CG P C T A KRK E Y A V Y V I I F K KM VL I DA R HQ A H K N T S K PK LY I N I NV V N I W D I W S V D N N L D S AI G S L G C R F FLN V A N Q A M A G RE AN Q Y KE L R MQNY C R A QG K S R K V Y V P T T D F P Q V Y F L W P E G DT G GT YF K Y C I Y F YR F T W C A W YP N Y F M W QN H FGQ S W S Q MV C W K W YN Y G W V FT Y V C V C M A Y S M L H L CC N HW C C M S RG W M P A DT F H I I I F F R F E L L F S H HA L H R D F D P N M K V TG F P H H D S G H KK F T L A F F M WN I R D L N F I N E KL Y S P P SG K R V K C E R Y L FT G RC Y D Q G P F L P EW Q A P VH I D G I G K Y G V H Y P W I E A N D S V H K T WF W H PT R A Q C N I L V T Q R C W Y WM I I AR E C F A I T G A T C Y N V N Q S S T V P 330 335 340 C L 345 Q R H K G Y D K Y W R C K WE P Y A H I F M W R P Y D A I C 365 N V R H F 360 L G P Y Y M P 355 M H H S D R F N C WD R L W V 350 V N Q H K R A I K A M F I Y E H D Y K Q M R W L P Q F C D A W G 325 N ST C K P K 320 Q S M H Q W A D L E H Y I F K I Q R R P E C Q M M M H H L D VD D Q Y H M E D V A L K I G Y E W Y R I P P G L M V W G Y T P R C M E E Q G C M W Q G R H T G S Y E I E E D F R A A A Y Q H I P F L L H I T T D S G T L E L T M I G N P L I K 370 375 SS RSA IRTRSGG EQLTRSKRPY W A T Q M VG FY Y A K SKI S CA A M L T K C Y R F T R W L M V T H C FQ Q LV I A G GRT I RT G M A SS Y LE F H Q T M K C P SYLIS F Q Q AF GK GN A K NI IL CTQ NVD CC MGN ARK W GL LCP HK Y T V C VNH F R MP IS V S AT AF P AT T CT H TMS TN L VH VV K TR K W YF MN T N L Y SH RLICGT MPF AR T LT A V L L R CKK I I E N H V SV I T V W I S V N WHI D G M AHD D QS R D VE E D Q SP AFK S Q S I H Q G A C VN K H P A MCP C N I I Q I N T V N D N E P C V YH N I E W L A C C L Q VR I A G Q T F Y R Y F Y E RM E H N F Y V K V M T F D G W L G C D H E N L P HW I M R D W M C G H Y S Q Y W RM R P Q C D I W C R M I D YM W M G H S L Y QC P T I P P I F Q P G W L H K Y R T E P F Y N K P A W V I N D A W F R M E Y D R E M V K D G Q P I D P N Q E P S L Q H Y L V W N I V A M V I F G Y G S M WD F T M S H I H M H Y P T I S W P SL P CC T H V KF YLN D G F A V N L P L M N C M A G VC T Q QL S C AM E CR W N L W D M H P Q L D S R A A VC AGQISM A F MVSA K S T N E S K P L SM H H EY N QN E WN F Q Q QM VC NA VH P MT Q MQ A A M V I H I G GS I G N GSS T L MR N L W G W N CA C GV A W E Y YK T KPT H N MQL V M F S S N I K A AM QC T EQN K W Y L Y H N C D WL P E A I QK Y TR C Q Y L I DS CV R C P I T V Q L Y V YC W I Y Q S Q A G KM E I E L V R H E G A E N Q W I S K AR T C CG YH Y D F R R S C RD H M Q V E M Q M T W Y S W H W T N K AP P I Y F I T R P R HTS P E P KF W CQ A T VH Q D F FQ WH TR Q CCT W S S Y E K T TC G F TC W V Y C EQN K N F F N F D GV A A S EV M F R S A R H NT SM NT A RHF Q AN K AKK A T AL VH SMCS S CFC SL W HQ H QHHMHG W R N W KE E GW C N V N I QK N KH N I S G C AP Y H L G R KRR N A H NKKR A Q NMHS V WNCN G Y D KDH PDL D G K V MA C C K V T F E CL I SR T N H DW F E D V Q E P P Y I E F W T F F C V A 380 385 390 395 400 405 410 415 420 