title: short title: 00: Computational Biology 1 cb1_intro Computational Biology 1 - Protein structure (for Informatics) - TUM summer semester lecture: © Burkhard Rost 1 /115 Informatics et al. © Burkhard Rost 2 CONTACT: Lothar Richter [email protected] Announcements Videos: THANKS : YouTube / www.rostlab.org . Special lectures: Dmitrij Nechaev EXERCISES: • 07/xx Predrag Radivojac - Indiana Univ. • 06/xx Yana Bromberg - Rutgers Univ. No lecture: Lothar Richter Christian Dallago • • • • 05/15 Ascension day 05/23 Student assembly (SVV) 06/06 Whitsun holiday 06/15 Corpus Christi LAST lecture: Examen: bef: Jul 11 after: Jul 28 WEDNESDAY(!!) July 12: 18:00-19:30 TBA • Makeup: TBC: Oct 17 & 19, 2017 - lecture time © Burkhard Rost 3 /115 Protein Prediction - Part 1: Structure Computational Biology 1 © Burkhard Rost 4 Definitions Computational Biology biology replacing experiments by computers (include neurobiology, image processing) Bioinformatics anything that has to do with storing and using the information about bio-sequences http://www.rostlab.org/talks/ © Burkhard Rost 5 /115 Who are we? © Burkhard Rost 6 Burkhard Rost © Burkhard Rost 7 Some Professional Positions © Burkhard Rost 8 /115 Study complex systems © Burkhard Rost 9 /115 © Burkhard Rost 10 © Burkhard Rost 11 /115 Rostlab ISMB/ECCB 2010 Vienna ISMB/ECCB 2013 Berlin Garching TUM 2014 www.rostlab.org © Burkhard Rost 12 /115 www.rostlab.org Andrea Maria Schafferhans Schelling Inga Weise Juan Miguel Cecjuela Jonas Reeb Tatyana Goldberg Guy Yachdav Christian Dallago Dimitrij Nechaev Valérie Marot Jiajun Qiu Michael Heinzinger Caroline Gergen Yulia Oscar Gembar- Salvador zhevskaya Alexander Alexandru Galtesev Buff Michael Bernhofer Theresa Venkata P Martin Wirth Satagopam Steinegger Tim Karl Lothar Richter Maximilian Miller Yannick Mahlich Jade Martins Syeda Tanzeem H Charu © Burkhard Rost 13 /115 ROST= [email protected] © CNN - http://edition.cnn.com/2014/04/08/tech/innovation/universe-expansion-astronomers/ © Burkhard Rost 14 /115 Inga Weise [email protected] Inga Weise © Burkhard Rost 15 /115 Lothar Richter [email protected] Lothar Richter © Burkhard Rost 16 /115 TOC today Biology introduction • Organisms • Genes • Central dogma Protein introduction • some numbers/idea NEXT lectures • building blocks • domains • 3D comparisons © Burkhard Rost 17 /115 Nobel Prizes in Informatics? © Burkhard Rost 18 2013 Nobel Prize in Chemistry “for the development of multiscale models for complex chemical systems” (nobelprize.org) Martin Karplus Harvard Univ, USA & Univ Strasbourg, France Michael Levitt Stanford Univ, USA Arieh Warshel USC, Los Angeles, USA © Burkhard Rost 19 /115 Protein structure comparisons All-alpha All-beta 3sdh AlphaBeta 1bww 1xne © Burkhard Rost 20 /115 Predict protein function © Burkhard Rost 21 /115 Classical physics vs quantum physics Ⓒ NobelPrize.org http://www.nobelprize.org/nobel_prizes/chemistry/ laureates/2013/advanced-chemistryprize2013.pdf © Burkhard Rost 22 /115 2013 Nobel Prize in Chemistry Martin Karplus Michael Levitt Arieh Warshel Harvard Univ, USA & Univ Strasbourg, France Stanford Univ, USA USC, Los Angeles, USA Michael Levitt (AP): It’s sort of nice ... to see that computational science, computational biology is being recognized. ... It’s become a very large field and it’s always in some ways been the poor sister, or the ugly sister, to experimental biology. Arieh Warshel (NobelPrize) [experimental results are] like seeing a watch and