Fault Surface Maps: Three-dimensional Structural Reconstructions and Their Utility in Exploration and Mining Eric Seedorff*, Carson A. Richardson, and David J. Maher Lowell Institute for Mineral Resources, Department of Geosciences, University of Arizona, 1040 East 4th Street, Tucson, Arizona 85721-0077 ABSTRACT Mineral deposits that have been dismembered and tilted by syn- or post-mineral IDXOWV FDQ EH VWUXFWXUDOO\ UHFRQVWUXFWHG WR DFKLHYH VFLHQWL¿F DQG SUDFWLFDO REMHFWLYHV )DXOWVXUIDFHPDSVDUHSODQYLHZSURMHFWLRQVRIWKHJHRORJ\RIWKHIRRWZDOODQGKDQJLQJ ZDOOVXUIDFHVRIDIDXOWVKRZLQJURFNXQLWVIDXOWVDQGRWKHUIHDWXUHV+HUHZHGHVFULEH KRZWRFRQVWUXFWIDXOWVXUIDFHPDSVKRZWRSUHVHQWWKHPHI¿FLHQWO\LQSXEOLFDWLRQVDQG KRZWRXVHWKHPWRPDNHWKUHHGLPHQVLRQDOVWHSZLVHVWUXFWXUDOUHFRQVWUXFWLRQVUHVWRULQJWKHKDQJLQJZDOOPDSDJDLQVWWKHIRRWZDOOPDS$UHDVRIFRPSOH[JHRORJ\FRQWDLQLQJ PXOWLSOHJHQHUDWLRQVRIIDXOWVZLWKGLIIHULQJVOLSGLUHFWLRQVHVSHFLDOO\EHQH¿WIURPWKHXVH RIIDXOWVXUIDFHPDSVIRUWKUHHGLPHQVLRQDOUHFRQVWUXFWLRQV:KHUHWKHUHDUHDGHTXDWH JHRORJLFPDUNHUVDQGWKUHHGLPHQVLRQDOFRQWUROWKHUHVWRUDWLRQUHVXOWVLQQXPHURXVVOLS YHFWRUVDFURVVWKHIDXOWVXUIDFHIURPZKLFKWKHPDJQLWXGHRIVOLSLQWKHSODQHRIWKHIDXOW FDQEHFDOFXODWHGIRUHDFKYHFWRU$GGLWLRQDOJHRORJLFFRQVWUDLQWVDUHUHTXLUHGWRDVVHVV WKHDPRXQWRIWLOWLQJWKDWRFFXUUHGFRQFXUUHQWZLWKVOLSRQHDFKJHQHUDWLRQRIIDXOWV7R achieve a three-dimensional structural reconstruction of an area, the restoration process LVUHSHDWHGIURP\RXQJHVWWRROGHVWIDXOWVZRUNLQJEDFNZDUGLQWLPH 2OGHUIDXOWVDSSHDUDVVLQJOHOLQHVFRPPRQO\NQRZQDVFXWRIIOLQHVRQERWKWKH IRRWZDOO DQG KDQJLQJ ZDOO VXUIDFHV RI \RXQJHU IDXOWV )DXOWV WKDW PRYHG V\QFKURQRXVZLWKWKHIDXOWVXUIDFHEHLQJPDSSHGHJVSOD\VRIWKHVDPHIDXOWDSSHDUDVD VLQJOHEUDQFKOLQHWUDFHLQWKHVDPHSRVLWLRQLQERWKIRRWZDOODQGKDQJLQJZDOOPDSV <RXQJHUFURVVFXWWLQJIDXOWVDSSHDUDVJDSVLQWKHIDXOWVXUIDFHVRIROGHUIDXOWVWKDW DUHLGHQWLFDOO\SRVLWLRQHGRQIRRWZDOODQGKDQJLQJZDOOPDSVDQGWKHJDSVZLGHQLQ WKHGLUHFWLRQRILQFUHDVLQJGLVSODFHPHQWRUGHFUHDVLQJGLSRIWKH\RXQJHUIDXOW([DPSOHVIURPQRUPDOIDXOWVLQWKH5RELQVRQDQG<HULQJWRQPLQLQJGLVWULFWV1HYDGDLOOXVWUDWHWKHGLIIHULQJDSSHDUDQFHVRIIDXOWVXUIDFHPDSVRIHDUO\JHQHUDWLRQVRIIDXOWV YHUVXVODWHUJHQHUDWLRQVRIIDXOWV7KHW\SHVRIPRYHPHQWWKDWDFKLHYHDUHVWRUDWLRQ GLIIHUGHSHQGLQJRQZKHWKHUWKHSRUWLRQRIDQRUPDOIDXOWEHLQJUHVWRUHGLVQHDURU IDUIURPHLWKHUWLSZKHUHWKHGLVSODFHPHQWGLPLQLVKHVWR]HUR1HDUWLSUHJLRQVFRPmonly display an important rotational component pinned near the tip, whereas midIDXOWUHJLRQVDUHGRPLQDWHGE\DGRZQGLSWUDQVODWLRQDOFRPSRQHQW )DXOWVXUIDFHPDSVSURYLGHDQHI¿FLHQWPHWKRGIRUSRUWUD\LQJWKHORFDWLRQVDQG W\SHV RI WKUHHGLPHQVLRQDO JHRORJLF FRQWUROV WKHUHE\ DOORZLQJ UHDGHUV WR VHH PRUH FOHDUO\ZKHUHJHRORJLFLQWHUSUHWDWLRQVDUHZHOOFRQVWUDLQHGYHUVXVORRVHO\FRQVWUDLQHG E\ WKH DYDLODEOH GDWD 7KLV DOORZV XVHUV WR HYDOXDWH WKH YDOLGLW\ RI D SURSRVHG UHconstruction better, to develop and evaluate alternative hypotheses more easily, and WRGLVSHQVHZLWKXQYLDEOHDOWHUQDWLYHVPRUHUHDGLO\6WUXFWXUDOUHFRQVWUXFWLRQVKLVWRULFDOO\ KDYH OHG WR GLVFRYHULHV RI RIIVHW FRQWLQXDWLRQV RI NQRZQ RUHERGLHV DQG RI QHZRUHERGLHV8VHRIIDXOWVXUIDFHPDSVIRUUHFRQVWUXFWLRQVIDFLOLWDWHVDPRUHWKUHH GLPHQVLRQDODSSURDFKWRPLQHUDOH[SORUDWLRQLQFRPSOH[O\IDXOWHGUHJLRQVVXFKDV FHUWDLQSDUWVRIWKH%DVLQDQG5DQJHSURYLQFH .H\ :RUGV Fault surface map, Structural reconstruction, Yerington district, Robinson district, Basin and Range province *E-mail: [email protected] 1179 1180 INTRODUCTION Eric Seedorff, Carson A. Richardson, and David J. Maher as the Basin and Range province (e.g., Proffett, 1977; Wilkins and Heidrick, 1995; Maher, 2008; Seedorff et al., 2008), and Structural reconstructions attempt to undo the effects of this deformation provides the opportunity to explore for strucsecondary deformations that distort the primary geometry of turally offset targets. Balanced structural reconstructions test rock units. In shallow continental extension, the principal de- the feasibility of subsurface interpretations of structural geomformations are normal faulting and to a much lesser degree dis- etry (e.g., Proffett, 1977; Nickerson et al., 2010). This approach tributed strains between faults. Structural reconstructions play has led to the discovery of displaced extensions of veins during DVLJQL¿FDQWUROHLQDGGUHVVLQJFHUWDLQVFLHQWL¿FDQGSUDFWLFDO underground drift advance, such as in the Wright-Hargreaves REMHFWLYHV5HFRQVWUXFWLRQVFDQUHYHDOVRPHWKLQJRIVFLHQWL¿F mine (Hopkins, 1940). Likewise, district-scale exploration interest, such as tectonic and structural processes that lead to programs have discovered tilted and fault-bound fragments of extension of the crust (e.g., Gans and Miller, 1983; Colgan et large porphyry copper systems, such as Kalamazoo, Arizona al., 2010), the original geometry of calderas (e.g., Colgan et (Lowell, 1968; Lowell, 1991) and the Ann-Mason deposit, al., 2008), and the original geometry and scale of ore-forming Yerington district, Nevada (Proffett, 1977; Proffett and Dilles, systems and the processes that formed them (e.g., Shaver and 1984; Hunt, 2004). Similar approaches have been applied sucMcWilliams, 1987; Seedorff, 1991; Dilles and Proffett, 1995; cessfully in the petroleum industry, particularly to establish hyStavast et al., 2008). Likewise, reconstructions can have im- drocarbon migrations pathways across faults (Allan, 1989). plications for exploration and production (e.g., Maher, 2008; Our purpose is to offer one way in which the traditional Nickerson et al., 2010). two-dimensional, cross-sectional approach to structural reImportant challenges in achieving an actual structural re- constructions can be adapted to more of a three-dimensional construction of deformation, however, are the completeness of approach by utilizing plan-view projections of fault surfaces. subsurface geological constraints available to delimit fault ge- We restrict our attention to normal faults formed in areas of ometry and displacement. Moreover, faults in three dimensions continental extension (e.g., Roberts and Yielding, 1994). Fault can be non-planar, and displacements can show gradients along surface maps consist of information plotted on layers, which strike. Challenges also lie in conveying and applying the results can be either physical or digital, with restoration of a geologic of reconstructions such as to reveal the extent of the geologic map of the hanging wall surface against a geologic map of the constraints available, to test the validity of the reconstruction it- footwall surface. Fault surface maps are particularly useful for self, and to move toward three-dimensional reconstructions, in structural reconstructions where multiple, crosscutting sets of the face of what can seem to be blurry distinctions between the normal faults have differing slip directions. We claim that fault geologic facts and interpretations that underlie reconstructions. VXUIDFHPDSVDOVRSURYLGHDQHI¿FLHQWPHDQVRISRUWUD\LQJWKH Two-dimensional structural reconstructions for cross sec- locations and types of three-dimensional data available, which tions oriented parallel to the slip direction are the principal permit users to understand the nature of the constraints betmeans used to test geometric validity, which is also known as ter. In turn, this allows users to evaluate better the validity of balance and derives from conservation of volume (Dahlstrom, a proposed reconstruction hypothesis, to develop and evaluate 1969). A balanced cross section purports to maintain material alternative hypotheses more easily, and to dispense more readbalance between the deformed state and the restored (initial) ily with new but unviable proposals. state. With restrictive assumptions, then area balance and line:H EHJLQ E\ EULHÀ\ UHYLHZLQJ KLVWRULFDO DSSURDFKHV WR length balance can substitute for material balance. These tests structural reconstructions and then describe a multi-layer apFDQ EH DSSOLHG WR LQWHUSUHWDWLRQV RI VSHFL¿F DUHDV HJ %DOO\ proach to constructing fault surface maps. We illustrate selected et al., 1966; Dahlstrom, 1969; Elliott, 1983; Groshong, 1989; characteristics of fault surface maps in areas of complex exNunns, 1991; Buchanan, 1996), but they also can be used to test tensional deformation with examples of normal faults in the geometric validity of kinematic models of deformation, such Robinson and Yerington mining districts of Nevada. These exas those that have been presented for metamorphic core com- amples also illustrate the application of fault surface maps to plexes and other products of continental extension in the Ba- (1) district-scale exploration for structurally offset pieces of ore sin and Range province (e.g., Proffett, 1977; Davis and Coney, bodies and untested new ore bodies, and (2) operational issues 1979; Wernicke, 1981; Davis, 1983; Miller et al., 1983; Buck, such as ore control, geometallurgy, and slope stability in com1988; Lister and Davis, 1989).In principle, only geometrically plexly faulted settings where faults juxtapose variably mineralbalanced cross sections are retained as possibly valid inter- ized and altered rocks. pretations, whereas cross sections that fail to balance must be revised or rejected because they could not possibly be correct HISTORICAL APPROACHES TO STRUCTURAL 'DKOVWURP,QSUDFWLFHKRZHYHUVLWHVSHFL¿FLQWHUSUH- RECONSTRUCTIONS tations and kinematic models commonly are employed before their geometries are tested adequately for balance. Structural reconstructions undo the effects of fault offsets Syn- and post-mineral normal faults have dismembered and any distributed strains (commonly folds) in blocks between and tilted ore-forming systems in certain geologic terrains such faults. By convention, the footwall block is usually assumed to Fault surface maps: Three-dimensional structural reconstructions and their utility in exploration and mining EH¿[HGDQGWKHKDQJLQJZDOOEORFNLVPRYHGVRDVWRHOLPLQDWH fault offset. The most common form of structural reconstruction is a two-dimensional cross-sectional reconstruction; with limited exceptions, they are accurate and viable when oriented parallel to the slip direction (e.g., Dahlstrom, 1969). In areas of complex geology containing multiple generations of faults with widely differing slip directions, the cross-sectional technique cannot be used in a straightforward manner for reconstructions, nor can it be used to display continuous changes in magnitude and direction of slip of a fault along strike. These situations warrant a three-dimensional approach. Fault-surface map reconstructions, in contrast, are a threedimensional restoration technique, described below, that utilizes plan-view projections of a three-dimensional fault surface. Although structure contours are widely used throughout geology, the addition of geologic maps of the footwall and hanging wall surfaces to make fault surface maps generally have not been addressed in structural geology textbooks and laboratory manuals of the last century, nor in books on applied structural geology for exploration geologists (e.g., Badgley, 1959). The usage of fault surface maps in the mineral industry, at least locally, dates back more than a half century to determine fault offsets of major veins (e.g., Hopkins, 1940), and McKinstry (1948, SDOOXGHVWRWKHPEULHÀ\LQDWH[WERRNRQPLQLQJJHRORJ\ Nonetheless, few economic geologists have been exposed to fault surface maps, and the latter are without mention in the current economic geology literature aside from some recent applications (e.g., Keeler, 2010; Schottenfeld, 2012; Richardson, 2014). Fault surface maps are in more routine use today in the petroleum industry (Tearpock and Bischke, 2003, Chapter 7.6), where they are known as fault cutoff maps (e.g., Needham et al., 1996). Superimposed maps of the hanging wall and footwall surfaces are known as Allan diagrams (after Allan, 1989; Groshong, 2006, p. 229). Nonetheless, fault surface maps also are uncommonly used in the petroleum geology literature. 1181 abrupt change in lithology or alteration within the fault core. In the authors’ experience in the Basin and Range province, mixing of lithologic or alteration types—even where faults have a wide breccia zone—tends to be limited to true widths of centimeters to a few meters. The position of the fault surface is placed at the midpoint of the zone with mixed characteristics. The use of the more general term fault surface, rather than fault plane, is a recognition that the geometry of many faults is somewhat irregular, commonly curviplanar. In our view, the presence or absence of normal drag or reverse drag in the damage zone around faults is irrelevant to making of the fault surface maps, although it might be important for constructing cross sections across faults or interpreting the total amount of extension in the region. Mineral deposits and mining districts offer the advantage of potentially offering an abundance of three-dimensional data collected across and along faults (e.g., Kloppenburg et al., 2010). The two principal means of acquiring such data are geologic mapping and drill logging, although other sources (e.g., VHLVPLF UHÀHFWLRQ LPDJHV DOVR PD\ RIIHU XVHIXO LQIRUPDWLRQ Geologic maps can be made of exposures at the present-day or pre-mining topographic surface, of man-made exposures along major infrastructure routes such as haul roads and underground haulage ways, and of underground drift faces and shovel advances in open-pit mines (e.g., Brimhall et al., 2006). Maps can show the trace of the fault, the elevation along its trace, and the characteristics of the immediate footwall and hanging wall. Drill holes offer comparable information at points where the KROHVSLHUFHWKHIDXOWVXUIDFHWKRXJKWKHFRQ¿GHQFHLQFRUUHlating data between holes and with other exposures generally decreases with distance from the drill hole collar and with increasing distance between holes. Whether the data from drill hole piercements represent different observations along a single fault—rather than miscorrelation of potentially unrelated faults—is an interpretation that must be repeatedly tested, such as by various means of structural analysis, by stratigraphic CONSTRUCTION OF FAULT SURFACE MAPS thickness criteria, or with new exposures of the fault. A wide variety of geologic data from maps and drill holes 'H¿QLWLRQVDQGGDWDLQSXWV can be displayed on layers of fault surface maps. The data can include the elevation of the fault, stratigraphic and intrusive Faults are discontinuities where there is offset by shear dis- units, lithologic and textural variations within the units, strucplacement. The focus here is on faults that have a major normal tural features, characteristics of the fault zone (e.g., tectonic component of slip, but the principles apply to all types of faults. breccias and gouge), and hydrothermal features. Structural The presence or absence of a fault on a map is in part a function features include older, synchronous, and younger faults. Older of the scale of observation and documentation. The maps pre- faults will show as single traces in different (offset) positions in sented here ignore faults with offsets of less than ~10 m. the footwall and hanging wall surfaces of younger faults. Faults Faults typically consist of a zone of deformation (e.g., Da- that moved synchronous with the fault surface being mapped vis et al., 2004, Figure 4; Berg and Skar, 2005, Figure 2; Wib- (e.g., splays of the same fault) will show as a single branch-line berley et al., 2008), commonly consisting of a fault core where trace in the same position in both footwall and hanging wall most of the displacement is accommodated and an enclosing maps (e.g., Walsh et al., 1999). Younger, crosscutting faults will damage zone of deformed rock (e.g., Caine et al., 1996; Kim show as paired traces that constitute