Davidson et al., Supplemental Figure 1 A B SKN1 domain 1 121 150 181 Transmembrane helix (150-172) β-glucan synthesis associated SKN1 domain (121-179) C Sp Bm Ca Cg An Af Cn Sbg1p XP_007685256 XP_446183 KGU30817 CBF69971 EDP54700 XP_012049585 0.16 0.063 0.111 0.27 0.149 0.144 0.1485 121 159 160 180 165 163 76 KEVDDILHNEDFYDGRD---------LNIFTLRGFVNILTLILLSCGLLMLFIGYPILSAVEVEKQRKKN VEKDDYLHNPDPNDKDK-------RDCDVFTRRGIVNVGGLAILALGILMLFVGYPILTFVEKATAPERT KEDDDYLHNPDPEEEARLDRKRFSNDFKYMDKRSAGGLAGVLFLFIGLGCLFILLPALTY-TGVTEHAKP KEPDDYLHNPDPVQDAEYEKNRFMHDLKNMDKRSLGGLIGFIILFIAALAVFIILPALTY-SGATNPYHP VEKDDYLHNPDPSDREG-------E-CDVWNKRGMINVGGLVLLTIGFLVLFIGYPVVTAMKGFEKTQSG EEKDDYLHNPDPNDKEG-------Q-CDLWSRRGIMNVTGLVLLTLGFLALFIGYPVITAVKGM-RDKSG PEEDDWMHNPDPIKNHNYDRGTI------FTPRGLINVGCLVMLILCLVTLFAGYPIITHFTDTQIKTNG 181 247 280 332 226 250 162 gi|191123292 S. pombe Sbg1 β-glucan synthesis associated protein gi|891556976 S. octosporus β-glucan synthesis associated protein gi|891602747 S. cryophilus β-glucan synthesis associated protein gi|213410010 S. japonicus β-glucan synthesis associated protein gi|961817042 Candida galbrata β-glucan synthesis associated protein KRE6 gi|768881745 S. cerevisiae KRE6p gi|255726114 Candida tropicalis β-glucan synthesis associated protein SKN1 0.11 gi|723168469 Candida albicans β-glucan synthesis associated protein KRE6 0.154 gi|723181220 Candida albicans β-glucan synthesis associated protein SKN1 0.22 gi|58266800 Cryptocoocus neoformans β-glucan synthesis associated protein SKN1 0.26 gi|406695001 Trichosporon asahii var. asahii β-glucan synthesis associated protein SKN1 0.28 gi|406695001 Pnuemocystis carinii β-glucan synthesis associated protein SKN1 0.185 gi|627826051 Bipolaris oryzae β-glucan synthesis associated protein SKN1 0.197 gi|528296488 Blumeria graminis β-1,6-glucan synthetase 0.022 gi|952551258 Aspergillus lentulus β-glucan synthesis associated protein KRE6 0.021 gi|159129586 Aspergillus fumigatus β-1,6-glucan synthetase KRE6 0.07 gi|121715730 Aspergillus clavatus β-1,6-glucan synthetase KRE6 0.0007 0.0008 0.119 gi|914761099 Aspergillus flavus β-1,6-glucan synthetase KRE6 gi|169774877 Aspergillus oryzae β-glucan synthesis associated protein SKN1 gi|259479600 Aspergillus nidulans β-1,6-glucan synthetase KRE6 0.132 gi|816348981 Aspergillus rambellii β-1,6-glucan synthetase KRE6 0.114 gi|525581985 Penicilum oxalicum putative β-1,6-glucan active enzyme 0.047 gi|902274613 Penicilum camemberti putative β-glucan synthesis associated protein SKN1 0.05 gi|953383561 Penicilum digitatum putative β-1,6-glucan synthetase KRE6 0.107 gi|875280035 Coccidioides immitis β-glucan synthesis associated protein SKN1 0.073 gi|859411350 Coccidioides immitis β-glucan synthesis associated protein SKN1 0.22 gi|930439956 Phialophora attae β-glucan synthesis associated protein KRE6 S1 Fig. Sbg1 is a conserved protein involved in glucan synthesis. (A) Schematic of domain organization of Sbg1. (B) Sequence alignment of the SKN1 domain in S. pombe Sbg1 with β-glucan synthesis associated proteins from other fungi. SpS. pombe; Bm-Bipolaris maydis; Ca-Candida albicans; Cg-Candida galbrata; An-Aspergillus nidulans; Af-Aspergillus fumigatus; and Cn-Cryptococcus neoformans. Identical and similar (D/E, I/L/V, K/R, N/Q, and S/T) residues compared with Sbg1 are in red and blue, respectively. (C) Cladogram of SKN1 domains from different fungal species. A phylogenetic cladogram with branch length (indicated by the numbers) showing the relationship of the Sbg1 SKN1 domain with homologous β-glucan synthesis associated proteins from other fungal species. Fungal pathogens are in bold. NCBI’s BLAST and EMBL-EBI’s ClustalW2 were used to generate the cladogram.
© Copyright 2026 Paperzz