Homo sapiens taste receptor, type 2, member 38 (TAS2R38), mRNA NCBI Reference Sequence: NM_176817.4 FASTA Graphics nuccore 1 genbank Go to: LOCUS 2012 DEFINITION ACCESSION VERSION KEYWORDS SOURCE ORGANISM REFERENCE AUTHORS TITLE JOURNAL PUBMED REMARK NM_176817 1143 bp mRNA linear PRI 23-SEP- Homo sapiens taste receptor, type 2, member 38 (TAS2R38), mRNA. NM_176817 NM_176817.4 GI:261490644 . Homo sapiens (human) Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. 1 (bases 1 to 1143) Campbell,M.C., Ranciaro,A., Froment,A., Hirbo,J., Omar,S., Bodo,J.M., Nyambo,T., Lema,G., Zinshteyn,D., Drayna,D., Breslin,P.A. and Tishkoff,S.A. Evolution of functionally diverse alleles associated with PTC bitter taste sensitivity in Africa Mol. Biol. Evol. 29 (4), 1141-1153 (2012) 22130969 GeneRIF: Report striking patterns of variation at TAS2R38, including a significant excess of novel rare nonsynonymous polymorphisms that recently arose only in Africa, high frequencies of haplotypes in Africa associated with intermediate bitter taste sensitivity. REFERENCE 2 (bases 1 to 1143) AUTHORS Lipchock,S.V., Reed,D.R. and Mennella,J.A. TITLE Relationship between bitter-taste receptor genotype and solid medication formulation usage among young children: a retrospective analysis JOURNAL Clin Ther 34 (3), 728-733 (2012) PUBMED 22440514 REMARK GeneRIF: Children with >/=1 bitter-sensitive allele (TAS2R38 PP or AP genotype) were more likely to have taken medication in solid formulation than were bitter-insensitive (AA genotype) children. REFERENCE 3 (bases 1 to 1143) AUTHORS Colares-Bento,F.C., Souza,V.C., Toledo,J.O., Moraes,C.F., Alho,C.S., Lima,R.M., Cordova,C. and Nobrega,O.T. TITLE Implication of the G145C polymorphism (rs713598) of the TAS2r38 gene on food consumption by Brazilian older women JOURNAL Arch Gerontol Geriatr 54 (2), E13-E18 (2012) PUBMED REMARK REFERENCE AUTHORS TITLE JOURNAL PUBMED REMARK REFERENCE AUTHORS Naylor,C., TITLE natural JOURNAL PUBMED REMARK variation REFERENCE AUTHORS TITLE cells JOURNAL PUBMED REFERENCE AUTHORS TITLE JOURNAL PUBMED REFERENCE AUTHORS TITLE JOURNAL PUBMED REMARK REFERENCE AUTHORS TITLE JOURNAL PUBMED REMARK REFERENCE AUTHORS 21763010 GeneRIF: G145C polymorphism (rs713598) related to taste and food preferences and habits 4 (bases 1 to 1143) Calo,C., Padiglia,A., Zonza,A., Corrias,L., Contu,P., Tepper,B.J. and Barbarossa,I.T. Polymorphisms in TAS2R38 and the taste bud trophic factor, gustin gene co-operate in modulating PROP taste phenotype Physiol. Behav. 104 (5), 1065-1071 (2011) 21712049 GeneRIF: The data of this study showed how the combination of the TAS2R38 and gustin gene genotypes modulate PROP phenotype. 5 (bases 1 to 1143) Lucock,M., Ng,X., Boyd,L., Skinner,V., Wai,R., Tang,S., Yates,Z., Choi,J.H., Roach,P. and Veysey,M. TAS2R38 bitter taste genetics, dietary vitamin C, and both and synthetic dietary folic acid predict folate status, a key micronutrient in the pathoaetiology of adenomatous polyps Food Funct 2 (8), 457-465 (2011) 21769326 GeneRIF: study examined bitter taste genetics and whether in the TAS2R38 gene at three polymorphic loci (A49P, V262A and I296V) could alter dietary and systemic folate levels and dietary vitamin C intake 6 (bases 1 to 1143) Zhang,Y., Hoon,M.A., Chandrashekar,J., Mueller,K.L., Cook,B., Wu,D., Zuker,C.S. and Ryba,N.J. Coding of sweet, bitter, and umami tastes: different receptor sharing similar signaling pathways Cell 112 (3), 293-301 (2003) 12581520 7 (bases 1 to 1143) Bufe,B., Hofmann,T., Krautwurst,D., Raguse,J.D. and Meyerhof,W. The human TAS2R16 receptor mediates bitter taste in response to beta-glucopyranosides Nat. Genet. 