an offset. For normal sepaet al., 2004; Micklethwaite, 2011). The entire fault zone may ration faults, offsets create gaps in the fault surfaces of older be tens of meters or more in true width. The fault surface is de- faults that must be closed (restored) before restoring the older ¿QHGKHUHIRUWKHSXUSRVHRIPDNLQJIDXOWVXUIDFHPDSVE\DQ fault. Those gaps are identically positioned on footwall and 1182 Eric Seedorff, Carson A. Richardson, and David J. Maher hanging wall maps and widen in the direction of increasing displacement or decreasing dip of the younger fault. Hydrothermal features include alteration minerals or types, ore and gangue minerals, mineralogic assemblages and associations, as well as assays for ore, by-product, and deleterious elements. Over the life of a mine, the volume of rock that is well GH¿QHGE\GULOOKROHVDOVRWHQGVWRPLJUDWHGRZQZDUGDQGRXWZDUGDVH[SORUDWLRQDQGRUHGH¿QLWLRQFRQWLQXH,QODUJHGHSRVits, this can result in as much as 2–3 km of vertical exposure (Seedorff et al., 2005). The spatial distribution of the data on a fault surface map reveals the abundance, or paucity, of geologic control on the position and characteristics of the fault. may be useful also to make a preliminary structure contour map RIWKHIHDWXUHVWKDWVHHPWRGH¿QHWKHIDXOW,QRXUH[SHULHQFH the surface contour maps at this stage of investigation tend to be undulatory. Later work commonly reveals that the actual fault surface consists of both a gently dipping fault and smaller, crosscutting faults that were unrecognized during the preliminary analysis. After distinguishing between the gently dipping fault and the later, smaller-offset faults, the seemingly undulatory fault surface of the gently dipping fault may be much more planar than it appeared initially. Preliminary structural analysis of faults and fault sets After completion of the preliminary structural analysis of faults and fault sets, maps of individual fault surfaces can be constructed. More detailed map scales permit representation RI ¿QHU JHRORJLF GHWDLOV DQG UHVROXWLRQ RI VPDOOHU RIIVHWV RQ faults. Nonetheless, use of numerous overlapping or quilt-like, stitched together maps can be unwieldy and may impede understanding of the overall area. Alternatively, maps of multiple scales can be utilized for different purposes. If only one scale is employed, as a rule of thumb for physical restoration exercises we recommend selecting a map scale such that the area of interest will approximate the size of a standard drafting table, as compilation may need to use mylar of similar dimensions, and SUHVHQWDWLRQ RI ¿QDO UHVXOWV PD\ UHTXLUH SORWWLQJ RQ SDSHU RI standardized widths. It is useful to assemble universal base maps that apply to all faults, such as topography of the pre-mining surface, current topography, generations of pit topography, and drill hole collar maps with total depth elevations. Other information is most easily attributed on a fault-by-fault basis using multiple layers. A geologically defensible strategy for beginning to construct fault surface maps is to begin with the seemingly youngest faults and work backward in time to the oldest faults, which may miniPL]HHUDVXUHDQGPRGL¿FDWLRQ,QRXUH[SHULHQFHKRZHYHUWKH process is highly iterative regardless of approach. Alternatively, one may choose instead to begin with faults for which there are the best, most numerous, or most widespread data, and then gradually address faults for which there is greater uncertainty regarding their location, relative age, etc. Fault surface maps consist of information plotted on four (or more) layers: (1) data, (2) structure contours, (3) footwall geology; and (4) hanging wall geology. Separation of information onto layers, either physical or digital, keeps the observational constraints and interpretations separated and distinguishDEOHDQGHDVHVWKHWDVNRIPRGL¿FDWLRQRUHUDVXUH$OOOD\HUVFDQ EHUHSURGXFHGWRGLVSOD\WKH¿QDOUHVXOWVRUWKHLQIRUPDWLRQRQ OD\HUV DQG FDQ EH VXSHULPSRVHG RQ PRGL¿HG YHUVLRQV RI layers 3 and 4 to save space, as is done in this paper. Layers or sheets preferably are uniform in size and have a consistent survey grid, so that geologic maps and the various layers for each fault and for different faults can be easily compared. It is useful not to place more than one fault on each layer, for each layer to An analysis of the structure of a region, district, deposit, or prospect precedes construction of fault surface maps, because the latter requires at least a hypothesis about where faults are SUHVHQWKRZPDQ\IDXOWVPLJKWKDYHVXI¿FLHQWVOLSWRZDUUDQW more detailed work, and how earlier faults may have been offset by younger faults. 7KH¿UVWVWHSIRUWKLVDQDO\VLVLVWRFRPSLOHDPDSRUVHWRI maps that contains the best available information on the geology of the area of interest, with particular attention to continuity of faults along strike and crosscutting relationships between different faults (i.e., relative ages). Second, the observed fault segments should be assigned to individual faults, with each seemingly distinct fault assigned a different name and color. Faults of similar strikes, dips, and relative crosscutting relationships might also be grouped into sets of faults (e.g., Proffett, 1977; Westaway, 1991), in which case faults in the same set may be assigned similar colors (e.g., varying shades of blue for different faults of one set, varying shades of green for faults of a second set, etc.). When there is considerable evidence that faults assigned to the same fault set—a descriptive term—were active more or less contemporaneously, sets of faults then may be regarded as constituting sequential fault generations—a temporal and potentially genetic assignment (e.g., Maher, 2008; Nickerson et al., 2010; Richardson and Seedorff, this volume). The aforementioned exercise effectively creates a physical or digital overlay of the geologic map, showing the various faults or sets of faults highlighted in different colors. The resulting assignments of fault segments to individual, named faults then become the basis for generating fault surface maps. In practice, these assignments are part of a long, iterative process, DVDVVLJQPHQWVDUHUH¿QHGRYHUWLPHDVWKHVWUXFWXUDODQDO\VLV continues, as new data are generated (e.g., from new mapping or drill holes), and as hypotheses are tested. The more complex the structure in the area of interest and the less mature the understanding of it, then the more extensive the subsequent PRGL¿FDWLRQVDUHOLNHO\WREH7KHDVVLJQPHQWVDUHSDUWLFXODUO\ tentative for faults that have gentle dips and that crop out only locally yet are laterally extensive beneath the surface or have been eroded overhead. For the preserved parts of such faults, it Construction of layers for fault surface maps Fault surface maps: Three-dimensional structural reconstructions and their utility in exploration and mining cover the same map area at the same scale, and for layers to be labeled consistently, including the name of the fault, the type of layer, the date created, the names of the geologists who made WKHPDSDQGWKHGDWHVPRGL¿HGDVZHOODVDNH\WRFRORUVDQG symbols. 7KH ¿UVW OD\HU FRQVWUXFWHG RI DQ\ JLYHQ IDXOW LV WKH GDWD layer, which contains the observations. The surface traces of the fault over its mapped extent are shown, with measurements on the strike and dip of the fault and kinematic indicators (e.g., slickenlines), if available. Additional information can be added as desired, such as characteristics of the damage zones on either side of the fault. Along the fault trace, points are marked and labeled where major elevation contours cross the fault. Locations where each drill hole pierces the fault also are marked (e.g., with a black dot) and typically are labeled with four pieces of information for each hole: (1) the number of the drill hole (e.g., D117), (2) the elevation of the fault in that drill hole, (3) the lithology or map unit in the immediate footwall of the fault, and (4) the lithology or map unit in the immediate hanging wall of the fault. Data from drill holes that nearly pierced the fault may also be included, as they also constrain the position of the fault to be beyond the end of the drill hole. Where a fault has subsequently been intruded by a dike, then both the dike and the lithologies or map units on either side of the dike (and fault) are noted, as well as the estimated position of the fault zone prior to intrusion by the dike. The second layer constructed is the structure contour layer. Data relevant to the elevation of the fault from drill holes and surface traces of the fault are transferred from the data layer, and an interpretation of the structure contours is drawn using sound geologic reasoning for interpolations and extrapolations. Structure contours generated solely by machines run the danger of being geologically unreasonable where data are sparse, which commonly include the edges of the map. Attempting to make the faults as simple and as close to planar as the data points will allow tends to be a good strategy. The line type used (e.g., VROLGGDVKHGGRWWHGVKRXOGFRQYH\WKHOHYHORIFRQ¿GHQFHLQ the interpreted position of the contours, whether interpolated on the basis of numerous, closely spaced constraints, extrapolated beyond the limit of constraints, or projected beneath or through younger rocks, respectively. Gaps and offsets in the contours result if the fault was cut and offset by a younger fault, creating gaps in the fault surface. Consequently, generation of a structure contour map for a fault generally is an iterative process, as interpretations from one fault are reconciled with those of other faults nearby. The third layer is the footwall geologic map. Boundaries between rock units (depositional, faulted, or intrusive) will appear on the footwall geologic map as traces that are called cutoffs. There will be a matching cutoff (in some form) present on the hanging wall geologic map in a displaced down-dip position for normal-separation faults that have not rotated past horizontal. Unconformity, fault, and intrusive cutoffs may show other cutoffs terminating against them, and these intersections 1183 create piercing points on the footwall and hanging wall maps WKDWFDQEHXVHGWRGH¿QHQHWVOLSYHFWRUVRQWKHIDXOWVXUIDFH (see below). By overlaying the footwall layer on the data layer, the subset of data that are relevant to the geology of the footwall can be transferred to the third layer using standard colors assigned to the various lithologies. The data include the geology of the rocks in the immediate footwall of the mapped surface traces of the fault and data from drill holes that pierce the fault, with some consideration given to holes that nearly reach the fault surface. The contacts between different lithologies (unconformities, depositional, intrusive, or related to other faults) then are interpolated or extrapolated, marked with the appropriate symbols (e.g., wavy lines for unconformities), ideally with PHDQV WR FRQYH\ WKH FRQ¿GHQFH LQ WKHLU LQWHUSUHWHG SRVLWLRQV (see above). The interpretations also are guided by other geologic constraints that may exist (e.g., well documented thicknesses of stratigraphic units). The fourth layer is the hanging wall geologic map, constructed using the same methodology as the footwall geological map but using data relevant to the geology of the immediate hanging wall of the fault. If data are available regarding alteration types, ore and gangue minerals, and assays for ore, by-product, and deleterious elements, then the approach to developing the third and fourth layers can be repeated numerous times to generate pairs of footwall and hanging wall layers for each of these types of information. These data commonly create crude, i.e., larger diameter piercing points, although metal zoning patterns in some cases SURGXFH¿QHVFDOHSDWWHUQVWKDWPDNHH[FHOOHQWSLHUFLQJSRLQWV All of these data potentially can be used for restoration, and in principle each should be consistent with restorations based on lithology and structure. Patterns made of hydrothermal features are particularly valuable for restorations where there are large volumes of uniform host rocks (e.g., hypidiomorphic granular granitoid). Nonetheless, reconstructions may not use data that has changed during or after fault movement. For example, Cu assays may be used for reconstruction, but only those assays in rocks where Cu was not redistributed by supergene processes during or after fault movement. Reconstructions Methodology The methodology of constructing fault surface maps for a short segment of a simple normal fault is illustrated in Figure 1. Figure 1a shows a block diagram of the fault cutting three stratigraphic units and a crosscutting igneous body. Figures 1b and 1c show conventional map and cross sectional views, respectively. Figures 1d and 1e show surface projections of the footwall and hanging wall geology, respectively, i.e., fault surface map. The amount and direction of slip is determined by restoring the hanging-wall block relative to the footwall block in the direction opposite to the slip direction, pinning geologic markers 1184 Eric Seedorff, Carson A. Richardson, and David J. Maher Figure 1. Construction of a geologic fault surface map. (a) Perspective view of block diagram; (b) map view of surface of blocks and exposed fault surface; (c) cross section oriented normal to strike of fault, showing vertical projection of footwall and hanging-wall traces onto horizontal map surface; (d) surface projection of the footwall geology, showing piercing points in footwall; (e) surface projection of the hanging wall geology; piercing points are shown for hanging wall (solid) and footwall (dashed) sides of the fault surface. Vectors pointing toward hanging wall show horizontal projection of slip, i.e., heave component, indicated by offset of piercing points. Reconstruction vectors would be same length but would point in the opposite direction as slip vector, i.e., toward footwall. Elevation difference between head and tail of heave gives throw component. Total slip = sqrt(heave2WKURZ2). Fault surface maps: Three-dimensional structural reconstructions and their utility in exploration and mining or cutoffs in the hanging wall to offset equivalents of the same markers or cutoffs in the footwall (Figure 1e). For most normal faults, the hanging wall is restored up the direction of dip (Figure 1); however, for normal faults that have been rotated through horizontal (“overturned” normal faults), the hangingwall block will be restored down the current dip, but nonetheless opposite the slip direction (e.g., Nickerson et al., 2010). (Analogous relationships exist for tilted reverse and strike-slip faults.) Depending on the geometry of the geologic units and the data available to constrain the positions of contacts in the hanging wall and footwall, the reconstruction may be nonunique, permitting a range of solutions. Ideally, the reconstruction yields a unique slip vector or a unique family of slip vectors. Multiple slip vectors are necessary to characterize a fault if the amount and direction of slip varies along strike because the hanging wall has not only translated relative to the footwall, but also rotated relative to the footwall. The fault surface method, LQSULQFLSOHSHUPLWVGLVSOD\RIDQLQ¿QLWHQXPEHURIVOLSYHFtors on the plane of the fault. The amount and direction of slip can be measured or calculated from the reconstruction. The x-y component of slip, the heave, can be measured from the length of the horizontal component of the slip vector, i.e., its length on the fault surface maps, which are horizontal projections. The z component of slip is the difference in elevations of the piercing points on the