425 430 435 440 SS RSA EIID IMENTGKR M C Q I CQR M WY L W VKKH RGIVFE DERAA PIVPSI MSNV SYFFGDN E R SFR GG Y A VE GG YRNNATK CLR WLNWD EF Q CR PGL N T GNF QL Q Q Q CQ T A THQDN I I AG H Y GT A M ST V V VLPL D VLS P V Q E WS M W S AF MT H A SV M S M TM Y Y H H A W R V G V A A M M W V I Q T L D CS D F P E P I S Q N R C N T R C T K H C M Q F T M N R D T G Y K Y L C S Y Y K V F R F TG QM G H I D V E A C F H Q P P C V W Q D P A C D I W W Y L L K W A W H N M K FH N L L TQ M WL W C S F H N Q N L Q R S T G A D V V A F L E R C E A G D Y T W I Q I S G L H L N R S D Q F T H C R H E Q K D N E I F V V L F QM C M F WK F M S R C H G KN I I R C D S M G L C M M H M D W F S K K EY Y N A S V D TND NK K W GN ES YI GM L I NQK TR CR SA A T Y CK W THCH T VNM H S H G H V Y L NIK T A N D L VM Y I I I V L VP P K KM I AG R S MW Q R Y C M H R D MK MG E E H M D S N Q AP TN Q N T GC KD A I D I L M Q S HHF RG LA EK Y YG IWLH AT Y TMC T Y PT GT I R GQ S D W V H VD Q C H K R R V Y K A SV E RM VC NT A P E KY S S H T A N Y D S G QF C W MP EF A F RD IY P W Y FM G E W D L L W F N W Q D L T GPE E S H Q T E FT S M Q M S WP H C G R N QN NV V W V A Q L LFP I STR D P P R H L K T D E T S H MY F VD E C G E W F A D I G Y T PM V VP FG M L T AL I K S RR G NW S NA AK W C E H I C Q M YH K C MI CP F MI HR Y KE I K R TF HL K R LCP KSA N LQEE LW H N KL AFSDE QK S TA A SC REKH R D PS A CR QM WP L QLT R I H T FK KN G L AH SGG M H DG H Y G N I H Q F W C V Y L Y F 445 450 455 460 465 470 475 480 485 490 495 Figure 7: Amino-acid preferences. (A), (B) Preferences inferred from passage 1 and 2 are similar within each replicate, indicating that most selection occurs during initial viral creation and passage, and that technical variation is small. (C) Preferences from the two independent replicates are also correlated, but less perfectly. The increased variation is presumably due to stochasticity during the independent viral creation from plasmids for each replicate. (D) Preferences for all sites in NP (the N-terminal Met was not mutagenized) inferred from passage 1 of the combined replicates. Letters heights are proportional to the preference for that amino acid and are colored by hydrophobicity. Relative solvent accessibility and secondary structure are overlaid for residues in crystal structure. Correlation plots show Pearson’s R and P -value. Numerical data for (D) are in Supplementary file 1. The preferences are consistent with existing knowledge about mutations to NP (Table 4, Table 5). The computer code used to generate this figure is at http://jbloom.github.io/mapmuts/example_2013Analysis_ Influenza_NP_Aichi68.html. 54 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. amino-acid hydrophobicity 4 2 0 relative solvent accessibility (RSA) -2 -4 0 0.5 secondary structure (SS) 1 strand helix loop SS RSA A TKR F S YIR Y A FN VT AR N TP C HA HL CD I K N M S AR W LI G I T T Q T SP ST V C L D Q T S A T M P F