32 (3), 397-401 (2002) 12379855 8 (bases 1 to 1143) Montmayeur,J.P. and Matsunami,H. Receptors for bitter and sweet taste Curr. Opin. Neurobiol. 12 (4), 366-371 (2002) 12139982 Review article 9 (bases 1 to 1143) Margolskee,R.F. Molecular mechanisms of bitter and sweet taste transduction J. Biol. Chem. 277 (1), 1-4 (2002) 11696554 Review article 10 (bases 1 to 1143) Anne-Spence,M., Falk,C.T., Neiswanger,K., Field,L.L., Marazita,M.L., Allen,F.H. Jr., Siervogel,R.M., Roche,A.F., Crandall,B.F. and Sparkes,R.S. TITLE JOURNAL PUBMED COMMENT Estimating the recombination frequency for the PTC-Kell linkage Hum. Genet. 67 (2), 183-186 (1984) 6745938 REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BC104933.1. This sequence is a reference standard in the RefSeqGene project. On Oct 17, 2009 this sequence version replaced gi:223278414. Summary: This gene encodes a seven-transmembrane G protein- coupled receptor that controls the ability to taste glucosinolates, a family of bitter-tasting compounds found in plants of the Brassica sp. Synthetic compounds phenylthiocarbamide (PTC) and 6-n-propylthiouracil (PROP) have been identified as ligands for this receptor and have been used to test the genetic diversity of this gene. Although several allelic forms of this gene have been identified worldwide, there are two predominant common forms (taster and non-taster) found outside of Africa. These alleles differ at three nucleotide positions resulting in amino acid changes in the protein (A49P, A262V, and V296I) with the amino acid combination PAV identifying the taster variant (and AVI identifying the non-taster variant). [provided by RefSeq, Oct 2009]. Sequence Note: This RefSeq represents the non-taster AVI allele which is defined by polymorphic variation at three positions (A49P, A262V, and V296I). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN 1-1143 BC104933.1 1-1143 FEATURES Location/Qualifiers source 1..1143 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="7" /map="7q34" gene 1..1143 /gene="TAS2R38" /gene_synonym="PTC; T2R38; T2R61" /note="taste receptor, type 2, member 38" /db_xref="GeneID:5726" /db_xref="HGNC:9584" /db_xref="HPRD:09672" /db_xref="MIM:607751" exon 1..1143 /gene="TAS2R38" /gene_synonym="PTC; T2R38; T2R61" /inference="alignment:Splign" /number=1 PRIMARY COMP STS misc_feature CDS 1..1143 /gene="TAS2R38" /gene_synonym="PTC; T2R38; T2R61" /db_xref="UniSTS:490162" 70..72 /gene="TAS2R38" /gene_synonym="PTC; T2R38; T2R61" /note="upstream in-frame stop codon" 85..1086 /gene="TAS2R38" /gene_synonym="PTC; T2R38; T2R61" /note="PTC bitter taste receptor; taste receptor type 2 member 61" /codon_start=1 /product="taste receptor type 2 member 38" /protein_id="NP_789787.4" /db_xref="GI:261490645" /db_xref="CCDS:CCDS34765.1" /db_xref="GeneID:5726" /db_xref="HGNC:9584" /db_xref="HPRD:09672" /db_xref="MIM:607751" /translation="MLTLTRIRTVSYEVRSTFLFISVLEFAVGFLTNAFVFLVNFWDV VKRQALSNSDCVLLCLSISRLFLHGLLFLSAIQLTHFQKLSEPLNHSYQAIIMLWMIA