hanging-wall and footwall fault surfaces, which can be determined from the structure contours. The geologic constraints in DJLYHQVHJPHQWRIWKHIDXOWPD\EHLQVXI¿FLHQWWRGHWHUPLQH whether or by how much the direction and magnitude of slip vary along strike; indeed, the rotational component of slip may be undetectable without geologic markers that offer detailed spatial resolution, coupled with closely spaced three-dimensional observational constraints. Unique restorations generally involve one or more piercLQJSRLQWVZKLFKDUHJHRORJLFDOO\GH¿QHGSRLQWVLQWKHKDQJing wall that must have a corresponding, unique point in the footwall (Figure 1e). Such points generally result from two intersecting geologic surfaces (i.e., intersecting geologic conWDFWVLQVSDFHWKHUHE\GH¿QLQJDOLQH:KHUHDWKLUGVXUIDFH the fault, cuts the line, two corresponding points on either side of the fault (the piercing points) are produced. Nonetheless, the geology of the hanging wall may be uniquely matched to the geology of the footwall without involving piercing points if rock units have distinctive shapes. Note that the reconstructions are not driven by kinematic models of faults; this procedure uses the geology of the fault surfaces, which are based on interpretations constrained by observations, such as geologic maps and drill hole logs. The geologic markers used to achieve the reconstruction commonly are supracrustal strata that are part of a known stratigraphic sequence, but there are no restrictions on the types of geologic features involved. For instance, these can include crystalline rocks such as plutons and metamorphic rocks or hydrothermal features, even though structural reconstruction 1185 software commonly is not designed to deal with them. Crystalline rocks also may contain numerous, though potentially subtle, geologic features that provide markers for constraining slip (e.g., Maher, 2008), including opportunities for generating piercing points. Examples of such markers, including some that are not routinely recorded on many quadrangle-scale geologic maps, include: (1) sills and their feeder dikes; (2) mappable, compositional or textural variants of plutons; (3) pegmatite and aplite dikes and distinctive hydrothermal veins that may be associated with a pluton; and (4) distinctive textural or compositional variants within metamorphic rock units. The geometries of faults, which are largely inherited from their nucleation, growth, and linkage (e.g., Martel, 1999), have consequences for developing a three-dimensional approach to reconstruction. Over their full lengths, normal faults tend to have characteristic geometries, although an area of interest (e.g., a mining district) may cover only a small fraction of the entire length of a given fault. For the case of an isolated normal fault (Figure 2), its geometry is characteristic and simple, with the opposite ends of the fault having tips where the displacement diminishes to zero (e.g., Muraoka and Kamata, 1983; Barnett et al., 1987; Walsh and Watterson, 1991; Schlische and Anders, 1996). The hanging wall has a gently synclinal geometry between the tips, with the axis of the syncline oriented perpendicular to the fault and plunging toward it (Figure 2). The footwall has an even more subtly anticlinal geometry, with the axis of the anticline oriented perpendicular to the fault and plunging away from the fault. Real normal faults generally have more irregular, sinuous traces at the surface than is shown in Figure 2. Recesses and salients in the surface trace correspond to the troughs and ridges of fault-surface corrugations, respectively, that plunge for many kilometers down dip. The amount of displacement increases along the fault away from each tip toward the point of maximum displacement (Figure 2); theoretically, the change in displacement with length is non-linear, and maximum displacement occurs at the midpoint between the tips for isolated faults (Walsh and Watterson, 1989). For real normal faults, maximum displacement nonetheless tends to occur near the midpoint, and the maximum tilt of both the hanging wall and footwall strata also occurs near the midpoint (Figure 3), with both the displacement and tilt tapering to zero at the tips (Anders and Schlische, 1994). Moreover, longer faults have greater displacements (e.g., Walsh and Watterson, 1987; Dawers and Anders, 1995), with a scaling relationship between displacement (D) and length (L) given by D f Ln, where n is a small number likely to be 1 (Cowie and Scholz, 1992; Dawers et al., 1993). In practice, faults may have more complex geometries and be segmented; moreover, nearby faults commonly interact with one another and join over time (e.g., Childs et al., 1995; Hodgkinson et al., 1996; Cartwright et al., 1996; Crider and Pollard, 1998; Peacock, 2002). Implications for accuracy The characteristic geometry of normal faults (Figure 2) has 1186 Eric Seedorff, Carson A. Richardson, and David J. Maher Figure 2. Three-dimensional perspective view of an idealized, isolated normal fault from tip to tip, showing the point of maximum slip, the tips at either end of WKHIDXOWZKLFKKDYH]HURVOLSDQGLQWHUYHQLQJUHJLRQ7KLVGLDJUDPDOVRLQFRUSRUDWHVÀH[XUDOGHIRUPDWLRQRIIDXOWVEORFNVZLWKÀH[XUDOUHERXQGRUXSOLIWRIWKH KDQJLQJZDOODQGÀH[XUDOVXEVLGHQFHRIWKHIRRWZDOO0RGL¿HGIURP)RVVHQ)LJXUH$ multiple implications for how normal faults are restored and for the accuracy of a reconstruction. First, a purely rigid, up-dip translation of the hanging wall surface relative to the footwall surface in principle is likely to be in error. A purely translational reconstruction may be an exceptionally good approximation for any relatively short segment of a fault (Figure 1e), especially if the region of interest is far from a tip of the fault. This is expected because rotations about horizontal axes that result in tilting of fault blocks are clearly the dominant deformation in areas characterized by domino-style extension. Nonetheless, an increase in displacement along the strike of a normal fault implies at least a minor component of relative vertical-axis rotation between hanging wall and footwall blocks (Figure 2). This effect is expected to EHPRVWVLJQL¿FDQWQHDUDWLSRIDQRUPDOIDXOWDQGWKHQHWHIIHFW PLJKW EH PRVW VLJQL¿FDQW UHJLRQDOO\ ZLWKLQ DFFRPPRGDtion zones, where many faults typically are tipping out (e.g., Faulds and Varga, 1998). Second, the direction of rotation of the hanging wall relative to the footwall must reverse as one crosses the point of maximum displacement. Consequently, the accuracy of rigidbody approximations that employ both translational and rotational components will be increased if conducted separately on opposite ends of the point of maximum displacement. Third, additional assumptions may be required when reconstructing displacements near the tips of faults, especially in the absence of closely spaced observational control. Strain extends beyond the tip in the form of fractures and small folds (e.g., McGrath and Davison, 1995; Schlische, 1995; Walsh et al., 1999; Crider and Peacock, 2004; d’Alessio and Martel, 2004), but the amount of slip at the tip is zero (Figure 1). Figure 3 shows two versions of near-tip behavior of a normal fault. Though omitting effects of strain beyond the tip, Figure 3a depicts non-rigid behavior of the hanging-wall block, with a distinctly non-linear increase in displacement as a function of distance from the tip. Obviously, any rigid reconstruction—whether or not it involves rotation—will be only an approximation if the change in slip along strike is nonlinear. Alternatively, an assumption of linear change in displacement along strike may be an acceptable approximation. The assumption of a linear decrease in displacement toward the tip and zero displacement beyond it implies components of both translation and rotation of the hanging wall relative to the footwall, with rotation of the hanging wall as a rigid block about a pole of rotation located at the tip and ignoring effects of strain beyond the tip (Figure 3b). Fourth, a rigid-body reconstruction also will be only an approximation if penetrative deformation of either the hanging wall or footwall blocks occurs concurrent with slip. Penetrative deformation of both hanging wall and footwall are LQKHUHQWLQWKHÀH[XUDOFDQWLOHYHUW\SHGHIRUPDWLRQHJ)LJure 1) that seems to characterize continental extension (e.g., Kusznir and Egan, 1990; Kusznir and Ziegler, 1992; Roberts and Yielding, 1994). A perfect palinspastic reconstruction must not only restore the slip but also remove the monoclinal ÀH[XULQJWKDWDFFRPSDQLHGVOLS7KHRUHWLFDOFDOFXODWLRQVVXJgest that reconstructions assuming rigid domino-type behavLRUZLOORYHUHVWLPDWHWKHDPRXQWRIH[WHQVLRQLIÀH[XUDOFDQtilever-type deformation is involved (Westaway and Kusznir, 1993). Fifth, the restoration process only backs out the movement on the fault; even if the direction and amount of slip have been determined quite rigorously (notwithstanding second-order Fault surface maps: Three-dimensional structural reconstructions and their utility in exploration and mining characteristics of normal faults, noted above), it does not generally return the fault surface to its original orientation prior to the onset of faulting because normal faults commonly rotate or tilt as they move (Thompson, 1960; Morton and Black, 1975; :HUQLFNH DQG %XUFK¿HO *DQV HW DO -DFNVRQ 1987). Additional geologic constraints typically are required to determine the original dip of the fault. For example, beddingto-fault angles of syntectonic sedimentary strata (Gawthorpe DQG/HHGHUDQGRULHQWDWLRQVRIÀDWWHQHGSXPLFHLQSUH WHFWRQLFLJQLPEULWHVDVKÀRZWXIIV²ZLWKDSSURSULDWHUHJDUG for the likelihood of unreliable measurements due to differential compaction in paleovalleys with steep walls (e.g., Henry, 2008; Henry and Faulds, 2010)—can be used to determine how each fault surface should be restored to its original dip (Proffett, 1977; Gonsior and Dilles, 2008; John et al., 2008). The origiQDOGLSRIWKHIDXOWLVRIVLJQL¿FDQWLQWHUHVWEHFDXVHWKHDQJOH of initiation of normal faults in continental extensional tectonics is a persistent controversy (e.g., Gans et al., 1985; Jackson and White, 1989; Lister and Davis, 1989; Roberts and Yielding, 1994; Wong and Gans, 2008), and structural reconstruction is an important method for constraining initial dips of faults. For many faults, the direction and amount of slip are well constrained, yet the constraints on the initial dips are nonetheless poor. To obtain a three-dimensional structural reconstruction of an area, the reconstruction process proceeds backward in 1187 WLPH LH IURP \RXQJHVW WR ROGHVW IDXOWV 6LJQL¿FDQW HUURUV in determining crosscutting relationships generally preclude achieving a reconstruction that will balance. Hence, continual testing of hypotheses regarding the relative ages of faults is essential. When restoring older faults, the gaps created by younger FURVVFXWWLQJQRUPDOIDXOWV¿UVWPXVWEHFORVHG6PDOOHUURUVLQ the amount and direction of slip will be introduced if the geometry of the older fault was deformed by offset on the younger fault. Errors in the amount and direction of slip also will be introduced if there was differential tilting of the older fault surface across the hanging wall and footwall blocks of the younger fault, because tilting of the fault surface changes the dimensions and geology of its surface projection. If the shape of the fault surface, as illustrated by the structure contours, changes markedly on either side of the gaps created by offsets by younger, crosscutting faults are closed, then care is required in calculating the direction and magnitude of slip. It is unlikely that any palinspastic restoration mimics nature perfectly, because all methods make simplifying assumptions. Nonetheless, even imperfect restorations can lead to greater geologic understanding. As the models become more three-dimensional, however, the overall importance of the 3-D effects in the natural processes becomes more apparent. Indeed, a restoration cannot be achieved in some geologic settings without a satisfactory accounting of the 3-D effects. )LJXUH3HUVSHFWLYHYLHZRIVLPSOL¿HGEORFNGLDJUDPVVKRZLQJPRYHPHQWWKDWPLJKWRFFXUQHDUWKHWLSRIDQRUPDOIDXOWD([DPSOHVKRZLQJQRQULJLGQRQ linear) behavior of the hanging wall block relative to the footwall block, which resembles the case in Figure 1. (b) For comparison, an example with a simplifying assumption that might be employed in a restoration in which the hanging-wall block is assumed to move rigidly with a linear displacement-length behavior. In reality, such movement also would produce additional deformation beyond the tip of the fault (not shown). These two examples involve both translation and rotation of the hanging wall relative to the footwall. 1188 Eric Seedorff, Carson A. Richardson, and David J. Maher EXAMPLES AND APPLICATIONS: TOPOLOGY AND RECONSTRUCTION OF SUPERIMPOSED FAULT GENERATIONS magnitudes of slip than the younger faults that bound the major blocks. Selected post-mineral normal faults in the Liberty pit of the Robinson district illustrate some of the diversity in topologies The Robinson and Yerington districts, Nevada, provide of fault surface maps, even though a reconstruction of the postexamples of some of the diversity in topologies and character- mineral faulting of the district is still incomplete, so the results istics of fault surface maps and applications of structural recon- shown are preliminary. For geologic context and location of the structions to exploration and mining operations. faults described below, Figure 4 shows an east-west cross section from Maher and Seedorff (2000) through the middle of the Overview of Robinson district geology Liberty pit with overlays showing rock types, alteration, and structure. The Robinson district, also known as the Ely porphyry copThe horizontal projection of the rock/alteration types and per system, contains porphyry, skarn, carbonate replacement, structure of the footwall and hanging-wall surfaces is illustrated and distal Au-Ag ores in the central Egan Range near the town for the Dexter, Alpha, and Liberty faults in Figures 5 through of Ely in east-central Nevada. The Robinson district seemingly 7. Grid lines are labeled in the mine grid coordinates in feet constitutes one, mid-Cretaceous porphyry copper center with (virtually no rotation from true north), but a metric scale bar is early sills and several later mineralizing stocks (Seedorff et al., included. The rocks in certain areas are so intensely altered that 1996). The system was dismembered and variably tilted by late the determination of the protolith can be problematic; in such Eocene normal faults that formed within a narrow absolute time rocks, reliable bedding attitudes generally were never mapped. interval between ~37.60 and 36.68 Ma. In some cases, bedding attitudes were measured at the surface Robinson is a monzonitic porphyry Cu-(Mo-Au) system and can be projected down to the fault surface (dips shown in LQWKHFODVVL¿FDWLRQVFKHPHRI6HHGRUIIHWDO7KHKRVW parentheses). Stratigraphic and intrusive contacts are shown in rocks are carbonate and clastic units of the miogeocline of thin black lines; faults contacts are shown in thick colored lines. western North America (e.g., Stewart, 1980), and those that Various lithologic/alteration types each have distinct colors, but crop out in the district range in age from Devonian to Permian so, too, do the various faults, their associated dip symbols, and (Bauer et al., 1966; Maher, 1996; Shaver and Jeanne, 1996). ODEHOV7KH GLVWULEXWLRQ RI DOWHUDWLRQ KDV EHHQ VLPSOL¿HG DQG A batholithic intrusion that is the source of the stocks and sills certain alteration boundaries have