V Y PT Y V V H T C ASSLT VNTGVTI S I K D R L NP RI P S Q M G D AD C V P T E D I G Y E I G D I C P W Y F K K G M Q F R D P C H E N C I F I C Y Y Q F H H W N H C Q V C C K Q E D D M H P N V F S YE I K M D N N N I A V R Q L L P QC N N C A G Q Y M F N Y I P V W N A Q A C I T N F H H D H ES F R YD E H F L I G I E W T D F C P T L V K F G I Y A E C N C I D C C P G G H P K Q G Q G R A L V SN SY T Q TP KS P HR TS QV PSF YR AP V GAD Y L S APSNA V F N N I P L L T F S F C G I F L P H D V G Y C L N KR H P N F V A Y V N A Q D SRR V R S V GN R REP Y CA C H I T M VK Q N F M C TL T F IK M S AR P C L WHL GG G T F D LT G V AH I TD R VP V G Y V I LDRRKN GTPH PFG T ALS I RR R VT GR Q T CNT D S AQ S A ALKRD VL AH AN I P RL H I A G A TD RF N QL RLL A T LH C SSG RK AN R CG CT I VK VL Y P KHND S V QDC P V Q I P G H H C H G AL R CM E KN M L A PQ QL F CP L I RS R NV K T EC TE C V GS PC H M FQ RM MQ P I Q T E C TP R G YN I HS VL V LS E EC F F I K V V G S V A T F I Q V I K T F F S Y Q K AT T A LE QN TP ALGL EGRL NL GSLS A ELT G SVGRSI GSIGSR ARYSQ I T T I G N W E P SQ S T I H P F PT W H Q T E AD R A SA S G R LL LSH S R QR V NAI NVLR A AIAK V G TV P M LG QE GE SR A KRR V SK VT E S A E CP VR L L A SH CQ S V SQR A V N A F N E TT MY TE NH Q R E T I L RC Q A C D G C Q LR I A GN Y L V W V V SIK T IR L N I M R SLAESKRDMETDGPGLV QS L G LL SS M F Y G H V Q P W M F F K F Y Q 5 10 15 20 25 30 35 40 45 50 55 60 SS RSA R VLSSA DLRR RYL F R Y T AR T S M G FA S N I CS G HG SR I V P A I K T G T A PTL A T LR G T N I S L YR L RTGGPI RADRVFLRELCV L DAQ PSS TSR S SS AH R V LLC A T I Y W GR GHSL G I RTV N KEL VI S GQH A K S C AS RP K M G AD V N YK F LDG W A N Y Q L P E G E T N N N RR T E DQ V TCSCG N F YP TC Y KCW C DC M EA E K W K L V I I I KN I I Q YK A G RM R R KH T Q FV CT Q L Q K L V CV G D C C H P N I Q N F Q E W N M H A ET K Q H C I Y R C Y Y L L V F S Y I Q V N R YG Q P Q Q E C V T P C M G Y R N H G H S A S V A T F D V P H E C M E C C E TM N Q H H F I E N N Y F D M Y G V HY C K H M W G H F W Y C P K M M Y P K H M D F I H A Y V N I C H K P TP N Q K I Q AD C I P R N P S I Q G Q F F R G A P Y A P H E D F F P H Q Q D S A Q H I F P W M F E Y D E E M 75 Q LRR TV C N K T PS V G P A K G L A P G Y C K D P P D 70 C G S LL N QI TA W 65 NLLL V N V L SSGA G RT SIG S W D NR RS G K E T E M M Q E H Q A I W D E K N SL FL M S F YR Q AD T G DA H Q C I N C N P Y N A Y G G K TG I D N E C H P D P LT K EIVRRI R A L I P I P L Q D V M Y Y H S KR A H W T I H F D S R A E P N F M T I H V G H M A Q E D Y V K C F H K K H Y T N AVS P LP S I T T SR GLSN A LA A G N F W P G F A VT P L RHAH T V V G G N V E G N M H P P N H C M T C C P P VL RS I QT L A GHA R LTL SEN LR SF S A Q SR Y L E L A Q C K WF T KK G M N S V VLKPPL SRI R G T SD NP R T VG V F P V GSPL AL W A A Q A V I T A V CK C F C V V EGQ H T LRF I L I T P G SV T I I NVR S I T TD H CQ FG L LCSLED FCL E C Y SV VG KN D NY T T R VP E TL S H TH T QE FA Q Y I GG RK E V TK GMGRR