wondering how actually it works. ... what we developed is a way which requires a computer to look ... and then to eventually understand how exactly [a protein] does what it does.23 /115 © Burkhard Rost Background © Burkhard Rost 24 Life is diverse David Pacchioli: Logic of Organisms Trilobite Bergeroniellus spinosus Lena River Gorge, Siberia http://www.emory.edu/COLLEGE/ENVS/ research/ichnology © Burkhard Rost 25 /115 How does life work? Leonardo Da Vinci (1452-1519) Vitruve Luc Viatour (~1492) © Burkhard Rost 26 /115 How does life work? Leonardo Da Vinci (1452-1519) Vitruve Luc Viatour (~1492) © Burkhard Rost 27 /115 Common 2 Life? David Pacchioli: Logic of Organisms Trilobite Bergeroniellus spinosus Lena River Gorge, Siberia http://www.emory.edu/COLLEGE/ENVS/ research/ichnology © Burkhard Rost 28 /115 Terms/facts DNA protein RNA © Burkhard Rost 29 /115 Central dogma of molecular biology DNA RNA information, code, library, manual Protein intermediate step machinery of life 4 nucleotides 4 nucleotides 20 amino acids GATC GAUC ACDEFGHIKLMNPRSTVWY transcription © Wikipedia translation © Burkhard Rost 30 /115 A gallery of proteins scale reduced 1ej9 Topoisomerase 1i6h RNA Polymerase 1ais TATA-binding Protein/ Transcription Factor IIB 1cgp Catabolite Gene Activator Protein 1tau DNA Polymerase 1lbh+1efa lac Repressor 1aoi Nucleosome 1aoi Nucleosome 1tub Microtubule 1b7t Myosin © David Goodsell © Burkhard Rost 1bkv Collagen 1atn Actin 31 /115 Images © Burkhard Rost 32 What is similar? © Burkhard Rost 33 /115 What is similar? © Wikipedia © http://www.lionsons.com © Burkhard Rost 34 /115 What is similar? silicone © Wikipedia glass © http://www.lionsons.com © Burkhard Rost 35 /115 What is this? Diamond Graphite/coal © Wikipedia © Burkhard Rost 36 /115 What is this? Diamond Graphite/coal carbon diamond lattice © Wikipedia © Burkhard Rost 37 /115 Periodic table © Wikipedia © Burkhard Rost 38 /115 Which molecule dominates our body weight? © Burkhard Rost 39 Which molecule makes most of our body? H2O - water how much? © Burkhard Rost 40 /115 What elements make most of our body? H2O - water about 50-65% in adults © Burkhard Rost 41 /115 What elements make most of our body? © Burkhard Rost 42 /115 Which ones make up life? oxygen - O carbon - C hydrogen - H 65.00 oxygen - O 18.60 carbon - C 9.70 hydrogen - H nitrogen - N nitrogen - N calcium - Ca calcium - Ca phosphorus - P potassium - K 3.20 1.80 1.00 phosphorus - P 0.40 potassium - K sodium - Na sodium - Na chlorine - Cl chlorine - Cl magnesium - Mg sulfur - S 0.20 0.20 0.10 magnesium - Mg 0.05 sulfur - S 0.03 iron - Fe iron - Fe iodine - I iodine - I body weight © Wikipedia 0.03 96.5 0 10 © Burkhard Rost 20 30 40 50 60 70 43 /115 Which ones make up life? oxygen - O carbon - C hydrogen - H 65.00 oxygen - O 18.60 carbon - C 9.70 hydrogen - H nitrogen - N nitrogen - N calcium - Ca calcium - Ca phosphorus - P potassium - K 3.20 1.80 1.00 phosphorus - P 0.40 potassium - K sodium - Na sodium - Na chlorine - Cl chlorine - Cl magnesium - Mg sulfur - S 0.20 0.20 0.10 magnesium - Mg 0.05 sulfur - S 0.03 iron - Fe iron - Fe iodine - I iodine - I body weight © Wikipedia 0.03 96.5 0 10 © Burkhard Rost 20 30 40 50 60 70 44 /115 Which ones make up life? oxygen - O carbon - C hydrogen - H 65.00 oxygen - O 18.60 carbon - C 9.70 hydrogen - H nitrogen - N nitrogen - N calcium - Ca calcium - Ca phosphorus - P potassium - K 3.20 1.80 1.00 phosphorus - P 0.40 potassium - K sodium - Na sodium - Na chlorine - Cl chlorine - Cl magnesium - Mg sulfur - S 0.20 0.20 0.10 magnesium - Mg 0.05 sulfur - S 0.03 iron - Fe iron - Fe iodine - I iodine - I body weight © Wikipedia 0.03 96.5 0 10 © Burkhard Rost 20 30 40 50 60 70 45 /115 What is this? © Wikipedia © Burkhard Rost 46 /115 What is this? © Wikipedia Escherichia coli © Wikipedia © Burkhard Rost 47 /115 What is this? © Burkhard Rost Luke Jerram - http://www.duskyswondersite.com 48 /115 What is this? Escherichia coli /E coli © Burkhard Rost Luke Jerram - http://www.duskyswondersite.com 49 /115 What is this? bigbackground.com © Burkhard Rost 50 /115 What is this? © Wikipedia © Burkhard Rost 51 /115 What is this? Salmonella bongori © Wikipedia © Burkhard Rost 52 /115 What is this? © Burkhard Rost Luke Jerram - http://www.duskyswondersite.com 53 /115 What is this? Avian or bird flu (virus) © Burkhard Rost Luke Jerram - http://www.duskyswondersite.com 54 /115 What is this? © Burkhard Rost Luke Jerram - http://www.duskyswondersite.com 55 /115 What is this? HIV virus © Burkhard Rost Luke Jerram - http://www.duskyswondersite.com 56 /115 What is this? © Burkhard Rost 57 /115 Velcro - invented by George de Mestral George de Mestral (1907-1990) velcro http://www.engr.sjsu.edu/WofMatE/ polymers.htm • swiss electrical engineer • invented velcro 1949 © Wikipedia © Burkhard Rost 58 /115 Velcro copied from plants http://www.engr.sjsu.edu/WofMatE/ polymers.htm George de Mestral (1907-1990) velcro • swiss electrical engineer • invented velcro 1949 burr (seed of fruit) © Wikipedia © Wikipedia © Burkhard Rost 59 /115 Bacteria differ in shape © Wikipedia © Burkhard Rost 60 /115 What do they have in common? © Wikipedia © Burkhard Rost 61 /115 Common to bacteria: single cells single cell © Wikipedia © Burkhard Rost 62 /115 Cells © Wikipedia © Burkhard Rost 63 /115 Do we carry bacteria? Leonardo Da Vinci (1452-1519) Vitruve Luc Viatour (~1492) © Burkhard Rost 64 /115 we carry bacteria when we are sick © Burkhard Rost 65 Our bodies are teeming with bacteria © NATURE REVIEWS MICROBIOLOGY 9:244-53, COPYRIGHT 2011 http://publications.nigms.nih.gov/findings/jan12/body-bacteria.asp © Burkhard Rost 66 /115 Common? David Pacchioli: Logic of Organisms Trilobite Bergeroniellus spinosus Lena River Gorge, Siberia http://www.emory.edu/COLLEGE/ENVS/ research/ichnology © Burkhard Rost 67 /115 DNA/Gene www.chemistryexplained.com © Wikipedia © Burkhard Rost 68 /115 Where do we have genes? © Burkhard Rost 69 /115 Genes in nucleus and mitochondria green: cell (actin) red: mitochondria blue: nucleus © Wikipedia © Burkhard Rost 70 /115 Genes in nucleus and mitochondria green: cell (actin) red: mitochondria blue: nucleus © Wikipedia © Burkhard Rost 71 /115 Central dogma of molecular biology DNA information, code, library, manual RNA intermediate step Protein machinery of life © Laszlo Kajan, TUM © Burkhard Rost 72 /115 Quiz 1. what is the smallest building block of life that can replicate? • protein - quarks - cells - organelles 2. different cells in typical human? • 20 - 200 - 400 - 1000 3. what are the parts of cells called? • cellular parts - organelles - organs - celluoplasts 4. which part of cells is called the “powerhouse”? • nucleus - Golgi apparatus - mitochondria - Endoplasmic reticulum 5. what part of a plant cell is involved with photosynthesis? • mitochondria - nucleus - smooth reticulum - chloroplast 6. what is mitosis? • cell death - cellular respiration - cell division - cellular communication 7. who first