been omitted unless they ilin the district, the Weary Flat pluton, has a U-Pb zircon LA- lustrate structural aspects that are the focus of this contribution. ICP-MS date of 109.3±1.5 Ma (Seedorff et al., this volume). The geometry of faults is indicated by structure contour lines in From west to east, the copper occurs principally in the Vet- feet that are identical on the footwall and hanging wall geologic eran, Tripp, Liberty, Ruth, and Kimbley pits (e.g., Bauer et maps. The locations of reliable geologic control for these maps al., 1966). are shown by intensely colored dots (drill hole piercing locaPaleozoic and Tertiary strata in the northern Egan Range tions) and by very thick colored lines (the geology in the immestrike northerly and dip to the west because of tilting associated diate footwall and hanging wall along the mapped trace of the with slip on several sets of east-dipping normal faults, whereas fault). Interpretations of lithologic/alteration types are shown strata in the southern Egan Range strike northerly but dip to in fainter colors. Circles show reference points for restoration the east, associated with slip on several sets of west-dipping of slip. Black vectors show the direction and magnitude of slip, normal faults. The Robinson district is located in the central measured in the plane of the fault. Red arcs with exaggerated Egan Range, where faults typical of the northern Egan Range curvature emphasize the sense of rotation for faults with an imare tipping out to the south and faults typical of the southern portant rotational component of slip (Figures 5b, 7b). Egan Range are tipping out to the north. Thus the Robinson district occurs within a regional-scale extensional accommodation Fault surfaces of relatively young faults zone that persists for tens of km north-south within the central Egan Range (Seedorff et al., 1996; Gans et al., 2001; Seedorff Figure 5 illustrates the horizontal projection of the geoland Maher, 2002). ogy of the footwall and hanging-wall surfaces of the Dexter The alignments of intrusions and mineralization across the fault. This fault illustrates characteristics of fault surface maps district are the net result of slip on the numerous sets of post- of relatively young faults, i.e., faults from late generations of mineral faults. The large open pits are bounded by relatively faults: the fault surface tends to contain many rock types and allate, post-mineral normal faults (e.g., Bauer et al., 1966; Wes- teration types in complex patterns, a wide range in bedding attitra, 1982; Seedorff et al., 1996; Gans et al., 2001), but each tudes with locally abrupt changes at boundaries between faults, big fault block internally contains numerous other, mostly older a paucity of younger faults, and an abundance of older faults. faults. Some of the older faults, including the Alpha fault deThe Dexter fault is a relatively young, east-dipping norscribed below, are gently dipping, do not crop out at the surface mal fault that cuts across the western end of the Liberty area in within any one large fault block, and in some cases have greater the Robinson district. This fault is cut off at depth by the still Fault surface maps: Three-dimensional structural reconstructions and their utility in exploration and mining 1189 Figure 4. East-west geologic cross section through the middle of the Liberty pit along section 102,900N, with overlays showing (a) rock type, (b) structure, (c) alteration, and (d) copper grade. Note that many of the normal faults that dip steeply, both to the east and west, are cut off at depth by the gently dipping Footwall East fault, yet the Footwall East fault in turn is cut and offset by younger faults such as the Liberty and Josie faults. From Maher and Seedorff (2000). Fault names XVHGLQODWHU¿JXUHVDQGWKHJHRORJLFXQGHUVWDQGLQJRIWKH/LEHUW\DUHDKDYHHYROYHGVOLJKWO\VLQFHWKHVHFURVVVHFWLRQVZHUHPDGHHJ+XPEXJIDXOWQRWVKRZQ KHUH%DOO3DUNIDXOWLQWKLV¿JXUHFRUUHVSRQGWR%HHKLYHIDXOW younger Footwall East fault (Figure 4b); therefore, the northward and down-dip continuation of the Dexter fault must be present somewhere in the footwall of the Footwall East fault (not shown). As indicated by the structure contours, the Dexter fault dips ~40–45°E and strikes nearly due north in the middle of the Liberty pit but swings eastward further south (Figure 5), whereas the Footwall East fault beneath it dips ~30°SE. The Dexter fault everywhere places younger rocks on older rocks, FRQ¿UPLQJWKDWLWLVDQRUPDOIDXOW Relatively young faults generally cut and offset numerous older faults. The older faults that are cut by the Dexter IDXOW $OSKD %HHKLYH &RSSHU )ODW 6XO¿GH (DVW (OGRUDGR Champion, and High Grade Hanging Wall Splay faults) occur as single, curving lines on both the footwall and hanging-wall surface geologic maps, but their positions are offset between the footwall and hanging wall (Figure 5). Among other geologic features, the older faults serve as geologic markers to constrain the direction and magnitude of slip on the younger fault. The Footwall East fault cuts off the Dexter fault to the QRUWK DQG DW GHSWK 7KH 'H[WHU IDXOW LQ WKH ¿HOG RI YLHZ RI Figure 5 also is cut by two younger faults (Humbug and Josie faults), which also cut the Footwall East fault at depth. In any fault surface map, younger faults occur in the same place in the footwall and hanging-wall surfaces and create gaps in both 1190 Eric Seedorff, Carson A. Richardson, and David J. Maher Figure 5. Preliminary fault surface maps for the Dexter fault in the Liberty pit, Robinson district. The Dexter fault is relatively young and its subsurface geometry is well sampled by drill holes. (a) Footwall map. (b) Hanging wall map. Structure contours (gray) on both maps show that Dexter fault is corrugated and indicate that overall it has a northerly strike and a moderate easterly dip of ~40–45°, extending from surface (green) to its down-dip truncation by the Footwall East fault SLQNH[FHSWWRWKHVRXWKZKHUHWKHORFDWLRQRIWKH)RRWZDOO(DVWIDXOWLVXQFRQVWUDLQHG*HRORJLFPDSVRIVXI¿FLHQWTXDOLW\DQGGHWDLOGLGQRWH[LVWLQWKLVDUHD so the only locations of reliable geologic control are intensely colored dots for drill hole piercements; interpretations of lithologic/alteration types around the drill holes are shown in fainter colors. Older faults individually colored and labeled) are shown as colored lines; the locations of older faults are offset between the hanging wall and footwall fault surface maps. Therefore, the older faults constrain the direction and magnitude of slip on the fault, as do other geologic markers. The overturned dip symbol is used where the dip directions of the Alpha and Beehive faults are opposite to their interpreted slip directions. Two younger faults (Humbug and Josie) crosscut the Dexter fault on these maps, and a third younger fault, the Footwall East fault, cuts off the Dexter to the north and dips under these fault surfaces (see Figure 4). Younger faults occur in the same place in the hanging wall and footwall surfaces of the Dexter fault and create gaps in both the hangLQJZDOODQGIRRWZDOOIDXOWVXUIDFHPDSVLOOXVWUDWLQJWKHVXEVHTXHQWH[WHQVLRQ$OWKRXJKWKHJHRORJLFLQWHUSUHWDWLRQVUHTXLUHIXUWKHUUH¿QHPHQWWKHDSSUR[LPDWH slip is shown by circular reference points in the hanging wall and footwall blocks. Geologic reference points are shown as circles. At southern end of map the slip measured in the plane of the fault is ~95 ft (~29 m) N53E and increases to ~240 ft (~73 m) in a N66E direction at the northern end, producing a horizontal component of clockwise rotation of the hanging wall by ~2° relative to the footwall. Source of information; E. Seedorff et al. (unpub. data). Fault surface maps: Three-dimensional structural reconstructions and their utility in exploration and mining the footwall and hanging-wall fault surface maps. These gaps illustrate the extension that was produced by subsequent faulting, and the gaps must be closed before determining the slip on the older fault. Regardless of relative age, faults with large magnitudes of slip are most likely to create large discontinuities in metal grade and metallurgical behavior, but late, small-offset faults such as the Dexter also can create large discontinuities in places where they cut and offset older, large-offset faults (e.g., Figure 4d). Because late faults tend to be more continuous along strike and down dip, they are especially critical for rock mechanics issues (e.g., pit slope stability and block caving behavior), even if they have only small amounts of slip. Of course, it is not only the characteristics of the faults (e.g., strike and dip, presence of gouge, thickness of breccia), but also the characteristics of the rocks (e.g., attitudes of bedding planes and joints, strength, friability) that affect rock mechanics, as well as the angles of intersection of the various faults and other features (e.g., whether they form wedges or buttresses). Some of the contacts (fault, stratigraphic, intrusive, alteration) shown on the fault surface maps of the Dexter fault (Figure 5) are approximately planar, but many are highly irregular. A few of the irregularities in contacts are the product of remaining imperfections in the three-dimensional geologic interpretations. A second factor leading to irregularities is that deformaWLRQDVVRFLDWHGZLWKPRYHPHQWRQ\RXQJHUIDXOWVHJÀH[XUH of the hanging wall and footwall blocks near the fault surface) can deform preexisting features, including older faults (seen best for later example of the Alpha fault). Most irregularities, however, result from a third factor: lines on these maps result from intersection of two, irregular, curviplanar features (i.e., the Dexter fault and the contact of interest), and that intersection— and its horizontal projection—can be much more irregular than the irregularities in either of the two surfaces that intersect. The structure contours on the fault surface maps help remind users of these geometric consequences. The dip directions of older faults, which are taken from dip measurements and structure contour maps of the older faults, generally are far from perpendicular to the trace of the older faults. This effect is produced on fault surface maps by the intersection of older fault surfaces with the surface of younger faults, such as the Dexter. The effect is analogous to dip measurements on faults not being perpendicular to the trace of a fault if the fault trace is changing elevation across a topographic surface. These preliminary footwall and hanging-wall fault surface maps do not match perfectly because of remaining imperfections in the three-dimensional geologic interpretations, but slip on the Dexter fault nonetheless can be estimated to a precision of ~10 m. The magnitude of slip on the Dexter fault at the southern end of the map is ~95 ft (~29 m), and the magnitude of slip increases to ~240 ft (~73 m) at the northern end (Figure 5), resulting in a horizontal component of clockwise rotation of the hanging wall relative to the footwall of ~2°. 1191 Fault surfaces of relatively old faults Figure 6 shows preliminary fault surface maps for the Alpha fault in the Liberty pit east of the Kaboony fault and west RIWKH6XO¿GH(DVWIDXOWH[HPSOLI\LQJFKDUDFWHULVWLFVRIIDXOWV from relatively early fault generations: few rock types and alteration types present, generally regular changes in bedding dips and typically of a limited range, abundance of younger faults, and paucity of older faults. The Alpha fault in the Liberty pit is a relatively old, gently dipping fault that crops out on the western side of the Liberty pit both north and south of the younger White Hill Rhyolite (Figure 6), and it continues into other parts of the Robinson district. The Alpha fault is cut off to the north by the younger Footwall East fault (Figure 6); therefore, the Alpha fault must continue in the footwall of the Footwall East fault (not shown). Between WKH\RXQJHU.DERRQ\DQG6XO¿GH(DVWIDXOWVWKH$OSKDIDXOW has a narrow range in elevation, mostly between 7000 and 7250 ft, and dips in variable directions at moderate to shallow angles, as indicated by the morphology of structure contours (Figure 6). The Alpha fault must be normal because it everywhere omits stratigraphic section (e.g., a common relationship for the Alpha IDXOW LQ WKH /LEHUW\ SLW LV YDULDEO\ VLOLFL¿HG 3HUPLDQ 5LE +LOO Sandstone in the hanging wall, resting on Pennsylvanian Ely Limestone altered to silica-pyrite and ore-related porphyry with intense sericitic alteration in the footwall). For some time, the VOLSGLUHFWLRQRIWKH$OSKDIDXOWZDVQRW¿UPO\NQRZQEXWWKH fault surface maps here (Figure 6) demonstrate that the Alpha fault is a top-to-the-east normal fault which may have originated as a steep, down-to-the-east normal fault. Within the area shown by Figure 6, the Alpha does not cut any older faults. The Alpha fault, however, is highly dismembered by numerous younger, crosscutting faults that displace the Alpha fault (Kaboony, West Dexter, Dexter, Watson West, :DWVRQ:DWVRQ(DVW6XO¿GH(DVW+XPEXJDQG-RVLHIDXOWV plus the Footwall East fault that cuts it off to the north). Each younger, crosscutting fault creates a gap in both the footwall and hanging-wall fault surface maps for the Alpha fault (Figure 6), which must be closed to assess the amount and direction of slip on the Alpha fault precisely. In the northern part of the Liberty pit, each of the small fragments of the Alpha fault dips back to the west. At the southern end of the area, the Alpha fault assumes a more consistent southerly dip. The Alpha fault also appears to be less planar than many younger faults, and structure contours suggest that this may have been caused by footwall uplift and hanging wall subsidence related to movement on the younger faults (Figure 6). Such deformation varies in magnitude along the strikes of the younger faults, causing warps and wrinkles in the surface of the older, Alpha fault. Such deformation also passively rotates the Alpha fault surface. Where the Alpha fault has been rotated through horizontal, the originally east-dipping Alpha fault becomes an “overturned,” gently westdipping normal fault (Figures 4b and 6). Bedding attitudes measured at the pre-mining surface in the 1192 Eric Seedorff, Carson A. Richardson, and David J. Maher )LJXUH$3UHOLPLQDU\IDXOWVXUIDFHPDSVIRUWKH$OSKDIDXOWLQWKH/LEHUW\SLWHDVWRIWKH.DERRQ\IDXOWDQGZHVWRIWKH6XO¿GHIDXOW5RELQVRQGLVWULFW exemplifying characteristics of faults from relatively early fault generations. (A) Footwall; (B) hanging wall. The locations of good geologic control are shown by intensely colored dots (drill hole piercements). Other attributes are as described for Figure 6 and in the text. There are no older faults cut by the Alpha in the area shown, but there are numerous crosscutting younger faults that create gaps in both the hanging wall and footwall fault surface maps that must be closed before determining the slip on the Alpha fault. There is no overlap in the geology of the hanging wall and footwall fault surfaces, so the amount of slip exceeds the length of a line in the slip direction across the illustrated view, but a preliminary indication of the slip is ~3–4 km in an easterly direction. Source of information; E. Seedorff et al. (unpub. data). Fault surface maps: Three-dimensional structural reconstructions and their utility in exploration and mining 1193 )LJXUH%3UHOLPLQDU\IDXOWVXUIDFHPDSVIRUWKH$OSKDIDXOWLQWKH/LEHUW\SLWHDVWRIWKH.DERRQ\IDXOWDQGZHVWRIWKH6XO¿GHIDXOW5RELQVRQGLVWULFW exemplifying characteristics of faults from relatively early fault generations. (A) Footwall; (B) hanging wall. The locations of good geologic control are shown by intensely colored dots (drill hole piercements). Other attributes are as described for Figure 6 and in the text. There are no older faults cut by the Alpha in the area shown, but there are numerous crosscutting younger faults that create gaps in both the hanging wall and footwall fault surface maps that must be closed before determining the slip on the Alpha fault. There is no overlap in the geology of the hanging wall and footwall fault surfaces, so the amount of slip exceeds the length of a line in the slip direction across the illustrated view, but a preliminary indication of the slip is ~3–4 km in an easterly direction. Source of information; E. Seedorff et al. (unpub. data). 