YC I VKHAH SV F V I R T A H GQ W R I I C F Q P R YD C E T K F HS N S I I PTE A NP NL R FTM T S VI K CN CL S R V A I V AD Y G SV LG VF DT CHAR D K AG T EQQ AR E NP T VF SR PN S L SF I QI VL SA PL 80 85 90 95 100 105 110 115 K K 120 125 SS RSA AA H I SNLNDSTTYQRTRAILVRSGLDARIASLL GSTLPRRSGAAGAAVKGVGTL M LH TPG HI LL W S AI S S V L I LT GV L R P TR R V I S S G GQ R T Q V L Y T P K KG N P Q AK R RN VD T P Q R C M Q V V E TRL I R G T P D Q Q C K M Y T P Y C Y P V N H E T D C P L A V V D K T K K Q E I YD R N V N E Y K C D H Q N F P K Y H Q C N P C Y M Y V M C I T R P N I YF I T AR Y C F CT I T TR M V P F C S Q P E E T Q Q P Y Q R P E H A G T R T L D I I E V K R H Y V M GCSC R F V A S R I G V P P P N Q H M K W Q D Q A S IS A R H S R D H E LR Q LE P TP L H Y G T E P Q Q H H E W Q G I LLG F RNA L N L D C H K I V N F F V D D F R A Y E G RF C E V G F T FT P N W L L E D Y Q K K C N H K HT S VH G I TC I Q C H WR Q Q I T A D F E M AP K I G L S V G P A Q V N A S R Q C SNG A L HAP D CM C L L F G R IS RP V TS I K RL D MCN T TKR G A T K G H C A L E K Y F E D R N F H R E Q T C L S S A A E S C PA TS G Q L P VN L A Q V T AEH S I R GS A L FV G EV V T S VL I SV V A MQL PC H I I T SGR STRL MH C PM L R YK LS RS G L G S I A Q L Q P R Q V P F M C C VI R Y C R D G T M N E A VR C N P T H T N P E G T GS D S E I G I E I S S G N T R R R A G LS H P L E A VD A TH C H P K Y QMQ YL A F A V QPGG E S YF D L P I C Q D T G E K C P C I G E Q F I N A V P A D N L VV MS P T A S AQ V T S R S Q L R A G RK V Q L H K V GG N P N G K I RC H A S E SM S IL I V I A L V A F K G R VC Y V Q S AG T I TE K GA L F I A AS T SLL I TR G RT T Q VH I FSK VPS MPP GGP R SM Y P VM GQ V CST L NK S F VLL I P A SL L AD AFC VT SK I FSH CSS V V PTHHL L VC N R P P G PA TS A D N V A Q N N Y Y I F E F C Y W K K C M A K Y G D C N M D H D D 130 135 W 140 145 150 155 160 165 170 175 180 185 190 SS RSA R IKRGIL DR F RG LGR TR A R LELSIV R M Y QL G RN TR I I SS M TS V A V A T SR GQ Y L VQ ST R I TN S K G H SDS YR G A V GMK N Q LQ L G LF RA TA P KS FH S SP V A TQ H NPH V TRL TL V H QKK ALH GR I LYG I P AES ST A AEM YR N SV F V GS N A L I EQ C N VR VF Q VRESGRSPAGNLAEI Q RR L VD Q L GT A S A SC SM SA T G I K A LKGKL LNL R S YE S V A AL T LD G C I L AL K S LST VS T AT V T S S E V SLL T A W N T N H S A L L AK L SS T T Q VL S I GA ST VL G A P DP C V M TI R LF LC G P S K S A L N R G GTR C AT Q P HSL VL T D S MGR I I C A S VS Y N L KP HQ SM Q A V VS F CE G A T T QL ST A A AS N YE L L R TK RP HA AD Q S A V SHG R A V V PY I I N F YG Y GC D NVH R T YRN S TQ HA Y T FR ST L VH T F I GSSH V VL A T R N C FG N P V P C S KF V VL D DA I N R N I P AG F P VPR N LQ C D S DG SQ C R G VRH R CN F R AR W V CT P L F P G KP E L I L TP I G I T M R G E G A C A VE AK P E G R Q I PS C RC I TRE D E R P A Y V V N Q P R I D T M T A V T GT S P G L T K T A F K L C A W Y L C Q N K Y Q Y Q E H P P N K N M G F E M P K D L N R I W V C KE E Y Q Y N Q P C C T I G I C T