Anti-PSMD10 monoclonal antibody, clone 2C5 Cat.No: DCABH-13088 Lot. No. (See product label) PRODUCT INFORMATION Antigen Description The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 nonidentical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 nonATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitindependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. Two transcripts encoding different isoforms have been described. Pseudogenes have been identified on chromosomes 3 and 20. Immunogen PSMD10 (AAH11960, 127 a.a. ~ 226 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Isotype IgG1 Source/Host Mouse Species Reactivity Human Clone 2C5 Conjugate Unconjugated Applications Western Blot (Recombinant protein); Sandwich ELISA (Recombinant protein); ELISA Sequence Similarities EGGANPDAKDHYEATAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVSQ GASIYIENKEEKTPLQVAKGGLGLILKRMVEG Size 1 ea Buffer In 1x PBS, pH 7.4 Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Antigen Gene Information Gene Name PSMD10 proteasome (prosome, macropain) 26S subunit, non-ATPase, 10 [ Homo sapiens ] Official Symbol PSMD10 Synonyms PSMD10; proteasome (prosome, macropain) 26S subunit, non-ATPase, 10; 26S proteasome nonATPase regulatory subunit 10; gankyrin; p28; ankyrin repeat protein; 26S proteasome regulatory subunit p28; hepatocellular carcinoma-associated protein p28-II; p28(GANK); dJ889N15.2; Entrez Gene ID 5716 mRNA Refseq NM_002814 Protein Refseq NP_002805 MIM 603480 Creative Diagnostics. All rights reserved 45-1 Ramsey Road Shirley, NY 11967, USA Tel: 1-631-624-4882 Fax: 1-631-938-8221 E-mail: [email protected] www.creative-diagnostics.com 1 UniProt ID O75832 Chromosome Location Xq22.3 Pathway APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; Activation of NF-kapp Function protein binding; transcription factor binding; Creative Diagnostics. All rights reserved 45-1 Ramsey Road Shirley, NY 11967, USA Tel: 1-631-624-4882 Fax: 1-631-938-8221 E-mail: [email protected] www.creative-diagnostics.com 2
© Copyright 2026 Paperzz