1194 Eric Seedorff, Carson A. Richardson, and David J. Maher KDQJLQJZDOORIWKH$OSKDIDXOWGH¿QHDVPDOOV\QFOLQH)LJXUH 6b). The fold is likely is a synextensional Tertiary fold formed E\VXEVLGHQFHRIWKHKDQJLQJZDOORIWKHFRQFDYHZHVW6XO¿GH East fault because the syncline roughly corresponds to a trough LQWKHIDXOWVXUIDFHDQGSOXQJHVWRZDUGWKH6XO¿GH(DVWIDXOW Single stratigraphic units are widespread in both the footwall and hanging-wall fault surface maps of the Alpha fault (Figure 6). Bedding in the footwall dips ~20–30°SW (Figure 6a), and bedding in the hanging wall dips ~35°NE to ~35°SE (Figure 6b). The dip of the Alpha fault is moderate to subhorizontal; hence, the angle between bedding and the fault is a small to moderate angle. The following three geologic scenarios conceivably are consistent with small to moderate bedding-to-fault angles. (1) The Alpha fault formed initially as a Tertiary, highangle normal fault but cut bedding in Paleozoic rocks at a low angle because bedding was rotated to moderate or high angles by Mesozoic contractional folding. The strike of the later fault also would have been subparallel to the trend of the fold axis, and the limb of the fold was steep enough such that the fault was subparallel to bedding over distances comparable to the area of Figure 6. (2) The Alpha fault formed initially as a high-angle normal fault but cut bedding at low to moderate angles because bedding was tilted to high angles by movement on one or more earlier normal faults. (3) The Alpha fault formed initially as a low-angle normal fault but Paleozoic rocks were gently dipping because Mesozoic contractional deformation produced open folds; thus the Alpha fault cut bedding in Paleozoic rocks at low to moderate angles. This question remains unresolved pending completion of a compelling three-dimensional structural reconstruction of the district, but district and regional-scale geologic considerations suggest that hypothesis (2) is most likely and that hypothesis (3) is least likely. The distribution of rock/alteration units coupled with bedding orientations in the footwall and hanging-wall maps for the Alpha fault indicates that there is no overlap between the two fault surface maps. Note that the hanging wall map contains mostly Permian Rib Hill Sandstone (variably altered to silica-pyrite) and virtually no porphyry (Figure 6b), whereas the footwall consists of an east-west trending band of sericitically altered porphyry, > 300 m wide, bordered both to the north and south by ~300-m wide zones of silica-pyrite alteration of Pennsylvanian Ely Limestone, grading outward to weaker alteration and eventually into other rock units (Figure 6a). Therefore, the Alpha fault has moved a volume of rock that formed somewhat outside the porphyry system and translated it down on the intensely altered, centrally located but high-level part of the porphyry copper system. The magnitude of slip on the Alpha fault must exceed the length of a line in the slip direction across the illustrated view, i.e., the magnitude of slip exceeds one km. Alignment of the southwesterly dipping stratigraphic contact between the Rib Hill Sandstone and Riepe Spring Limestone in the footwall with the same contact in the hanging wall suggests that there is ~3–4 km of slip in an easterly direction on the Alpha fault. Fault surfaces in a near-tip setting Figure 7 shows preliminary fault surface maps for the Liberty fault. The Liberty fault illustrates characteristics of fault surface maps in the near-tip environment, including a major rotational component of the hanging wall relative to the footwall. Like the Dexter fault, the Liberty fault is also relatively young—indeed even younger than the Dexter—so it also shows characteristics of other young faults. The Liberty fault is a northeast-striking, southeast-dipping normal fault that is exposed for ~1000 m of strike length on the eastern end of the Liberty pit (Figures 4 and 7). Two vintages of reliable geologic maps are available for this region of the pit, one spatially offset from the other by mining progress; very thick colored lines show the rock/alteration types along the two mapped traces of the fault (Figure 7). Intensely colored dots show the logged geology of drill hole piercements, which are relatively few because the fault is relatively steep (requiring a deep hole to penetrate it) and the copper grade drops quickly with depth (obviating the need to drill many holes for ore delineation in this area). Because of the presence of a block cave mine nearby, the Liberty fault was crossed by underground drifts on the 6560 ft level south of 104,000N, in which the location of the Liberty fault was mapped (locations not shown because of lack of corresponding data on rock/alteration types). Fault locations at that elevation improve the control on structure contours along most of the illustrated portion of the fault, which must continue further to the northeast. The southwestern tip of the Liberty fault was mapped (unpublished 1958 Liberty pit map, Geology Department, Nevada Mines Division, Kennecott Copper Corporation), with the fault ending in a horsetail of small faults. Continuations of the Liberty fault to the southwest of the tip are shown on some maps (e.g., Spencer, 1917), but careful attempts to trace the fault VRXWKZHVWZDUGLQWKH¿HOGDQGWRGRFXPHQWFRPSHOOLQJRIIVHWV in geologic markers (after accounting for other faults in the DUHDLQGULOOKROHVFRQ¿UPWKDWWKHIDXOWWHUPLQDWHVZLWKLQWKH pit as originally mapped and shown on Figure 7. The Liberty fault picks up displacement northeastward, cutting and offsetting the Eureka fault immediately northeast of the northern rim of the Liberty pit (Figure 7). Measurements on the dip of the Liberty fault range from 45° to 70°SE (Figure 7). The steepest dips are near the southwestern termination of the fault, whereas to the northeast, over the rest of its exposed length, typical dips are about 50° (Figure 7). The main Liberty fault has a nearly linear trace, but it has a concave southeast footwall splay and a north-striking, concave southeast, scooped-shaped hanging wall splay within ~600 m of its southwestern tip. The Liberty Footwall Splay fault is subparallel to the main fault but is more irregular in strike and dips 65° to the southeast (not shown); the branch-line with the main Liberty fault (i.e., where the Footwall Splay joins with the main fault) is shown on the footwall geologic map (Figure 7a). The Liberty Hanging Wall Splay fault, in contrast, swings abruptly Fault surface maps: Three-dimensional structural reconstructions and their utility in exploration and mining 1195 Figure 7A. Preliminary fault surface maps for the Liberty fault on the eastern end of the Liberty pit, Robinson district, illustrating characteristics of fault surface maps in the near-tip environment, including a major rotational component of the hanging wall relative to the footwall. (A) Footwall; (B) hanging wall. The locations of reliable geologic control for these maps are shown by intensely colored dots (drill hole piercements) and by very thick colored lines (the mapped trace of the fault on two vintages of geologic maps during mining). Other attributes are as described for Figure 6 and in the text. The southwestern end of the Liberty fault was mapped within the Liberty pit. The measured dips indicate that the fault dips to the southeast at moderate to steep angles; some of the dip orientations near the southwestern tip of the Liberty fault are measured on small horsetails (not shown) off the main fault. Branch lines show how hanging-wall and footwall splays joint with the main Liberty fault. There is no slip at the tip at the southwestern end of the fault; farther to the northeast, geologic interpretations require further PRGL¿FDWLRQWRUH¿QHWKHDPRXQWDQGGLUHFWLRQRIVOLSRIYDULRXVSLHUFLQJSRLQWVDORQJWKHIDXOWVXUIDFH1RQHWKHOHVVRIIVHWVLQWKHFLUFXODUUHIHUHQFHSRLQWVDWWKH northeastern end of the map indicate that the hanging wall point moved 227 m in the plane of the fault in a S40E direction relative to the footwall, producing a horizontal component of clockwise rotation of the hanging wall by ~7° relative to the footwall. Restoring this movement causes the position of the Eureka fault and other geologic markers in the hanging wall to match closely with corresponding markers in the footwall. Source of information; E. Seedorff et al. (unpub. data). 1196 Eric Seedorff, Carson A. Richardson, and David J. Maher Figure 7B. Preliminary fault surface maps for the Liberty fault on the eastern end of the Liberty pit, Robinson district, illustrating characteristics of fault surface maps in the near-tip environment, including a major rotational component of the hanging wall relative to the footwall. (A) Footwall; (B) hanging wall. The locations of reliable geologic control for these maps are shown by intensely colored dots (drill hole piercements) and by very thick colored lines (the mapped trace of the fault on two vintages of geologic maps during mining). Other attributes are as described for Figure 6 and in the text. The southwestern end of the Liberty fault was mapped within the Liberty pit. The measured dips indicate that the fault dips to the southeast at moderate to steep angles; some of the dip orientations near the southwestern tip of the Liberty fault are measured on small horsetails (not shown) off the main fault. Branch lines show how hanging-wall and footwall splays joint with the main Liberty fault. There is no slip at the tip at the southwestern end of the fault; farther to the northeast, geologic interpretations require further PRGL¿FDWLRQWRUH¿QHWKHDPRXQWDQGGLUHFWLRQRIVOLSRIYDULRXVSLHUFLQJSRLQWVDORQJWKHIDXOWVXUIDFH1RQHWKHOHVVRIIVHWVLQWKHFLUFXODUUHIHUHQFHSRLQWVDWWKH northeastern end of the map indicate that the hanging wall point moved 227 m in the plane of the fault in a S40E direction relative to the footwall, producing a horizontal component of clockwise rotation of the hanging wall by ~7° relative to the footwall. Restoring this movement causes the position of the Eureka fault and other geologic markers in the hanging wall to match closely with corresponding markers in the footwall. Source of information; E. Seedorff et al. (unpub. data). Fault surface maps: Three-dimensional structural reconstructions and their utility in exploration and mining southward from the main Liberty fault, forming an easterly facing scoop that dips ~40° east and terminates to the south (not shown); the branch line with the main Liberty is shown on the hanging-wall geologic map (Figure 7b). The offset segments of the older Eureka fault, which occur as a curving line on both the footwall and hanging wall Liberty fault surface geologic maps (Figure 7), provide a geologic marker to restore slip on the southwestern end of the younger Liberty fault. The restoration can be accomplished by rotation of the hanging wall relative to the footwall about a rotation axis near the tip, such that any point in the hanging wall makes an arc UHODWLYHWRWKHIRRWZDOO7KHVOLSGLUHFWLRQLVGH¿QHGE\DYHFWRU that joins the ends of the arc, which is oriented at ~S40°E, and the length of the vector as measured in the plane of the fault, which is the magnitude of slip on the Liberty fault, is ~ 745 ft (~230 m). The horizontal component of clockwise rotation of the hanging wall relative to the footwall is ~7° (Figure 7), or more than three times the amount observed for the Dexter fault (Figure 5). Overview of Yerington district geology The Yerington district, located near the town of Yerington in western Nevada, contains porphyry copper, skarn, and iron-oxide-copper-gold (IOCG) mineralization related to the Middle Jurassic Yerington batholith. Mineralization is hosted in the Yerington batholith and its Triassic to Jurassic wall rocks (Dilles and Wright, 1988; Dilles et al., 2000). The district conWDLQVPXOWLSOHSRUSK\U\FRSSHUFHQWHUVZKLFKDUHFODVVL¿HGDV quartz monzodioritic-granitic porphyry Cu-(Mo) systems in the scheme of Seedorff et al. (2005). The Yerington district has been structurally dismembered and rotated 60 to 90°, primarily by three temporally distinct sets of east-dipping normal faults since ~14 Ma (Proffett, 1977, 1979; Einaudi, 1977; Harris and Einaudi, 1982; Dilles, 1987; Dilles and Einaudi, 1992; Dilles and Gans, 1995; Barton and Johnson, 2000; Dilles et al., 2000). Rocks of the Yerington batholith crop out over an east-west disWDQFHRIa±NP2OLJRFHQHDVKÀRZWXIIVWKDWZHUHGHSRVited horizontally upon a mid-Tertiary erosion surface are now highly tilted (Figure 8), and distinct phases and porphyry dike swarms, associated with a Jurassic batholith, provide abundant markers to aid in reconstruction and indicate the district has been extended more than 150% (Proffett and Proffett, 1976; Proffett and Dilles, 1984; Runyon, 2013). Two-dimensional structural reconstructions led to the discovery of the Ann-Mason deposit by the Anaconda Company (Proffett, 1977; Proffett and Dilles, 1984; Hunt, 2004). Recent drilling and exploration has further expanded the availability of data in three dimensions and has allowed a 3-D reconstruction of the Ann-Mason and Blue Hill area (Richardson, 2014; Richardson and Seedorff, this volume). Fault surface maps provide a PHDQVWRUH¿QHWKHORFDWLRQRIH[SORUDWLRQWDUJHWV,QDUHDVVXFK as Yerington where there are multiple discrete porphyry dike swarms, fault surface maps and associated reconstructions also allow one to test questions such as whether mineralization on 1197 two sides of a fault were contiguous prior to faulting. Both of these possibilities can be addressed at Ann-Mason. Ann-Mason deposit The Ann-Mason deposit is a porphyry Cu-(Mo) deposit associated with a swarm of granite porphyry dikes that presHQWO\ VWULNH DW a1: DQG GLS 1 EXW LQ SUHWLOW FRQ¿JXration would have had a strike of ~N35°W and dipped ~90° (Dilles, 1987; Dilles and Proffett, 1995; Dilles et al., 2000). The ÀDQNVWRSDQGERWWRPRIWKHK\GURWKHUPDOV\VWHPDUHH[SRVHG in the Ann-Mason fault block in the Singatse Range (Dilles and Einaudi, 1992), as well as in the Buckskin Range to the west (Lipske and Dilles, 2000; Dilles et al., 2000). The main part of the Ann-Mason deposit is bound by two gently east-dipping faults: the deposit is located in the footwall of the Singatse fault and in the hanging wall of the Blue Hill fault (Figure 8). In addition, the deposit is cut by other, more steeply dipping faults. Exploration opportunities exist in each place where the deposit potentially is truncated by post-mineral faults. Lateral continuations across fault blocks As described above, the Ann-Mason ore body is truncated above by the Singatse fault (Figure 8). The Singatse fault has 3.6 km of slip along its northern exposure and increases to 3.8 km of slip along its southern exposure directly above the AnnMason deposit (Figure 9) over a distance of 3.8 km (Richardson and Seedorff, this volume). The minimal increase in slip along strike is further constrained by the scoop-like geometry of the Singatse fault, which limits the viable structural interpretations, as large rotations involving north-south components would require much larger strains on the wall rocks (e.g., Needham et al., 1996). The outermost limits of the Ann-Mason ore body are projected to the footwall surface of the Singatse fault (Figure 9), and the outline of the Ann-Mason ore body in the hanging wall of the Singatse fault represents a potential exploration target. The two generations of faults that postdate the Singatse fault complicate the exercise, as these create gaps in the fault surface maps (Figure 9) that have to be closed before reconstructing the Singatse fault. These younger faults also dismember the outline of the Ann-Mason ore body and generate a smaller target on the HDVWHUQÀDQNVRIWKH6LQJDWVH5DQJHLQWKHKDQJLQJZDOOVRIWKH Singatse fault and a younger, crosscutting fault, such that the bulk of the hanging-wall projection is located directly beneath the abandoned pit of the Yerington mine (Figure 9). The presence of the hanging-wall fragment of the Ann-Mason deposit beneath the Yerington mine is somewhat coincidental and does not indicate that the Ann-Mason deposit is related to the Yerington system; instead, each deposit is associated with separate, narrow dike swarms (each ~2 km in thickness) that dip 45° N. The northern-most limit of the Ann-Mason fragment in the hanging wall of the Singatse fault projects ~1.8 km SSW of the Yerington pit at the modern surface. Figure 8. Bent cross section through the Yerington district, oriented approximately east-west, looking north. Adapted from cross section A-Ac of Proffett and Dilles (1984). 