used the term cell? • Aristotle - Captain Hooke - Robert Hooke - James Watson 8. how many elements are found in amounts larger than trace amounts (0.01%) in our bodies? • 92 - 48 - 13 - 11 9. when communities of living things interact with non-living things they are called ...? • population - community - biosphere - ecosystem 10.the most common molecule in the human body is? © Ask a Biologist (askabiologist.asu.edu) © Burkhard Rost 73 /115 Q&A 1. what is the smallest building block of life that can replicate? • protein - quarks - cells - organelles 2. different cells in typical human? • 20 - 200 - 400 - 1000 3. what are the parts of cells called? • cellular parts - organelles - organs - celluoplasts 4. which part of cells is called the “powerhouse”? • nucleus - Golgi apparatus - mitochondria - Endoplasmic reticulum 5. what part of a plant cell is involved with photosynthesis? • mitochondria - nucleus - smooth reticulum - chloroplast 6. what is mitosis? • cell death - cellular respiration - cell division - cellular communication 7. who first used the term cell? • Aristotle - Captain Hooke - Robert Hooke - James Watson 8. how many elements are found in amounts larger than trace amounts (0.01%) in our bodies? • 92 - 48 - 13 - 11 9. when communities of living things interact with non-living things they are called ...? • population - community - biosphere - ecosystem 10.the most common molecule in the human body is? • H20 © Ask a Biologist (askabiologist.asu.edu) © Burkhard Rost 74 /115 Life: The Players © Burkhard Rost 75 What is life? © Burkhard Rost 76 Life is diverse David Pacchioli: Logic of Organisms Trilobite Bergeroniellus spinosus Lena River Gorge, Siberia http://www.emory.edu/COLLEGE/ENVS/ research/ichnology © Burkhard Rost 77 /115 Can you define life? © Burkhard Rost 78 Descriptive definition of life Homeostasis (regulation of internal environment to maintain constant state) Organization - unit: cells Metabolism (transfer of energy) Growth Adaptation Response to stimuli Reproduction © Burkhard Rost 79 /115 Descriptive definition of life Homeostasis (regulation of internal environment to maintain constant state) Organization - unit: cells Growth Adaptation Response to stimuli (transfer of energy) ru s lif es e? = Vi Metabolism Reproduction © Burkhard Rost 80 /115 Central dogma as information flow General Special Unkown DNA->DNA Replication RNA->DNA protein->DNA DNA->RNA Transcription RNA->RNA protein->RNA DNA->protein protein->protein RNA->protein Translation NarayaneseCentraldogmanodetails-Wikimedia slide: Edda Kloppmann © Burkhard Rost 81 /115 Central dogma of molecular biology © 2014 David Goodsell & RCSB Protein Data Bank [email protected] slide: Andrea Schafferhans © Burkhard Rost 82 /115 Codon wheel © yourgenome.org slide: Andrea Schafferhans © Burkhard Rost 83 /115 Translation in action slide: Andrea Schafferhans © Burkhard Rost 84 /115 DNA sequencing © yourgenome.org slide: Andrea Schafferhans © Burkhard Rost 85 /115 Illumina: MiSeq run: 6 hours full capacity: raw: ~5-10 TB data / day reduced: 50-200GB/day Illumina - Early 2012 © Burkhard Rost 86 /115 Illumina: HiSeq 2000 run: 1-8 days, 24 GB/day 1 human genome @ 30x / day full capacity: raw: 25 TB data / day reduced: 100-500 GB 120 x 76 x 94 cm BGI - Shenzhen Illumina - 2011 © Burkhard Rost 87 /115 Illumina HiSeq 2016 ~2TB/run (<3 days) © Burkhard Rost 88 /115 Entire Manual / Library 0.3 μm Wikipedia Haemophilus Influenzae (Pfeiffer’s bacillus) 40 