FY P G H Y Q N Q W D N R K E F P K Q C G K Y A C F E Q H H D E W P H Q F T Y K K C Y H F D H W E H V D H V G H L V Y P S G A G C M I K I G L V T T E F W D G N W W H T R C C R K G E V N E L F I D E M L V QR Q AL T M N C M Y R H C C A L H L P Q P C C Y D E V H I C N D W H Q H K I H I D Y H Y H T P Q V Q F E D K Q I W G K R P M C C V I H EQ F C F E A S Q I Y P K I N M H P H L N P R N Y Y P V F M V D T A C A P P G RE P N G V K F C I C N Y Q E V Q T E I S L W I D F FT K E D T G E D H A P Q G C I I Y I K F K M A P K D I M P E Q K S G R H N D M K D T H M I G R G N A P C C Y IV S M T R Q GT P H V F M M F P K VE I F D N C P K A P F I V P S L K MQE H Q Q N Q K M W 195 200 205 210 215 220 225 230 235 240 245 250 SS RSA DLLFLARSTALLLRSSVGAHKSCLPACIVYG R VARSRGHPD Q K V I L VV ASFP TR VS T K Q GYSLVGI P RLLLRARVYSLI F L RP F S VK N I R AL L S A S D Q I P H T R T T ITC IS A H Q SLS G V GA A A QC ST V R I V ST V G A Y A V F AL LV A Q Q L R G L I K Q M T R P F F R I S SG M VF M VP TCT V D Q CYC C H P M R LG L GT G A T QG L VG LN I E FC VRH SA CQ Q Y P L I I V TP LH R MC P DT Y I Y PR A A VE RH RN A TD Y Q G CQ SGC VNVE NV YE P Y MGC G I P P D L H G K P V T RRL TPSS A VC P V RR P W AD V C F PQR TE G CSM W S G I I G N N T AN QK C RP Q D A P L T YP F R QK G C I M A R E H V L M C H C S H I V C V W V AC P A KN H F F G I Y KP NV H E M P H H C W Q M Q C I E I E Q N F P D C F Y VN K Y K H I K P H C C S W D H C G E K A E K Q F D D F F V L N Q T K V E Y H M K Y T C N E D Q H L AI R T H R CGGT V Q Q TMC S V S L VS NNPCCM I L Q I K M A L RF N NA P KF F P H S Y Q A Q R V R VL KR W P GT E H N S G P P W I G Y H T N F M A D G R D Q N Q H E C I N F W N K P E C K E N Y Q I E K K W T W N N E K E G Q I M D K M E D M N I W H W I T L F R C P G D Y V N E P A W Q A H K R G N I A F P T I C F I V I M E G S R Y N T M V F D N L D C N H E Y E L D S M E F H F K Y L Q C C I T A L A Q I V A H Q A E I M C G TL T FQ C GGS T ST QNA G D A TP N SR SG AI RT T S GRP AKR PR A TPL EE IYI GP TS R T R ALK G Q LS RL I TMT TRRN CS Y TL GN E N PPR S TG R I N V HQPT I I L LL A VF G TK V GK T SG AK V I N S G QS A HQ GP RE GRN N LR I KS SY S GL L A ALG R S T A A QPHL SI VG IS EA VV S VL V SSK S W S II V L GT A S V LA GP A R LSS RL G TY V TCC I A T A L S SV A G E S FN D K C M D I M K M Q E T Y Y 255 260 265 270 275 280 285 290 295 300 305 310 315 SS RSA R RG IAS E LDSILSSTL V F ERPAHKSLQLVWLACSGHCSLAFQEDSLRGI SLIL GAKVPRPLRGKLRST LL PT V SR L K Q TRP S T RG N V MS LI TT V AD I S V V VI S A AG TA K S S V TR SR S GS G NN P I V V A I M L TGT V I HA LFG C LSRRR A VH A V R D SS NTR G G LNS T V G R GR A TPLSR R E RN S S LLF HFLS V A TG T S SS N H S S A S LL P I SS I V VTL VC QS TL LY L KS G S V SA A G TC R A A VLLPK T V TK G AK H PMRLR V GR Q T P P I MS A VR M TL CRP DQ Y I Y VT I P L A CHANC LT V A G P SC GV I ALR C A G KN T V LG L P KP PCTR K V AN I I I TR AL A I LK H TP I YG DSG PD P F E I FC L C A T V A C L PC Q R Q K