Anal. Chem. 2001, 73, 5875-5885 Capillary Electrophoresis-Electrospray Mass Spectrometry for the Characterization of High-Mannose-Type N-Glycosylation and Differential Oxidation in Glycoproteins by Charge Reversal and Protease/Glycosidase Digestion Tao Liu, Jia-Da Li, Rong Zeng, Xiao-Xia Shao, Ke-Yi Wang, and Qi-Chang Xia* Institute of Biochemistry and Cell Biology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 320 Yue-Yang Road, Shanghai 200031, People’s Republic of China The characterization of high-mannose-type N-glycosylation by capillary electrophoresis-electrospray mass spectrometry (CE-ESI MS) was described. In addition to the use of a cationic noncovalent capillary coating, strong acidic buffer, and charge reversal to increase the glycoform resolving power, N-glycosidase F (PNGase F) combined with a basic protease and r-mannosidase combined with an acidic protease were used to analyze the high-mannosetype N-glycosylation in ribonuclease B (RNase B) and in a novel C-type lectin from the venom of Trimeresurus stejnegeri (TSL). The structures of oligosaccharide, glycosylation sites, and glycoform distributions were determined simultaneously, and the differential oxidation of Met residues in glycopeptides obtained from TSL protease digestion was also characterized successfully by CE-MS/ MS. The results showed that the oligosaccharide attached to RNase B has a structure of GlcNAc2Man5∼9, and that attached to TSL has a structure of GlcNAc2Man5∼8. The glycoform distributions in these glycoproteins are quite different, with the GlcNAc2Man5 type predominant in RNase B, and the GlcNAc2Man8 type, in TSL. This method may be useful not only for the characterization of glycosylation sites and glycan structures, but also for the determination of the relative abundance of individual glycoforms. Glycosylation has long been recognized as one of the most important posttranslational events affecting the functions of proteins in health and disease. The intracellular or intercellular events can be regulated by modifying the glycoform distribution of glycoproteins.1 Differential glycosylation is a major source of protein microheterogeneity.2 However, studies on the structure of glycans are much retarded in comparison with proteins and DNAs. Full structural characterization of glycans requires the defining of branching, linkages, and configurations and the identification of sugar isomers. Furthermore, oligosaccharides can be linked to Ser or Thr residues (O-glycosylation) or to Asn * To whom correspondence should be addressed. Fax: (+86-21) 64333781. E-mail: [email protected]. (1) Dwek, R. A. Science 1995, 269, 1234-1235. (2) Dwek, R. A.; Edge, C. J.; Harvey, D. J.; Wormald, M. R.; Parekh, R. B. Annu. Rev. Biochem. 1993, 62, 65-100. 10.1021/ac0106748 CCC: $20.00 Published on Web 11/08/2001 © 2001 American Chemical Society residues (N-glycosylation), and glycoprotein can have different oligosaccharides attached to any given possible sites, so the analysis of glycoprotein is even more difficult. Fortunately, N-glycosylation normally occurs at the Asn residue in a tripeptide recognition signal Asn-X-Ser/Thr (where X is any amino acid residue except Pro or Asp).3 The N-linked oligosaccharides can be classified into high-mannose, complex, and hybrid types. They all share a common core pentasaccharide structure composed of GlcNAcβ1-4GlcNAcβ1-4ManR1-3Man(R1-6Man) but differ from each other in appending a variable number of different saccharide residues on the pentasaccharide core. High-mannose-type oligosaccharide can have two to nine additional mannose residues linked to the pentasaccharide core by an R-glycosidic bond.3 Thus, it is possible to utilize protease and glycosidase combined digestion to fully define the primary structures of oligosaccharides of this type. Generally, glycoform analysis consists of the separation of intact glycoprotein glycoforms, structural characterization of the released glycan pool, and determination of glycosylation sites and glycoform distribution. In the past decade, methodologies for resolving glycoforms by capillary electrophoresis (CE) were developing rapidly by using basic or borate buffers4-6 or strong acidic buffers in zone electrophoresis mode7,8 or by using different capillary coatings.8-10 Recently, Pacakova et al.11 reported the effects of electrolyte modification and capillary coating on the separation of glycoprotein isoforms by CE. On the other hand, mass spectrometry (MS) has become a powerful tool for the detection of oligosaccharides and glycoconjugates with the invention of “soft ionization” methods, such as electrospray ionization (3) Kornfeld, R.; Kornfeld, S. Annu. Rev. Biochem. 