authors RD Fleischmann, et al. & C Venter (1995) Science 269: 496-512 0.05 μm Mycoplasma Genitalium Venter Inst. 3 μm CM Fraser, et al. & C Venter (1995) Science 270: 397-403 Sacharomyces cerevisiae B Dujon (1996) Trends in Genetics 12: 263-70 A Goffeau, et al. (1996) Science 274: 546, 63-7 Wikipedia Caenorhabditis elegans, nematode - worm The C. elegans Sequencing Consortium (1998) Science 282: 2012-8 1mm Wikipedia Drosophila melanogaster fruit fly 195 authors MD Adams, et al. (2000) Science 287: 2185-95 © Burkhard Rost 5 mm Wikipedia 89 /115 Genome sizes Mycoplasma genitalium 470 Haemophilus influenzae 1740 Methanococcus jannaschi 1,738 Escherichia coli 4,288 Sacharomyces cerevisiae - yeast 6,600 Drosophila melanogaster - fruit fly 13,600 Caenorhabditis elegans - worm 19,000 Arabidopsis thaliana - mustard 26,735 Oryza sativa - rice 50,000 *100,000 Homo sapiens * Estimate from 1999 © Burkhard Rost 90 /115 Manual for human not Jan 1, 2000 © Burkhard Rost 91 /115 Manual for human not Jan 1, 2000 number of genes/ proteins: Oct 1999 (after >5 years): 100,000 © Burkhard Rost 92 /115 Manual for human not Jan 1, 2000 number of genes/ proteins: Oct 1999 (after >5 years): 100,000 Nov 1999: oops there are only 30,000 © Burkhard Rost 93 /115 Degree of novelty: biology vs. physics Speed of light 0 © Burkhard Rost 2015 1 1950 2 novelty in physics 1885 2015 1950 1885 0 1690 1 1820 2 1755 novelty in biology 3 Year Value [km/s] 1690 220,000 1862 298,000 1972 299,792 1820 3 Who Huygen sFoucaul tCGPM 4 1755 4 knowledge added Number 100,000 30,000 20,000 Year 1999 2003 2015 1690 Human proteins 94 /115 Genome sizes Mycoplasma genitalium 470 Haemophilus influenzae 1,740 Methanococcus jannaschi 1,738 Escherichia coli 4,288 Sacharomyces cerevisiae - yeast 6,600 13,600 Drosophila melanogaster - fruit fly Caenorhabditis elegans - worm *21,000 Arabidopsis thaliana - mustard *26,735 Oryza sativa - rice *50,000 Homo sapiens *25,000 * Estimates from 2010 © Burkhard Rost 95 /115 Now we know it all? Like for every good manual: you hardly ever find what you look for when you find it, it is difficult to understand! Anna Tramontano, La Sapienza Rome, Italy http://static.open.salon.com http://i42.tinypic.com © Burkhard Rost 96 /115 Central dogma Function Structure [email protected] slide: Andrea Schafferhans © Burkhard Rost 97 /115 Amino acid sequence determines protein 3D structure Christian Anfinsen Nobel Prize in Chemistry 1972 © Burkhard Rost 98 /115 Central dogma of molecular biology DNA information, code, library, manual RNA intermediate step Protein machinery of life © Burkhard Rost 99 /115 FANTOM 3: Functional annotation of mouse 143 authors Science 2005 309:1559-63 The Transcriptional Landscape of the Mammalian Genome Numbers: • Total transcripts: 181,047 • New protein-coding transcripts: 16,247 • New proteins: 5,154 • Multiple splice variants: 65% • 1.35 5’ start sites for each 3’ end • 1.83 3’ ends for each 5’ end © Burkhard Rost 100 /115 Central dogma of molecular biology DNA information, code, library, manual RNA intermediate step Protein machinery of life Still the central dogma, but we know that reality is more complicated © Burkhard Rost 101 /115 What are proteins? © Burkhard Rost 102 Protein functions • Defense (e.g. antibodies) • Structure (e.g. collagen) • Enzymes – metabolism, catabolism • Communication / Signaling (e.g. insulin) • Ligand binding / Transport (e.g. hemoglobin) • Storage (e.g. ferritin) slide: Andrea Schafferhans © Burkhard