D P E T ST I A V A VS F I N I QD YDQN F I I R Q C Q PC F V E R P L K V T R G F A G F W A Q A N C YM LP K Q N H N I P N V K Q P E N E Q H R CDGR SI V R S NMFPL L V T VR D L Y I I K TC M M D K C P I P G QD N I AF W Y I L N D K M Y G P C V C N H C M F G Q I Y K A G D C H H P A E H E M G E A K K C Q N R P W F I Q E C H YK P K I Y M P F VN R AK Q R G N F W Y Y Y W F M TG T A TQ NV AC N SG LGS A AK S R GERH V P P F VR V N RP V SM LT CQFST T G AL I S D Q I P F F M M A GG F P C T HV FG Q Y G D F H W C M I V V TNR G V T S R P F RR E RH E Q H K K F Q Y N F R N H W YT LLQ T N I I T H I T F K A ALE TSL AE N SAI S H C D D D Q F C Y P G H C G F I M H K L S L A A N E C N P Q Y P M S H E H C P V H C D R H I P P V E K A F G Y I RN CG E G N TG E C G N H C HYR M V I A N P Q Q W C T K V R K W I Y Q T F N G C R E N Q D V P Q T F W E S T E Y N H F Q Q T R D N N K TR I G D G K A E H Q T NV HY F T G S F L D D P Y A H I C N RP Y I G NV F P Y Q M T I I F M H C R V Q C A Q D H I C TV PP STR AF S D A G Y H A P V P Y K L T L G NHN Q LL P Y K M G M C 320 325 330 335 340 345 350 355 360 365 370 375 SS RSA R IRTRSGG R RRRR AGQISV PASLSVSR LP E L S RPW Q T T Y A A W D Q C R L H K VS NMT N LV LY S G N S Y AG C H C S L S D R T A S R E T I A A I TR L N K C H C RL AG H P PQ M G G VF QE H M L LH C A T AP C A I C R Y S P H I K QP F V L V Q V G Y Y G R I R R W I A Q YR C M I H P F CRL R C H Q Q D G M M KR A N G Q T SG I A R W I H P C I Q V T L N R K N Q T T N K D V M N E C G C Y Q R C Y N M Y Q N G S L RHV L S R V G F A C Q H P K Y F V I K H G N N K T Y L N H A C P E V R I E M I L I E E AA L D W L C V T D A S G M L D DHD T L A P D F A I TH A M N S E H N G QG Q Q I NV S C R L T H F G N Q T L N I D Y R IR SG STSG IE T Q VR AN AS V T VPP HCP R VS SN I S PK YL RP VP K I A LM R NQR G TN I R C P K P N V TC Q V K N I H A S C E G S Y Q N H P N T Q C V Q G G F E QP F NY C M Q H Q DQ G P L A G LN I V H A C C L Q E N A YS FP FR I S S IS T CG A V CRIT TKD S H W I NT K L A V M N R Q Y P C Y A I A TT FA T V GA LP S S A P E I K G S K F S N E E T Y S T A T N H K H M P H E N Y K V K W C S C W V L F D L P P T K E V G I Q W L T G Y K V H F C C T K Q G T K C VR F LP H G A F I C K P H H C L R LT S VH LL V VF AV TA M MQ S Y V K C Q T S VKH G T TLH NT N S VRLM V I Q S H P P T AF R GLL GT SL SA R VL SL VL R L AS S N E VD K L I T L L G Y C C F SSS V SAN ALK E T V N K F Y H R S A V CCGQ P D R PS N P A E R G C GV G P R N D L AK V I P NSR K V KT TST TT AS CLC ALF H A AR HR TC SKPK A L CV A RH G T S G PK A S A VK N I F R I K T GH V T KF K TM V L I A R R S G R Q SR V APDG F 380 385 390 395 400 405 410 415 420 425 430 435 440 SS RSA R F D R Y F I G S S RA P S VFE LSDE TARSP V SI S R NVR EIIDIIETRGKRRL RLSFYRGRG RGI LPG T R P A L L S G N L RLL L V T ASR T TG Q VLEFM LY VS T G PA S N RL V GGQ A S GL LST A S S V V S K FNC G T I Q V I R QC V RDCN Q SES DS PL DRR AHSSPH WE I MKR A V GQ V A AS P I QP T C TG M Y GT W D KN H M V