NQANLWLAACLSLLYCSKLIRFSHTFLICLASWVSRKISQMLLGIILCSCICTVLCVW CFFSRPHFTVTTVLFMNNNTRLNWQIKDLNLFYSFLFCYLWSVPPFLLFLVSSGMLTV SLGRHMRTMKVYTRNSRDPSLEAHIKALKSLVSFFCFFVISSCVAFISVPLLILWRDK IGVMVCVGIMAACPSGHAAILISGNAKLRRAVMTILLWAQSSLKVRADHKADSRTLC" misc_feature 136..198 /gene="TAS2R38" /gene_synonym="PTC; T2R38; T2R61" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P59533.3); transmembrane region" misc_feature 142..210 /gene="TAS2R38" /gene_synonym="PTC; T2R38; T2R61" /inference="protein motif:TMHMM:2.0" /note="Region: transmembrane helix" misc_feature 247..315 /gene="TAS2R38" /gene_synonym="PTC; T2R38; T2R61" /inference="protein motif:TMHMM:2.0" /note="Region: transmembrane helix" misc_feature 250..312 /gene="TAS2R38" /gene_synonym="PTC; T2R38; T2R61" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P59533.3); misc_feature misc_feature misc_feature misc_feature misc_feature misc_feature misc_feature misc_feature misc_feature misc_feature transmembrane region" 367..435 /gene="TAS2R38" /gene_synonym="PTC; T2R38; T2R61" /inference="protein motif:TMHMM:2.0" /note="Region: transmembrane helix" 367..429 /gene="TAS2R38" /gene_synonym="PTC; T2R38; T2R61" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P59533.3); transmembrane region" 511..573 /gene="TAS2R38" /gene_synonym="PTC; T2R38; T2R61" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P59533.3); transmembrane region" 514..582 /gene="TAS2R38" /gene_synonym="PTC; T2R38; T2R61" /inference="protein motif:TMHMM:2.0" /note="Region: transmembrane helix" 655..717 /gene="TAS2R38" /gene_synonym="PTC; T2R38; T2R61" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P59533.3); transmembrane region" 679..747 /gene="TAS2R38" /gene_synonym="PTC; T2R38; T2R61" /inference="protein motif:TMHMM:2.0" /note="Region: transmembrane helix" 832..900 /gene="TAS2R38" /gene_synonym="PTC; T2R38; T2R61" /inference="protein motif:TMHMM:2.0" /note="Region: transmembrane helix" 838..900 /gene="TAS2R38" /gene_synonym="PTC; T2R38; T2R61" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P59533.3); transmembrane region" 913..981 /gene="TAS2R38" /gene_synonym="PTC; T2R38; T2R61" /inference="protein motif:TMHMM:2.0" /note="Region: transmembrane helix" 913..975 /gene="TAS2R38" /gene_synonym="PTC; T2R38; T2R61" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P59533.3); transmembrane region" 192..464 /gene="TAS2R38" /gene_synonym="PTC; T2R38; T2R61" /standard_name="G63092" /db_xref="UniSTS:140067" STS ORIGIN // 1 61 121 181 cctttctgca atagccaatt gaagtcagga aatgccttcg ccttcg ctgggtggca agagaagtga gtacatttct ttttcttggt ttttcttggt accaggtctt catcatgttg gttcatttca gaatttttgg gaatttttgg tagattagcc actctaactc gtcctggagt gatgtagtga gatgtagtga aactagagaa gagaagtaga gcatccgcac tgtgtcctat ttgcagtggg gtttctgacc agaggcaggc actgagcaac agaggcgg Primer Forward 241 301 361 421 481 541 601 661 721 781 841 901 961 1021 1081 1141 agtgattgtg ctgagtgcta caagccatca ctcagcctgc gcaagctggg atctgcactg gtgctattca tattcctttc tctgggatgc aactctcgtg ttctgcttct tggcgcgaca catgcagcca ctctgggctc tgctgagaat gcc tgctgctgtg tccagcttac tcatgctatg tttactgctc tctccaggaa tcctctgtgt tgaataacaa tcttctgcta tgactgtctc accccagcct ttgtgatatc aaataggggt tcctgatctc agagcagcct ggacatgaaa tctcagcatc ccacttccag gatgattgca caagctcatc gatctcccag ttggtgcttt tacaaggctc tctgtggtct cctgggaagg ggaggcccac