1198 Eric Seedorff, Carson A. Richardson, and David J. Maher Figure 9. Geologic fault surface map for the hanging wall of the Singatse fault, showing closure of gaps created by younger faults. The Singatse fault is cut by faults of two younger generations of faults. (a) Map prior to closure of gaps created by the younger, crosscutting normal faults. (b) Map after closure of gaps. Arrows show displacement directions based on restoration of hanging wall map on top of footwall map (not shown). From Richardson and Seedorff, this volume. Fault surface maps: Three-dimensional structural reconstructions and their utility in exploration and mining 1199 1200 Eric Seedorff, Carson A. Richardson, and David J. Maher Likewise, the Ann-Mason ore body is truncated at depth by the Blue Hill fault (Figure 8), and there is mineralized rock that crops out on the footwall side of the Blue Hill fault, known as the Blue Hill deposit. Although Dilles and Proffett (1995, Figure 1) present a reconstruction that suggests that both deposits originated in the same porphyry dike swarm, most of the data WKDWZHUHXVHGWRJHQHUDWHWKH¿JXUHLVXQSXEOLVKHG5LFKDUGson and Seedorff (this volume) test that hypothesis using fault VXUIDFHPDSVZLWKWKHEHQH¿WRIGDWDGHULYHGIURPKROHVGULOOHG E\(QWUpH*ROGPRUHUHFHQWO\DQGFRQ¿UPWKDWWKHSURMHFWLRQ of the Ann-Mason dike swarm down to the Blue Hill fault does indeed restore directly over the Blue Hill deposit and its associated dikes (Richardson and Seedorff, this volume). Thus, the Blue Hill and the Ann-Mason deposits are genetically linked, and Blue Hill indeed can be thought of, in pre-tilt position, as the lateral continuation of the Ann-Mason porphyry system (Dilles and Proffett, 1995). Another swarm of porphyry dikes is present south of the Ann-Mason dike swarm, and it could be associated with another center of porphyry mineralization, for which a few exploration holes have been drilled. This target is known variously as Yerington West and Roulette (see Richardson and Seedorff, this volume). The viability of this center as an exploration target will be advanced by further delineation of the geology of the Blue Hill fault surface. As the Yerington district example demonstrates, fault surface maps provide an opportunity to generate exploration targets by transferring tightly constrained interpretations of the geology across faults to where there may be little or no known information, thereby making better informed decisions about EURZQ¿HOGVH[SORUDWLRQIRUIDXOWRIIVHWIUDJPHQWV mum displacement along strike (Elliott, 1983). The slip vector at the point of maximum displacement represents the bisector between the two fault tips, also known as Elliott’s (1976) “bow and arrow” rule. Structural features plotted should be observDEOHLQWKH¿HOGLQVHLVPLFUHÀHFWLRQVDQGRULQGULOOFRUHZLWK structural styles shown on the section matching those observed on the ground, e.g., chevron and box folds not plotted as concentric folds (Woodward et al., 1989). Where data are sparse, data from out of the cross section can be projected down plunge (Mackin, 1950) into the cross section to provide additional constraints. Reconstructions should aim to conserve volume, which, with various simplifying assumptions, in 2-D translates to conserving bed length and unit thickness (Dahlstrom, 1969; Groshong, 1994; Judge and Allmendinger, 2011), as well as be strain-compatible, geometrically valid, and internally consistent (Woodward et al., 1986; Buchanan, 1996). In sets of serial cross sections, where one is attempting to assess changes along strike, the amount of slip on any one fault between two closely neighboring cross sections should not differ greatly nor should there be changes in structural style; whereas, over longer distances across the fault system, displacement is transferred from one fault to another (Dahlstrom, 1969). These 2-D reconstructions show an amount of slip that is determined by the choice of a line of cross section. Faults have points of zero displacement at the tips and a point of maximum displacement between them; between the point of maximum displacement and the tips, the hanging wall should be rotating about a vertical axis relative to the footwall. Additionally, the line of section may cross multiple, superimposed fault generations with differing slip directions, where material will be moving in and out of the one, chosen line of section, making it unrestorable. The necessity for a more 3-D approach to strucDISCUSSION tural reconstruction becomes apparent in the Robinson district. Strata dip moderately west in the western part of the Robinson Contrasting perspectives between 2-D and 3-D structural district, but strata dip moderately to steeply east in the central reconstructions and eastern parts of the district. Thus rigid-body 2-D cross-sectional structural reconstructions cannot untilt strata on one side Over the last half-century, rules and guides have been de- of the district without increasing the degree of tilting on the veloped that govern 2-D, cross-sectional reconstructions to test opposite side of the district. A restoration of the tilting of beds interpretations, either validating or dismissing them. This work cannot be achieved solely by rotations about horizontal axes. was developed in contractional settings and have been widely Although horizontal-axis rotations characterize normal faults, used in fold and thrust belts (e.g., Bally et al., 1966; Dahlstrom, an important component of vertical-axis rotation occurs near 1969; Mitra, 1992; Wilkerson and Dicken, 2001), but cross- tips. The abundant 3-D geologic data available in the Robinsectional reconstructions also have been applied in settings of son district, as depicted in the fault surface maps shown here, continental extension (e.g., Proffett, 1977; Gibbs, 1983, 1984; UHTXLUHVVLJQL¿FDQWFRPSRQHQWVRIYHUWLFDOD[LVURWDWLRQIRUWKH Wernicke et al., 1988; Smith et al., 1991; Seedorff, 1991; Col- Liberty fault and non-trivial components for other faults. The gan et al., 2008; Nickerson et al., 2010). In the petroleum in- importance of vertical-axis rotations in the Robinson district is GXVWU\WKHLQWHQWRISHUIRUPLQJWKLVWHGLRXVSURFHVVLV¿UVWWR consistent with the fact that strata within the central Egan Range test targets conceptually before spending money, in an attempt commonly strike 20–50° from due north, which contrasts with to avoid drilling dry holes. Faults can affect not only the forma- strikes observed north and south of the accommodation zone tion of the trap, but also the migration path of hydrocarbons where typical strikes are northerly. (Buchanan, 1996). The technique described here, though not a volumetric Cross sections are typically constructed parallel to the restoration, restores a 2-D image of the hanging wall against a principal slip direction, preferably nearest to the point of maxi- 2-D image of its footwall and captures the third dimension via Fault surface maps: Three-dimensional structural reconstructions and their utility in exploration and mining structure contours of the fault surface. The examples offered here demonstrate that fault surface maps are a useful technique for reconstruction. Nonetheless, even this type of 3-D reconstruction may not result in a substantially improved structural interpretation over a 2-D, cross-sectional reconstruction without considerable 3-D geologic control. Asymmetry in amount and familiarity with geologic data used in reconstructions The advancement of science and its practical application depend on making and presenting observations, constructing hypotheses—ideally multiple working hypotheses, and using geological reasoning to test the hypotheses to advance understanding (Chamberlin, 1890; Frodeman, 1995). Although some workers view geologic maps as anachronistic (House et al., 2013), the geologic map remains a fundamental means of presenting geologic observations (Compton, 1985; Barnes and Lisle, 2004), and cross sections and three-dimensional block models are the principal means of presenting geologic interpretations of the map area, especially in the disciplines of structural and economic geology (e.g., Stevens, 2010; Davis et al., 2012). Nonetheless, the basis for these interpretations—the geologic map—contains an underlying element of interpretation (e.g., Coe et al., 2010). A map represents the modern, irregular, two-dimensional surface through a region that evolved both in time and in three-dimensional space. The preserved geology may lack any evidence for certain time intervals; the degree of exposure in the map area may be imperfect; and critical contacts may be poorly exposed at the surface or may exist only at depth. Thus a geologic map constitutes only a working, testable hypothesis, so the impact on structural reconstructions of data derived from maps and other inputs should be displayed explicitly. Many users of structural reconstructions, be they readers of a journal article or managers in an exploration company, may have neither the time nor the interest in evaluating the validity of the interpretation. However, the small fraction of users who have the most interest or have the most at stake in the success or failure in using the reconstruction may want to perform “due diligence” on the reconstruction. These consumers of geologic interpretations in both science and industry, however, are at a distinct disadvantage relative to the geologists who initially offer the structural reconstruction because the users typically have access to only a small fraction of the available data, or the GDWDDUHLQDIRUPWKDWPDNHLWGLI¿FXOWIRUWKHXVHUVWRDVVHVV their quality and to consider and test alternative interpretations. The use of fault surface maps decreases this asymmetry in NQRZOHGJH EHFDXVH IDXOW VXUIDFH PDSV DUH DQ HI¿FLHQW PHDQV of presenting more of the data that constrain the structural reconstructions, as shown in the illustrations above. This has VHYHUDOLPSRUWDQWVFLHQWL¿FFRQVHTXHQFHV)LUVWLWKHOSVSHUPLW the reader (and earlier reviewers and editors) to evaluate better whether the reconstruction is potentially valid geologically and 1201 geometrically. Second, it makes it easier for the less informed user to generate alternative hypotheses with the same data set, LQFOXGLQJ FRPSHWLQJ UHFRQVWUXFWLRQV )LQDOO\ LW LV PRUH GLI¿cult for geologists who are less disposed to accept the interpretation resulting from a compelling reconstruction to reject the interpretation, because it is apparent to readers that the interpretation is indeed well supported by a rich body of data. Hence it becomes incumbent on the skeptics to develop an alternative that is at least as viable. As a result, the improved transparency in reconstructions is a feature of fault surface maps that makes them an appealing alternative to 2-D reconstructions even where 3-D data are sparse. Exploration in 3-D The areas where the concepts of palinspastic structural reconstruction have been applied to district-scale exploration programs, such as San Manuel-Kalamazoo, Arizona (Lowell, 1968; Lowell, 1991) and the Yerington district, Nevada (Proffett, 1977; Proffett and Dilles, 1984), are locales where the faults with major displacement tend to have similar strike directions. Hence, 2-D reconstructions using cross sections are accurate and effective means of structural reconstruction, and the Ann-Mason examples shown here are a by-product of exSORUDWLRQWKDWEHQH¿WWHGIURP'VWUXFWXUDOUHFRQVWUXFWLRQV,Q areas with more complicated extensional faulting, however, a 3-D approach is especially valuable, both to aid visualization of the structure and to calculate the amounts and directions of slip more rigorously. The Robinson district is one of those regions with complex geometries of crosscutting normal faults (Seedorff et al., WKDWEHQH¿WVPRVWIURP'UHFRQVWUXFWLRQV,QGHHGWKH reason that a 3-D structural reconstruction of normal faulting in the Robinson district became a long-term goal for the Robinson project was to assess whether the district had any remaining exploration potential. So many holes had been drilled in the Robinson district (>10,000) that its potential for growth in ore reserves appeared to have been exhausted, save for favorable changes in metal prices and production costs. Without a rigorous, geologically defensible 3-D reconstruction, however, LW ZRXOG EH GLI¿FXOW WR DVVHVV WKH SRVVLELOLW\ WKDW PDWHULDO DW minable grades and depths remains to be located. A 3-D model could show the preserved and eroded portions of fault blocks and the volumes of ore-grade material that was known (mined out or in place) or that could reasonably be inferred. Restoration RI D IDXOW RU IDXOWV WKDW LGHQWL¿HV WKH SURMHFWLRQ RI SUHVHUYHG ore-grade material within an undrilled fault block would signify an area that would be especially prospective for mine-site exploration. Thus, 3-D reconstructions are valuable both in grass roots H[SORUDWLRQDQGLQEURZQ¿HOGVH[SORUDWLRQZKHQDGGUHVVLQJWKH potential of regions that exhibit complex extensional faulting, and fault surface maps are useful for achieving these 3-D reconstructions. 