PQR K E F C E P P PW Q YD Y HTR AP AH H L L A R G H C G FK T Q V C S P I S E H H G K T Q V Y V R NA L W V F F G G Q L C LL T A I GG T TH Y L R W K P Y Q K V YL A P S M A E Y NG A R P Q C R E C N V C A T G A Y T K G V K I P W C S I Q D KD L WN G A GV G F V Q M A P Q T L D K R H Y CQ N P N R I H S I P C M M T Q F E H M H Q C A H D G VD P K L A T N S R L N C D E H Y C N RT N Y D I W G T RF C D V S S Q T N F H V YS ES N FV R SA V N E RC T H N E H A T P G KR VL T Y GK ITF H I C A YL T S A G LLH K Y S S I I DL TN SRRLL M I VT LI ES LS Y GN KRD V D I I L K LS T P Y F AK S RFK GH Q RT E I P P L L H G E S GC Y M S G H E R F M TT A N E N W L Y L M A D E Y PQ R V SF V AP G QV A V Y AES T TPR N TET T F D N MH ET PS A C VK G I RLM A ST M I V Y TK S Q LCGT P D D F C N E K V R P S S N KLH T F VD VHW P P I I K P QKECC I AGA KC Q V M FR AL Q CD W L W AA L W QNQN LG A GNA T T K NAH E I VK K L FG N T K S H Y L IR F V H Y K 445 450 455 460 465 470 475 480 485 490 495 Figure 8: The expected frequencies of the amino acids at evolutionary equilibrium using the experimentally determined evolutionary model from passage 1 of the combined replicates and Equation 3 for the fixation probabilities. Note that these expected frequencies are slightly different than the amino-acid preferences in Figure 7D due to the structure of the genetic code. For instance, when arginine and lysine have equal preferences at a site, arginine will tend to have a higher evolutionary equilibrium frequency because it is encoded by more codons. The numerical data are in Supplementary file 2. The computer code used to generate this plot is at http://jbloom.github.io/phyloExpCM/example_2013Analysis_ Influenza_NP_Human_1918_Descended.html. 55 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. A A/Brevig Mission/1/1918 (H1N1) A/Albany/1/1958 (H2N2) A/Aichi/2/1968 (H3N2) A/Lyon/815/1993 (H3N2) B 0.1 0.1 Figure 9: Phylogenetic tree of NPs from human influenza descended from a close relative of the 1918 virus. Black - H1N1 from 1918 lineage; green - seasonal H1N1; red - H2N2; blue H3N2. Maximum-likelihood trees constructed using codonPhyML (Gil et al., 2013) with (A) the GY94 substitution model or (B) the KOSI07 substitution model. Up to three NP sequences per year from each subtype were used to build the tree. 56 bioRxiv preprint first posted online Feb. 20, 2014; doi: http://dx.doi.org/10.1101/002899. The copyright holder for this preprint (which was not peer-reviewed) is the author/funder. It is made available under a CC-BY 4.0 International license. Supplementary file 1: The file Preferences.xlsx is an Excel table of the inferred amino-acid preferences at each site from the combined passage 1 data for the two replicates. Supplementary file 2: The file EvolutionaryEquilibriumFreqs.xlsx is an Excel table of the expected equilibrium frequencies of the amino acids during evolution. 57
© Copyright 2026 Paperzz