Rost 103 /115 Gallery of proteins 1 slide: Andrea Schafferhans © Burkhard Rost 104 /115 Gallery of proteins 2 slide: Andrea Schafferhans © Burkhard Rost 105 /115 Protein sequence >gi|16128674|ref|NP_415226.1| potassium translocating ATPase, subunit A [Escherichia coli K12] MAAQGFLLIATFLLVLMVLARPLGSGLARLINDIPLPGTTGVERVLFRALGVSDREMNWK QYLCAILGLNMLGLAVLFFMLLGQHYLPLNPQQLPGLSWDLALNTAVSFVTNTNWQSYSG ETTLSYFSQMAGLTVQNFLSAASGIAVIFALIRAFTRQSMSTLGNAWVDLLRITLWVLVP VALLIALFFIQQGALQNFLPYQAVNTVEGAQQLLPMGPVASQEAIKMLGTNGGGFFNANS SHPFENPTALTNFVQMLAIFLIPTALCFAFGEVMGDRRQGRMLLWAMSVIFVICVGVVMW AEVQGNPHLLALGTDSSINMEGKESRFGVLVSSLFAVVTTAASCGAVIAMHDSFTALGGM VPMWLMQIGEVVFGGVGSGLYGMMLFVLLAVFIAGLMIGRTPEYLGKKIDVREMKLTALA ILVTPTLVLMGAALAMMTDAGRSAMLNPGPHGFSEVLYAVSSAANNNGSAFAGLSANSPF WNCLLAFCMFVGRFGVIIPVMAIAGSLVSKKSQAASSGTLPTHGPLFVGLLIGTVLLVGA LTFIPALALGPVAEYLS © Burkhard Rost 106 /115 Some facts about proteins how many in human? • 20-25K in human how long are they? • ~35-30k, median around 400 do they consist of units? • most proteins have more than 2 domains how many proteins known? © Burkhard Rost 107 /115 Bio-sequence data explodes © Uniprot EBI Cambridgeshire © Burkhard Rost 108 /115 Protein WITH annotations grow less © Swiss-Prot Geneva/Lausanne © Burkhard Rost 109 /115 Raw protein sequence data vs. annotations Swiss-Prot © Uniprot EBI Cambridgeshire © Burkhard Rost 110 /115 PDB: Proteins with experimentally known 3D structure © PDB Rutgers Univ © Burkhard Rost 111 /115 PDB: known structure ~ 0.2% of sequences UniProt=all (0.2%) Swiss-Prot=Annotation (20%) © PDB Rutgers Univ PDB=3D © Burkhard Rost 112 /115 Proteins = gene products = machinery of life From the book: “DNA: The Secret of Life” by James Watson and Andrew Berry © Burkhard Rost 113 /115 Proteins - genetic code http://img.sparknotes.com/figures/1/132e5720f3b37836571a1aeb9d163ac3/genetic_code.gif © Burkhard Rost From the book: “DNA: The Secret of Life” by James Watson and Andrew Berry 114 /115 Kingdoms similar in amino acids usage J Liu. & B Rost (2001) Prot Sci 10, 1970-1979. B Rost (2002) Curr Op Struct Biol, 12, 409-416 © Burkhard Rost 115 /115 organisms DO differ in the codon usage nucleotide amino acid GCT GCA GCC GCG A © Burkhard Rost 116 Lecture plan (CB1 structure) 01: 04/25 Tue: no lecture 02: 04/27 Thu: no lecture 03: 05/02 Tue: Organization of lecture: intro into cells & biology 04: 05/04 Thu: Intro I - acids/structure - domains 05: 05/09 Tue: Possibly no lecture - Alignment 1 06: 05/11 Thu: Alignment 2 07: 05/16 Tue: Alignment 3 08: 05/18 Thu: Comparative modeling & experimental structure determination & secondary structure assignment 09: 05/23 Tue: SKIP: student assembly (SVV) 10: 05/25 Thu: SKIP: Ascension Day 11: 05/30 Tue: SKIP: Whitsun holiday (05/15-17) 12: 06/01 Thu: 1D: Secondary structure prediction 1 13: 06/06 Tue: SKIP: Whitsun holiday (06/03-06) 14: 06/08 Thu: 1D: Secondary structure prediction 2 15: 06/13 Tue: 1D: Secondary structure prediction 3 / Transmembrane structure prediction 1 16: 06/15 Thu: SKIP: Corpus Christi 17: 06/20 Tue: 1D: Transmembrane structure prediction 2 / Solvent accessibility prediction 18: 06/22 Thu: 1D: Disorder prediction 19: 06/27 Tue: 2D prediction 20: 06/29 Thu: 3D prediction / Nobel prize symposium 21: 07/04 Tue: TBA 22: 07/06 Thu: recap 1 23: 07/11 Tue: recap 2 24: 07/12 Thu: examen 25: 07/13 Tue: TBA 26: 07/18 Thu: TBA 27: 07/20 Tue: TBA 28: 07/22 Thu: TBA 29: 07/25 Thu: TBA © Burkhard Rost 117 /115
© Copyright 2026 Paperzz