atcctgtgtt gatggtttgt aggcaatgcc gaaggtaaga tgagctcttc agccggcttt aagttgagtg aaccaagcca cgtttctctc atgctcctgg tttagcagac aactggcaga gtgcctcctt cacatgagga attaaagccc gccttcatct gttgggataa aagttgagga gccgaccaca attaatacgc tcctgcatgg aaccactgaa acctctggct acaccttcct gtattattct ctcacttcac ttaaagatct tcctattgtt caatgaaggt tcaagtctct ctgtgcccct tggcagcttg gagctgtgat aggcagattc ctgtgagtct actgctgttc ccacagctac tgctgcctgc gatctgcttg ttgctcctgc agtcacaact caatttattt tctggtttct ctataccaga tgtctccttt actgattctg tccctctggg gaccattctg ccggacactg tcataaatat Homo sapiens taste receptor, type 2, member 38 (TAS2R38), mRNA NCBI Reference Sequence: NM_176817.4 nuccore LOCUS DEFINITION ACCESSION VERSION FEATURES source gene exon CDS 1 genbank NM_176817 1143 bp mRNA linear PRI 23-SEP-2012 Homo sapiens taste receptor, type 2, member 38 (TAS2R38), mRNA. NM_176817 NM_176817.4 GI:261490644 Location/Qualifiers 1..1143 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="7" /map="7q34" 1..1143 /gene="TAS2R38" /gene_synonym="PTC; T2R38; T2R61" /note="taste receptor, type 2, member 38" 1..1143 /gene="TAS2R38" /gene_synonym="PTC; T2R38; T2R61" /inference="alignment:Splign" /number=1 85..1086 /gene="TAS2R38" /gene_synonym="PTC; T2R38; T2R61" /note="PTC bitter taste receptor; taste receptor type 2 member 61" /codon_start=1 /product="taste receptor type 2 member 38" /protein_id="NP_789787.4" /db_xref="GI:261490645" /db_xref="CCDS:CCDS34765.1" /db_xref="GeneID:5726" /db_xref="HGNC:9584" /db_xref="HPRD:09672" /db_xref="MIM:607751" /translation="MLTLTRIRTVSYEVRSTFLFISVLEFAVGFLTNAFVFLVNFWDV VKRQALSNSDCVLLCLSISRLFLHGLLFLSAIQLTHFQKLSEPLNHSYQAIIMLWMIA NQANLWLAACLSLLYCSKLIRFSHTFLICLASWVSRKISQMLLGIILCSCICTVLCVW CFFSRPHFTVTTVLFMNNNTRLNWQIKDLNLFYSFLFCYLWSVPPFLLFLVSSGMLTV SLGRHMRTMKVYTRNSRDPSLEAHIKALKSLVSFFCFFVISSCVAFISVPLLILWRDK IGVMVCVGIMAACPSGHAAILISGNAKLRRAVMTILLWAQSSLKVRADHKADSRTLC" ORIGIN // 1 61 121 181 cctttctgca atagccaatt gaagtcagga aatgccttcg ccttcg ctgggtggca agagaagtga gtacatttct ttttcttggt ttttcttggt accaggtctt catcatgttg gttcatttca gaatttttgg gaatttttgg tagattagcc actctaactc gtcctggagt gatgtagtga gatgtagtga aactagagaa gagaagtaga gcatccgcac tgtgtcctat ttgcagtggg gtttctgacc agaggcaggc actgagcaac agaggcgg Primer Forward 241 301 361 421 481 541 601 661 721 781 841 901 961 1021 1081 1141 agtgattgtg ctgagtgcta caagccatca ctcagcctgc gcaagctggg atctgcactg gtgctattca tattcctttc tctgggatgc aactctcgtg ttctgcttct tggcgcgaca catgcagcca ctctgggctc tgctgagaat gcc tgctgctgtg tccagcttac tcatgctatg tttactgctc tctccaggaa tcctctgtgt tgaataacaa tcttctgcta tgactgtctc accccagcct ttgtgatatc aaataggggt tcctgatctc agagcagcct ggacatgaaa tctcagcatc ccacttccag gatgattgca caagctcatc gatctcccag ttggtgcttt tacaaggctc tctgtggtct cctgggaagg ggaggcccac atcctgtgtt gatggtttgt aggcaatgcc gaaggtaaga tgagctcttc agccggcttt aagttgagtg aaccaagcca cgtttctctc atgctcctgg tttagcagac aactggcaga gtgcctcctt cacatgagga attaaagccc gccttcatct gttgggataa aagttgagga gccgaccaca attaatacgc tcctgcatgg aaccactgaa acctctggct acaccttcct gtattattct ctcacttcac ttaaagatct tcctattgtt caatgaaggt tcaagtctct ctgtgcccct tggcagcttg gagctgtgat aggcagattc ctgtgagtct actgctgttc ccacagctac tgctgcctgc gatctgcttg ttgctcctgc agtcacaact caatttattt tctggtttct ctataccaga tgtctccttt actgattctg tccctctggg gaccattctg ccggacactg tcataaatat
© Copyright 2026 Paperzz