1202 Eric Seedorff, Carson A. Richardson, and David J. Maher Future developments Many characteristics of faults described here cannot be readily incorporated into reconstructions without use of computer software; however, these characteristics are currently not well accommodated in the algorithms of commercially available structural reconstruction software programs. For example, neither non-rigid, synkinematic deformation related either to ÀH[XUDOFROODSVHRIWKHKDQJLQJZDOODQGUHERXQGRIWKHIRRWwall (Kusznir and Ziegler, 1992) nor along-strike changes in WKHGLVSODFHPHQWSUR¿OH:DOVKDQG:DWWHUVRQDUHLQFRUporated easily. Indeed, the use of fault surface maps as inputs for restoration into computer software also is not readily incorporated. In the meantime, structural reconstructions of fault surface maps with adequate accuracy can be achieved manually or with standard drafting software. whether the reconstruction is valid and robust. Reconstructions can play an important role in exploration for and exploitation of ore deposits, and the use of fault surface maps can facilitate a more three-dimensional approach to mineral exploration, especially in complexly faulted regions such as certain parts of the Basin and Range province. ACKNOWLEDGMENTS Two of us (ES, DJM) started working on fault surface maps in the early to mid-1990s at the Robinson project while owned by Magma Copper Company. We appreciate discussions over the years with many people regarding fault surface maps and the geology of the Robinson deposit with Pat Fahey, Steve Shaver, Dick Breitrick, Rich Hasler, Richard Jeanne, Larry James, and the mine and exploration staffs of Magma, BHP, Quadra, QuadraFNX, and KGHM International, includCONCLUSIONS ing Bridget Ball, Jim Biggs, Randal Burns, and Judd Fee. We WKDQN4XDGUDIRU¿QDQFLDOVXSSRUWRIVRPHRIWKHZRUNWKDWOHG Three-dimensional reconstructions of faults can be made WRWKLVFRQWULEXWLRQWKURXJKWKHJRRGRI¿FHVRI3DW)DKH\(Qwith fault surface maps, which are plan-view projections of the trée Gold sponsored CAR’s M.S. research and provided access geology of the footwall and hanging-wall surfaces of a fault. A to drill data in the Ann-Mason area of the Yerington district. We four-layer strategy is used to develop fault surface maps. The especially thank Tom Watkins and Norm Page of Entrée Gold UHVXOWVFDQEHSUHVHQWHGHI¿FLHQWO\KRZHYHULQWZRSDQHOVWKDW for their support and assistance. Over the years we value the display interpretations of the geology of the hanging wall and discussions about the geology of the Yerington district that we footwall overlain on structure contours, as well as the sources have had with John Dilles, Marco Einaudi, John Proffett, Mark of geologic data for each panel—usually lines from geologic Barton, and David Johnson, and more recently with Hank Ohmaps and points from drill hole piercements. Older faults will lin, Korin Carpenter, and Simone Runyon. We thank Daniel A. show as lines on fault surface maps of younger faults. In con)DYRULWRIRUKLVKXJHDVVLVWDQFHE\GUDIWLQJVRPHRIWKH¿JXUHV trast, younger normal faults produce gaps in the fault surfaces The many people who have challenged our interpretations of of older faults, and the gaps widen in the direction of increasing normal faults in places such as Robinson have helped motivate displacement or decreasing dip of the crosscutting fault. XVWRUH¿QHWKHPHWKRGSUHVHQWHGKHUHDVDPHDQVRIGHPRQThe movement of a fault is restored by matching the geostrating the geologic constraints by which we all seemingly logic map of the hanging wall with the geologic map of the will have to abide. We highly appreciate the detailed comments footwall. Where there are adequate geologic markers and threereceived from formal and informal reviewers alike, Sean P. dimensional control, numerous slip vectors across the fault surLong, Steven H. Lingrey, and Steven A. Shaver, each of whom face result from the restoration, from which the magnitude of brought the differing perspectives of someone with a tectonics slip in the plane of the fault can be calculated for each vector. and structural reconstruction background, a structural geology In a given area, the type of movement exhibited by the fault specialist in the petroleum industry, and an economic geologist depends in part on whether the portion of a normal fault bewho is familiar with the Robinson and Yerington districts and ing restored is near or far from either tip of the fault; near-tip experienced in structural reconstructions of mineral deposits, regions commonly display an important rotational component respectively. of movement, but mid-fault regions are dominated by downdip translation. Additional geologic constraints are required to determine the amount of tilting that occurred concurrent with REFERENCES slip. Three-dimensional structural reconstructions of areas are achieved by stepwise repetition of the process from youngest Allan, U.S., 1989, Model for hydrocarbon migration and entrapment within faulted structures: American Association of Petroleum Geologists Bulto oldest faults. letin, v. 73, p. 803–811. Areas of complex geology containing multiple generations Anders, M.H., and Schlische, R.W., 1994, Overlapping faults, intrabasin highs, RIIDXOWVZLWKGLIIHULQJVOLSGLUHFWLRQVHVSHFLDOO\EHQH¿WIURPWKH and the growth of normal faults: Journal of Geology, v. 102, p. 165–180. use of fault surface maps for three-dimensional reconstructions. Badgley, P.C., 1959, Structural methods for the exploration geologist and a seNonetheless, fault surface maps are effective even in areas of ries of problems for structural geology students: New York, Harper and less complex faulting at portraying the locations and types of Brothers, 280 p. three-dimensional geologic controls, which aids in assessing Bally, A.W., Gordy, P.L., and Stewart, G. A., 1966, Structure, seismic data, and Fault surface maps: Three-dimensional structural reconstructions and their utility in exploration and mining orogenic evolution of southern Canadian Rocky Mountains: Bulletin of Canadian Petroleum Geology, v. 14, p. 337–381. Barnes, J.W., and Lisle, R.J., 2004, Basic geological mapping, 4th edition: Chichester, John Wiley and Sons, Ltd., 184 p. Barnett, J.A.M., Mortimer, J., Rippon, J.H., Walsh, J.J., and Watterson, J., 1987, Displacement geometry in the volume containing a single normal fault: American Association of Petroleum Geologists Bulletin, v. 71, p. 925–937. Barton, M.D., and Johnson, D.A., 2000, Alternative brine sources for Feoxide(-Cu-Au) systems: Implications for hydrothermal alteration and metals, in Porter, T.M., ed., Hydrothermal iron oxide copper-gold and related deposits—A global perspective: Glenside, South Australia, Australian Mineral Foundation, p. 43–60. Bauer, H.L., Jr., Breitrick, R.A., Cooper, J.J., and Anderson, J.A., 1966, Porphyry copper deposits in the Robinson mining district, Nevada, in Titley, S.R., and Hicks, C.L., eds., Geology of the porphyry copper deposits, southwestern North America: Tucson, University of Arizona Press, p. 232–244. Berg, S.S., and Skar, T., 2005, Controls on damage zone asymmetry of a normal fault zone: Outcrop analyses of a segment of the Moab fault, SE Utah: Journal of Structural Geology, v. 27, p. 1803–1822. Brimhall, G.H, Dilles, J.H., and Proffett, J.M., Jr., 2006, The role of geologic mapping in mineral exploration, in Doggett, M.D., and Parry, J.R., eds., Wealth creation in the minerals industry: Integrating, science, business, and education: Society of Economic Geologists Special Publication 12, p. 221–241. Buchanan, J.G., 1996, The application of cross-section construction and validation within exploration and production: A discussion, in Buchanan, P. G., and Nieuwland, D. A., eds., Modern developments in structural interpretations, validation and modeling: Geological Society of London Special Publication 99, p 41–50. Buck, W.R., 1988, Flexural rotation of normal faults: Tectonics, v. 7, p. 959– 973. Caine, J.S., Evans, J.P., and Forster, C.B., 1996, Fault zone architecture and permeability structure: Geology, v. 24, no. 11, p. 1025–1028. &DUWZULJKW-$0DQV¿HOG&DQG7UXGJLOO%'7KHJURZWKRIQRUPDO faults by segment linkage, in Buchanan, P.G., and Nieuwland, D.A., eds., Modern developments in structural interpretation, validation and modelling: Geological Society of London Special Publications 99, p. 163–177. Chamberlin, T.C., 1890, The method of multiple working hypotheses: Science, v. 15, no. 366, p. 92–96. Childs, C., Watterson, J., and Walsh, J.J., 1995, Fault overlap zones within developing normal fault systems: Geological Society of London Journal, v. 152, p. 535–549. &RH$/$UOHV7:5RWKHU\'$DQG6SLFHU5$*HRORJLFDO¿HOG techniques: London, Wiley-Blackwell and The Open University, 336 p. Colgan, J.P., John, D.A., Henry, C.D., and Fleck, R.J., 2008, Large-magnitude Miocene extension of the Eocene Caetano caldera, Shoshone and Toiyabe Ranges, Nevada: Geosphere, v. 4, no. 1, p. 107–130. Colgan, J.P., Howard, K.A., Fleck, R.J., and Wooden, J.L., 2010, Rapid middle 0LRFHQHH[WHQVLRQDQGXQURR¿QJRIWKHVRXWKHUQ5XE\0RXQWDLQV1Hvada: Tectonics, v. 29, no. 6, TC6022, doi:10.1029/2009TC002655. &RPSWRQ55*HRORJ\LQWKH¿HOG1HZ<RUN:LOH\S Cowie, P.A., and Scholz, C.H., 1992, Displacement-length scaling relationship for faults: Data synthesis and discussion: Journal of Structural Geology, v. 14, p. 1149–1156. Crider, J. G., and Peacock, D. C. P., 2004, Initiation of brittle faults in the upper FUXVW$UHYLHZRI¿HOGREVHUYDWLRQV-RXUQDORI6WUXFWXUDO*HRORJ\Y 26, p. 691–707. Crider, J.G., and Pollard, D.D., 1998, Fault linkage: Three-dimensional me- 1203 chanical interaction between echelon faults: Journal of Geophysical Research, v. 103, p. 24,373–24,391. Dahlstrom, C.D.A., 1969, Balanced cross sections: Canadian Journal of Earth Sciences, v. 6, p. 743–757. d’Alessio, M.A., and Martel, S.J., 2004, Fault terminations and barriers to fault growth: Journal of Structural Geology, v. 26, p. 1885–1896. Davis, G.H., 1983, Shear-zone model for the origin of metamorphic core complexes: Geology, v. 11, p. 342–347. Davis, G.H., and Coney, P.J., 1979, Geologic development of the Cordilleran metamorphic core complexes: Geology, v. 7, p. 120–124. Davis, G.H., Constenius, K.N., Dickinson, W.R., Rodríguez, E.P., and Cox, L.J., 2004, Fault and fault-rock characteristics associated with Cenozoic extension and core-complex evolution in the Catalina-Rincon region, southeastern Arizona: Geological Society of America Bulletin, v. 116, p. 128–141. Davis, G.H., Reynolds, S.J., and Kluth, C.F., 2012, Structural geology of rocks and regions, 3rd Edition: New York, John Wiley and Sons, 839 p. Dawers, N.H., and Anders, M.H., 1995, Displacement-length scaling and fault linkage: Journal of Structural Geology, v. 17, p. 607–614. Dawers, N.H., Anders, M.H., and Scholz, C.H., 1993, Growth of normal faults: Displacement-length scaling: Geology, v. 21, p. 1107–1110. Dilles, J.H., 1987, Petrology of the Yerington batholith, Nevada: Evidence for HYROXWLRQRISRUSK\U\FRSSHURUHÀXLGV(FRQRPLF*HRORJ\YS 1750–1789. Dilles, J.H., and Einaudi, M.T., 1992, Wall-rock alteration and hydrothermal ÀRZSDWKVDERXWWKH$QQ0DVRQSRUSK\U\FRSSHUGHSRVLW1HYDGD²$ 6-km vertical reconstruction: Economic Geology, v. 87, p. 1963–2001. Dilles, J.H., and Gans, P.B., 1995, The chronology of Cenozoic volcanism and deformation in the Yerington area, western Basin and Range and Walker Lane: Geological Society of America Bulletin, v. 107, p. 474–486. Dilles, J.H., and Proffett, J.M., Jr., 1995, Metallogenesis of the Yerington batholith, Nevada, in Pierce, F.W., and Bolm, J.G., eds., Porphyry Copper Deposits of the American Cordillera: Arizona Geological Society Digest 20, p. 306–315. Dilles, J.H., and Wright, J.E., 1988, The chronology of early Mesozoic arc magmatism in the Yerington district, Nevada, and its regional implications: Geological Society of America Bulletin, v. 100, p. 644–652. Dilles, J.H., Einaudi, M.T., Proffett, J.M., Jr., and Barton, M.D., 2000, Overview of the Yerington porphyry copper district: Magmatic to nonmagPDWLF VRXUFHV RI K\GURWKHUPDO ÀXLGV7KHLU ÀRZ SDWKV DQG DOWHUDWLRQ effects on rocks and Cu-Mo-Fe-Au ores, in Dilles, J.H., Barton, M.D., Johnson, D.A., Proffett, J.M., Jr., and Einaudi, M.T., eds., Part I. Contrasting styles of intrusion-associated hydrothermal systems: Society of Economic Geologists Guidebook Series, v. 32, p. 55–66. Einaudi, M.T., 1977, Petrogenesis of the copper bearing skarn at the Mason Valley mine, Yerington district, Nevada: Economic Geology, v. 72, p. 769–795. Elliott, D., 1976, The energy balance and deformation mechanisms of thrust sheets: Royal Society of London Philosophical Transactions, A, v. 283, p. 289–312. Elliott, D., 1983, The construction of balanced cross-sections: Journal of Structural Geology, v. 5, p. 101. Faulds, J. E., and Varga, R. J., 1998, The role of accommodation zones and transfer zones in the regional segmentation of extended terranes, in Faulds, J. E., and Stewart, J. H., eds., Accommodation zones and transfer zones: The regional segmentation of the Basin and Range province: Geological Society of America Special Paper 323, p. 1–45. Fossen, H., 2010, Structural geology: Cambridge, United Kingdom, Cambridge University Press, 463 p. Frodeman, R., 1995, Geological reasoning: Geology as an interpretive and 1204 Eric Seedorff, Carson A. Richardson, and David J. Maher historical science: Geological Society of America Bulletin, v. 107, p. 960–968. Gans, P.B., and Miller, E.L., 1983, Style of mid-Tertiary extension in eastcentral Nevada, in Nash, W.P., and Gurgel, K.D., eds., Geological excursions in the overthrust belt and metamorphic core complexes of the Intermountain region: Utah Geological Mineral Survey Special Studies 59, p. 107–139. Gans, P.B., Miller E.L., McCarthy, J., and Ouldcott, M.L., 1985, Tertiary extensional faulting and evolving ductile-brittle transition zones in the northern Snake Range and vicinity: New insights from seismic data: Geology, v. 13, p. 189–193. Gans, P.B., Seedorff, E., Fahey, P.L., Hasler, R.W., Maher, D.J., Jeanne, R.A., and Shaver, S.A., 2001, Rapid Eocene extension in the Robinson district, White Pine County, Nevada: Constraints from 40Ar/39Ar dating: Geology, v. 29, p. 475–478. Gawthorpe, R.L., and Leeder, M.R., 2000, Tectono-sedimentary evolution of active extensional basins: Basin Research, v. 12, p. 195–218. Gibbs, A.D., 1983, Balanced cross-section construction from seismic sections in areas of extensional tectonics: Journal of Structural Geology, v. 5, p. 153–160. Gibbs, A.D., 1984, Structural evolution of extensional basin margins: Journal of the Geological Society, v. 141, p. 609–620. Gonsior, Z.J., and Dilles, J.H., 2008, Timing and evolution of Cenozoic extensional normal faulting and magmatism in the southern Tobin Range, Nevada: Geosphere, v. 4, p 687–712. Groshong, R.H., Jr., 1989, Half-graben structures: Balanced models of extensional fault-bend folds: Geological Society of America Bulletin, v. 101, p. 96–105. Groshong, R.H., Jr., 1994, Area balance, depth to detachment, and strain in extension: Tectonics, v. 13, p. 1488–1497. Groshong, R.H., Jr., 2006, 3-D structural geology: A practical guide to quantitative surface and subsurface map interpretation, 2nd Edition: Berlin, Springer-Verlag, 400 p. Harris, N.B., and Einaudi, M.T., 1982, Skarn deposits in the Yerington district, Nevada—metasomatic skarn evolution near Ludwig: Economic Geology, v. 77, p. 877–898. +HQU\ &' $VKÀRZ WXIIV DQG SDOHRYDOOH\V LQ QRUWKHDVWHUQ 1HYDGD Implications for Eocene paleogeography and extension in the Sevier hinterland, northern Great Basin: Geosphere, v. 4, p. 1–35. +HQU\&'DQG)DXOGV-($VKÀRZWXIIVLQWKH1LQH+LOO1HYDGD paleovalley and implications for tectonism and volcanism of the western Great Basin, USA: Geosphere, v. 6, p. 339–369. Hodgkinson, K.M., Stein, R.S., and King, G.C.P., 1996, The 1954 Rainbow Mountain-Fairview Peak-Dixie Valley earthquakes: A triggered normal faulting sequence: Journal of Geophysical Research, v. 101, p. 25,459– 25,471. Hopkins, H., 1940, Faulting at the Wright-Hargreaves mine with notes on ground movements: Transactions of the Canadian Institute of Mining and Metallurgy, v. 43, p. 685–707. House, P.K., Clark, R., and Kopera, J. P., 2013, Overcoming the momentum RIDQDFKURQLVP$PHULFDQJHRORJLFPDSSLQJLQDWZHQW\¿UVWFHQWXU\ world, in Baker, V.R., ed., Rethinking the fabric of geology: Geological Society of America Special Paper 502, p. 103–125. Hunt, J.P., 2004, Society of Economic Geologists Silver Medal for 2003 Citation of John M. Proffett: Economic Geology, v. 99, p. 1817–1818. Jackson, J.A., 1987, Active normal faulting and crustal extension, in Coward, M.P., Dewey, J.F., and Hancock, P.L., eds., Continental extensional tectonics: Geological Society of London Special Publication 28, p. 3–17. Jackson, J.A., and White, N.J., 1989, Normal faulting in the upper continental crust: Observations from regions of active extension: Journal of Structural Geology, v. 11, p. 15–36. John, D.A., Henry, C.D., and Colgan, J.P., 2008, Magmatic and tectonic evolution of the Caetano caldera, north-central Nevada: A tilted, mid-Tertiary eruptive center and source of the Caetano Tuff: Geosphere, v. 4, p. 75–106. Judge, P.A., and Allmendinger, R.W., 2011, Assessing uncertainties in balanced cross sections: Journal of Structural Geology, v. 33, p. 458–467. Keeler, D.A., 2010, Structural reconstruction of the Copper Basin area, Battle Mountain district, Nevada: Unpublished M. S. thesis, Tucson, University of Arizona, 92 p. Kim, Y.