PAX4 antibody - middle region (ARP32064_P050)
Data Sheet
Product Number
Product Name
Size
Gene Symbol
Alias Symbols
Nucleotide Accession#
Protein Size (# AA)
Molecular Weight
Product Format
NCBI Gene Id
Host
Clonality
Official Gene Full Name
Gene Family
Description
Peptide Sequence
Description of Target
Reconstitution and
Storage
Lead Time
Blocking Peptide
Immunogen
Swissprot Id
Protein Name
ARP32064_P050
PAX4 antibody - middle region (ARP32064_P050)
50ug
PAX4
KPD; MGC129960; MODY9
NM_006193
343 amino acids
37kDa
Lyophilized powder
5078
Rabbit
Polyclonal
Paired box 4
PAX
This is a rabbit polyclonal antibody against PAX4. It was validated on Western Blot by Aviva Systems Biology.
At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000
products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We
usually provide antibodies covering each member of a whole protein family of your interest. We also use our
best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody
needed for your experiment, please inquire ().
Synthetic peptide located within the following region:
RTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRA
PAX4 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically
contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles
during fetal development and cancer growth. The paired box gene 4 is involved in pancreatic islet development
and mouse studies have demonstrated a role for this gene in differentiation of insulin-producing .- cells.
Add 50 ul of distilled water. Final anti-PAX4 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose.
For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Domestic: within 24 hours delivery International: 3-5 business days
For anti-PAX4 antibody is Catalog # AAP32064 (Previous Catalog # AAPP02966)
The immunogen for anti-PAX4 antibody: synthetic peptide directed towards the middle region of human PAX4
A4D0Z1
Paired box gene 4 EMBL EAL24318.1
Anti-PAX4 ARP32064_P050 has recently been referenced in the following publications:
Publications
Zhang, L. et al. KIT is an independent prognostic marker for pancreatic endocrine tumors: a finding derived from
analysis of islet cell differentiation markers. Am. J. Surg. Pathol. 33, 1562​9 (2009). WB, IHC, ELISA, Human
19574886
Sample Type
Confirmation
PAX4 is strongly supported by BioGPS gene expression data to be expressed in OVCAR3
Protein Accession #
Purification
Species Reactivity
Application
Predicted Homology
Based on Immunogen
Sequence
NP_006184
PAX4 is supported by BioGPS gene expression data to be expressed in COLO205
Affinity Purified
Human, Mouse, Rabbit, Dog, Bovine, Pig, Horse, Guinea pig, Rat
WB
Human: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Bovine: 92%; Rabbit: 92%; Guinea
pig: 92%
Human Jurkat
WB Suggested Anti-PAX4 Antibody Titration: 0.2-1
ug/ml
Image 1
Positive Control: Jurkat cell lysate
Hum. Fetal Lung
Host: Rabbit
Target Name: PAX4
Sample Tissue: Human Fetal Lung
Antibody Dilution: 1.0ug/ml
Image 2
Human OVCAR3
Host: Rabbit
Target Name: PAX4
Sample Tissue: OVCAR-3
Antibody Dilution: 1.0ug/ml
Image 3
PAX4 is strongly supported by BioGPS gene
expression data to be expressed in Human OVCAR3
cells
Human COLO205
Image 4
Host: Rabbit
Target Name: PAX4
Sample Tissue: COLO205
Antibody Dilution: 1.0ug/ml
PAX4 is supported by BioGPS gene expression data
to be expressed in COLO205
__________________________________________________________________________________________________________________________________________________________________
This product is for Research Use Only. Not for diagnostic, human, or veterinary use.
Optimal conditions of its use should be determined by end users.