-S., Peacock, D.C.P., and Sanderson, D.J., 2004, Fault damage zones: Journal of Structural Geology, v. 26, p. 503–517. Kloppenburg, A., Grocott, J., and Hutchinson, D., 2010, Structural setting and synplutonic fault kinematics of a Cordilleran Cu-Au-Mo porphyry mineralization system, Bingham mining district, Utah: Economic Geology, v. 105, p. 743–761. Kusznir, N.J., and Egan, S.S., 1990, Simple-shear and pure-shear models of extensional sedimentary basin formation: Application to the Jeanne d’Arc basin, Grand Banks of Newfoundland, in Tankard, A.J., and Balkwill, H.R., eds., Extensional tectonics and stratigraphy of the North Atlantic margins: American Association of Petroleum Geologists Memoir 46, p. 305–322. Kusznir, N.J., and Ziegler, P.A., 1992, The mechanics of continental extension DQG VHGLPHQWDU\ EDVLQ IRUPDWLRQ $ VLPSOHVKHDUSXUHVKHDU ÀH[XUDO cantilever model: Tectonophysics, v. 215, p. 117–131. Lipske, J.L., and Dilles, J.H., 2000, Advanced argillic and sericitic alteration in the subvolcanic environment of the Yerington porphyry copper system, Buckskin Range, Nevada, in Dilles, J.H., Barton, M.D., Johnson, D.A., Proffett, J.M., Jr., and Einaudi, M.T., eds., Part I. Contrasting styles of intrusion-associated hydrothermal systems: Society of Economic Geologists Guidebook Series, v. 32, p. 91–99. Lister, G.S., and Davis, G.A., 1989, The origin of metamorphic core complexes and detachment faults formed during Tertiary continental extension in the northern Colorado River region, U.S.A.: Journal of Structural Geology, v. 11, p. 65–94. Lowell, J.D., 1968, Geology of the Kalamazoo orebody, San Manuel district, Arizona: Economic Geology, v. 63, p. 645–654. Lowell, J.D., 1991, How the Kalamazoo was found, in Hollister, V.F., ed., Porphyry copper, molybdenum, and gold deposits, volcanogenic deposits PDVVLYH VXO¿GHV DQG GHSRVLWV LQ OD\HUHG URFN 6RFLHW\ IRU 0LQLQJ Metallurgy, and Exploration, Case Histories of Mineral Discoveries, v. 3, p. 29–30. Mackin, J.H., 1950, The down-structure method of viewing geologic maps: Journal of Geology, p. 55–72. Maher, D.J., 1996, Stratigraphy, structure, and alteration of igneous and carbonate wall rocks at Veteran Extension in the Robinson (Ely) porphyry copper district, Nevada, in Coyner, A.R., and Fahey, P.L., eds., Geology and ore deposits of the American Cordillera: Geological Society of Nevada Symposium, Proceedings, Reno/Sparks, Nevada, April 1995, v. 3, p. 1595–1621. Maher, D.J., 2008, Reconstruction of middle Tertiary extension and Laramide porphyry copper systems, east-central Arizona: Unpublished Ph. D. thesis, University of Arizona, 328 p. Maher, D.J., and Seedorff, E., 2000, Post-mineral structure of the Liberty area, Robinson (Ely) porphyry copper district, White Pine County, Nevada [abs.]: Geological Society of America Abstracts with Programs, v. 32, no. 7, p. A232–A233. Martel, S. J., 1999, Mechanical controls on fault geometry: Journal of Structural Geology, v. 21, p. 585–596. McGrath, A.G., and Davison, I., 1995, Damage zone geometry around fault tips: Journal of Structural Geology, v. 17, p. 1011–1024. McKinstry, H. E., 1948, Mining geology: New York, Prentice Hall, 680 p. Fault surface maps: Three-dimensional structural reconstructions and their utility in exploration and mining Micklethwaite, S., 2011, Fault-induced damage controlling the formation of Carlin-type ore deposits, in Steininger, R.C., and Pennell, W.M., eds., Great Basin evolution and metallogeny: Geological Society of Nevada, Symposium, Reno/Sparks, May 2010, Proceedings, v. 1, p. 221–231. Miller, E.L., Gans, P.B., and Garing, J., 1983, The Snake Range décollement: An exhumed mid-Tertiary ductile-brittle transition: Tectonics, v. 2, p. 239–263. Mitra, G., 1992, Balanced structural interpretations in fold and thrust belts, in Mitra, G., and Fisher, G.W., eds., Structural geology of fold and thrust belts: Baltimore, Johns Hopkins University Press, p. 53–77. Morton, W.H., and Black, R., 1975, Crustal attenuation in Afar, in Pilger, A., and Rösler, A., eds., Afar depression of Ethiopia, International Symposium on the Afar region and related rift problems, Proceedings, Inter8QLRQ&RPPLVVLRQRQ*HRG\QDPLFV6FLHQWL¿F5HSRUW6WXWWJDUW( Schweizerbart’sche Verlagsbuchhandlung, p. 55–65. Muraoka, H., and Kamata, H., 1983, Displacement distribution along minor fault traces: Journal of Structural Geology, v. 5, p. 483–495. Needham, D.T., Yielding, G., and Freeman, B., 1996, Analysis of fault geometry and displacement patterns, in Buchanan, P.G., and Nieuwland, D.A., eds., Modern developments in structural interpretation, validation and modeling: Geological Society of London Special Publication 99, p. 189–199. Nickerson, P.A., Barton, M.D., and Seedorff, E., 2010, Characterization and reconstruction of multiple copper-bearing hydrothermal systems in the Tea Cup porphyry system, Pinal County, Arizona, in Goldfarb, R.J., 0DUVK((DQG0RQHFNH7HGV7KHFKDOOHQJHRI¿QGLQJQHZPLQeral resources: Global metallogeny, innovative exploration, and new discoveries: Society of Economic Geologists Special Publication 15, p. 299–316. Nunns, A.G., 1991, Structural restoration of seismic and geologic sections in extensional regimes: American Association of Petroleum Geologists Bulletin, v. 75, p. 278–297. Peacock, D.C.P., 2002, Propagation, interaction and linkage in normal fault systems: Earth-Science Reviews, v. 58, p. 121–142. Proffett, J.M., Jr., 1977, Cenozoic geology of the Yerington district, Nevada, and implications for the nature and origin of Basin and Range faulting: Geological Society of America Bulletin, v. 88, no. 2, p. 247–266. Proffett, J.M., Jr., 1979, Ore deposits of the western United States—A summary, in Ridge, J.D., ed., Papers on mineral deposits of western North America, The International Association on the Genesis of Ore Deposits, Fifth Quadrennial Symposium, Proceedings, v. II: Nevada Bureau of Mines and Geology Report 33, p. 13–32. Proffett, J.M., Jr., and Dilles, J.H., 1984, Geologic map of the Yerington district, Nevada: Nevada Bureau of Mines and Geology, Map 77, scale 1:24,000. 3URIIHWW-0-UDQG3URIIHWW%+6WUDWLJUDSK\RIWKH7HUWLDU\DVKÀRZ tuffs of the Yerington district, Nevada: Nevada Bureau of Mines and Geology Report 27, 28 p. Richardson, C.A., 2014, Reconstruction of normal fault blocks in the Ann-Mason and Blue Hill areas, Yerington district, Nevada: Unpublished M. S. thesis, Tucson, University of Arizona, 107 p. Richardson, C.A., and Seedorff, E., this volume, Reconstruction of normal fault blocks in the Ann-Mason and Blue Hill areas, Yerington district, Nevada: Geological Society of Nevada, Symposium, Reno/Sparks, May 2015, Proceedings, in press. Roberts, A.M., and Yielding, G., 1994, Continental extensional tectonics, in Hancock, P. L., ed., Continental deformation: Oxford, Pergamon Press, p. 223–250. Runyon, S.E., 2013, Contrasting Fe oxide-rich mineralization in the Yerington district, Nevada: Unpublished M. S. thesis, Tucson, University of Arizona, 94 p. 1205 Schlische, R.W., 1995, Geometry and origin of fault-related folds in extensional settings: American Association of Petroleum Geologists Bulletin, v. 79, p. 1661–1678. Schlische, R.W., and Anders, M.H., 1996, Stratigraphic effects and tectonic implications of the growth of normal faults and extensional basins, in Beratan, K. K., ed., Reconstructing the history of Basin and Range extension using sedimentology and stratigraphy: Geological Society of America Special Paper 303, p. 183–203. Schottenfeld, M. T., 2012, Structural analysis and reconstruction of the southern end of the Pumpkin Hollow deposit, Yerington district, Nevada: Unpublished M. S. thesis, University of Arizona, 50 p. plus unpaginated ¿JXUHVDQGDSSHQGLFHV Seedorff, E., 1991, Magmatism, extension, and ore deposits of Eocene to Holocene age in the Great Basin—Mutual effects and preliminary proposed genetic relationships, in Raines, G.L., Lisle, R.E., Schafer, R.W., and Wilkinson, W.H., eds., Geology and ore deposits of the Great Basin: Geological Society of Nevada, Symposium, Reno/Sparks, April 1990, Proceedings, v. 1, p. 133–178. Seedorff, E., and Maher, D.J., 2002, Overview of the geology of the central Egan Range, in Ehni, W.J., and Faulds, J.E., eds., Detachment and attenuation in eastern Nevada and its application to petroleum exploration: Nevada Petroleum Society Guidebook, v. 17, p. 139–147. Seedorff, E., Hasler, R.W., Breitrick, R.A., Fahey, P.L., Jeanne, R.A., Shaver, S.A., Stubbe, P., Troutman, T.W., and Manske, S.L., 1996, Overview of the geology and ore deposits of the Robinson district, with emphasis on its post-mineral structure, in Green, S.M., and Struhsacker, E.M., eds., Geology and ore deposits of the American Cordillera, Great Basin porphyry deposits: Geological Society of Nevada Field Trip Guidebook Compendium, 1995, Reno/Sparks, p. 87–91. Seedorff, E., Dilles, J.H., Proffett, J.M., Jr., Einaudi, M.T., Zurcher, L., Stavast, W.J.A., Johnson, D.A., and Barton, M.D., 2005, Porphyry deposits: Characteristics and origin of hypogene features, in Hedenquist, J.W., Thompson, J.F.H., Goldfarb, R.J., and Richards, J.P., eds., Economic Geology 100th Anniversary Volume, p. 251–298. Seedorff, E., Barton, M.D., Stavast, W.J.A., and Maher, D.J., 2008, Root zones of porphyry systems: Extending the porphyry model to depth: Economic Geology, v. 103, p. 939–956. Seedorff, E., Barton, M.D., and Takaichi, M.L., this volume, East-west swath of mid-Cretaceous intrusions in east-central Nevada: U-Pb geochronology and metallogeny: Geological Society of Nevada, Symposium, Reno/ Sparks, May 2015, in preparation. Shaver, S.A., and Jeanne, R.A., 1996, The geology and evolution of the weakly Au-(Cu)-mineralized far eastern side of the Robinson mining district, Ely, Nevada, in Coyner, A.R., and Fahey, P.L., eds., Geology and ore deposits of the American Cordillera: Geological Society of Nevada Symposium, Reno/Sparks, April 1995, Proceedings, v. 3, p. 1623–1637. Shaver, S.A., and McWilliams, M.O., 1987, Cenozoic extension and tilting recorded in Upper Cretaceous and Tertiary rocks at the Hall molybdenum deposit, northern San Antonio Mountains, Nevada: Geological Society of America Bulletin, v. 99, no. 3, p. 341–353. Smith, D.L., Gans, P.B., and Miller, E.L., 1991, Palinspastic restoration of Cenozoic extension in the central and eastern Basin and Range province at latitude 39 - 40º N, in Raines, G.L., Lisle, R.E., Schafer, R.W., and Wilkinson, W.H., eds., Geology and ore deposits of the Great Basin: Geological Society of Nevada, Symposium, Reno/Sparks, April 1990, Proceedings, v. 1, p. 75–86. Spencer, A.C., 1917, The geology and ore deposits of Ely, Nevada: U. S. Geological Survey Professional Paper 96, 189 p., map scale 1:30,000. Stavast, W.J.A., Butler, R.F., Seedorff, E., Barton, M.D., and Ferguson, C.A., 2008, Tertiary tilting and dismemberment of the Laramide arc and related hydrothermal systems, Sierrita Mountains, Arizona: Economic Geology, v. 103, p. 629–636. 1206 Eric Seedorff, Carson A. Richardson, and David J. Maher Stevens, R.A., 2010, Mineral exploration and mining essentials: Port Coquitlam, British Columbia, Pakawau GeoManagement Inc., 322 p. Stewart, J.H., 1980, Geology of Nevada: Nevada Bureau of Mines and Geology Special Publication 4, 136 p. Tearpock, D.E., and Bischke, R.E., 2003, Applied subsurface geological mapping: with structural methods, 2nd Edition (e-book): Upper Saddle River, New Jersey, Prentice Hall, 822 p. Thompson, G.A., 1960, Problem of late Cenozoic structure of the Basin Ranges: International Geological Congress, 21st, 1960, Pt. 18, Copenhagen, 1960, p. 62–68. Walsh, J.J., and Watterson, J., 1987, Distribution of cumulative displacement and seismic slip on a single normal fault surface: Journal of Structural Geology, v. 9, p. 1039–1046. Walsh, J.J., and Watterson, J., 1989, Displacement gradients on fault surfaces: Journal of Structural Geology, v. 11, p. 307–316. Walsh, J.J., and Watterson, J., 1991, Geometric and kinematic coherence and scale effects in normal fault systems, in Roberts, A.M., Yielding, G., and Freeman, B., eds., The geometry of normal faults: Geological Society of London Special Publication 56, p. 193–203. Walsh, J.J., Watterson, J., Bailey, W.R., and Childs, C., 1999, Fault relays, bends and branch-lines: Journal of Structural Geology, v. 21, p. 1019–1026. Wernicke, B.P., 1981, Low-angle normal faults in the Basin and Range province: Nappe tectonics in an extending orogen: Nature, v. 291, p. 645– 648. :HUQLFNH %3 DQG %XUFK¿HO %& 0RGHV RI H[WHQVLRQDO WHFWRQLFV Journal of Structural Geology, v. 4, p. 105–115. Wernicke, B.P., Axen, G.J., and Snow, J.K., 1988, Basin and Range extensional tectonics at the latitude of Las Vegas, Nevada: Geological Society of America Bulletin, v. 100, p. 1738–1757. Westaway, R., 1991, Continental extension on sets of parallel faults: Observational evidence and theoretical models, in Roberts, A.M., Yielding, G., and Freeman, B., eds., The geometry of normal faults: Geological Society of London Special Publication 56, p. 143–169. Westaway, R., and Kusznir, N. J., 1993, Fault and bed ‘rotation’ during continental extension: Block rotation or vertical shear? Journal of Structural Geology, v. 15, no. 6, p. 753–770. Westra, G., 1982, Alteration and mineralization in the Ruth porphyry copper deposit near Ely, Nevada: Economic Geology, v. 77, p. 950–970. Wibberley, C.A.J., Yielding, G., and di Toro, G., 2008, Recent advances in the understanding of fault zone internal structure: A review, in Wibberley, C.A.J., Kurz, W., Imber, J., Holdsworth, R.E., and Collettini, C., eds., The internal structure of fault zones: Implications for mechanical and ÀXLGÀRZSURSHUWLHV*HRORJLFDO6RFLHW\RI/RQGRQ6SHFLDO3XEOLFDWLRQ 299, p. 5–33. Wilkerson, M.S., and Dicken, C.L., 2001, Quick-look techniques for evaluating two-dimensional cross sections in detached contractional settings: American Association of Petroleum Geologists Bulletin, v. 85, p. 1759– 1770. Wilkins, J., Jr., and Heidrick, T.L., 1995, Post-Laramide extension and rotation of porphyry copper deposits, southwestern United States, in Pierce, F.W., and Bolm, J.G., eds., Porphyry copper deposits of the America Cordillera: Arizona Geological Society Digest 20, p. 109–127. Wong, M.S., and Gans, P.B., 2008, Geologic, structural, and thermochronologic constraints on the tectonic evolution of the Sierra Mazatán core complex, Sonora, Mexico: New insights into metamorphic core complex formation: Tectonics, v. 27, no. 4, TC4013, doi:10.1029/2007TC002173. Woodward, N.B., Gray, D.R., and Spears, D.B., 1986, Including strain data in balanced cross-sections: Journal of Structural Geology, v. 8, p. 313–324. Woodward, N.B., Boyer, S.E., and Suppe, J., 1989, Balanced geological cross sections: An essential technique in geological research and exploration: Washington, D. C., American Geophysical Union, Short Course in Geology, v. 6, 132 p.
© Copyright 2026 Paperzz