1985, 54, 631-664. (4) Watson, E.; Yao, F. Anal. Biochem. 1993, 210, 389-393. (5) James, D. C.; Freedman, R. B.; Hoare, M.; Jenkins, N. Anal. Biochem. 1994, 222, 315-322. (6) Che, F. Y.; Song, J. F.; Shao, X. X.; Wang, K. Y.; Xia, Q. C. J. Chromatogr. A 1999, 849, 599-608. (7) Wiktorowicz, J. E.; Cloburn, J. C. Electrophoresis 1990, 11, 769-773. (8) Kelly, J. F.; Locke, S. J.; Ramaley, L.; Thibault, P. J. Chromatogr. A 1996, 720, 409-427. (9) Katayama, H.; Ishihama, Y.; Asakawa, N. Anal. Chem. 1998, 70, 52725277. (10) Yeung, B.; Porter, T. J.; Vath, J. E. Anal. Chem. 1997, 69, 2510-2516. (11) Pacakova, V.; Hubena, S.; Ticha, M.; Mad, ra M.; Stulik, K. Electrophoresis 2001, 22, 459-463. Analytical Chemistry, Vol. 73, No. 24, December 15, 2001 5875 (ESI) and matrix-assisted laser desorption/ionization (MALDI). Oligosaccharides can be conveniently characterized by MS either in underivatized form12-15 or in derivatized form.16-18 MS has also been used to characterize glycosylation by peptide mass mapping (PMM)19 or in-source fragmentation.20 In the proteome analysis of glycoforms reported by Packer et al.,21 glycoproteins separated by 2-dimsensional polyacrylamide gel electrophoresis can be characterized in microscale. Reviews on glycoprotein structure determination by MS have been published recently.22-26 On-line coupling of CE to MS (CE-MS) has been proved to be an extremely useful tool for oligosaccharide and glycoprotein characterization. Boss et al.27 reported on the analysis of recombinant human erythropoietin by capillary zone electrophoresis mass spectrometry (CZE-MS). Alternatively, on-line capillary isoelectric focusing-electrospray ionization mass spectrometry (CIEF-ESI-MS) as a 2-dimensional separation system has been applied to the high-resolution analysis of bovine serum apotransferrin glycoforms.28 In this work, we have used dynamic cationic capillary coating, strong acidic buffer, and charge reversal for the separation of glycoforms. According to the suitable pH range of enzymes, N-glycosidase F (PNGase F) and trypsin (or Lys-C protease) or R-mannosidase and Glu-C protease were used in pairs for comparative peptide mass mapping. First, RNase B as a model protein was examined, and then the method was applied to a novel C-type lectin from the venom of Trimeresurus stejnegeri (TSL). Interestingly, the process-induced differential oxidation of Met residues within the TSL was also detected by this method. EXPERIMENTAL SECTION Materials. All chemicals used were of analytical grade if not stated otherwise. Bovine pancreatic RNase B, endoproteinase LysC, R-mannosidase (from Jack Beans), hexadimethrine bromide (Polybrene), dithiothreitol (DTT), iodoacetamide (IAA), formic acid (>99%), and ammonium bicarbonate were purchased from Sigma (St. Louis, MO); HPLC-grade methanol (MeOH) and acetonitrile (ACN) were obtained from Fisher (Fair Lawn, NJ); (12) Kelly, J.; Masoud, H.; Perry, M. B.; Richards J. C.; Thibault, P. Anal. Biochem. 1996, 233, 15-30. (13) Bateman, K. P.; Banoub, J. H.; Thibault, P. Electrophoresis 1996, 17, 18181828. (14) Mechref, Y.; Novotny, M. V. Anal. Chem. 1998, 70, 455-463. (15) Weiskopf, A. S.; Vouros, P.; Harvey, D. J. Anal. Chem. 1998, 70, 44414447. (16) Jeso, B. D.; Liguoro, D.; Ferranti, P.; Marinaccio, M.; Acquaviva, R.; Formisano, S.; Consiglio, E. J. Biol. Chem. 1992, 267, 1938-1992. (17) Okafo, G.; Burrow, L.; Carr, S. A.; Roberts, G. D.; Johnson, W.; Camilleri, P. Anal. Chem. 1996, 68, 4424-4430. (18) Charlwood, J.; Birrell, H.; Gribble, A.; Burdes, V.; Tolson, D.; Camilleri, P. Anal. Chem. 2000, 72, 1453-1461. (19) Tsarbopoulos, A.; Karas, M.; Strupat, K.; Pramanlk, B. N.; Nagabhushan, T. L.; Hillenkamp, F. Anal. Chem. 1994, 66, 2062-2070. (20) Mazsaroff, I.; Yu, W.; Kelley, B. D.; Vath, J. E. Anal. Chem. 1997, 69, 25172524. (21) Packer, N. H.; Pawlak, A.; Kett, W. C.; Gooley, A. A.; Redmond, J. W.; Williams, K. L. Electrophoresis 1997, 18, 452-460. (22) Harvey, D. J. J. Chromatogr. A 1996, 720, 429-446. (23) Reinhold, V. N.; Reinhold, B. B.; Chan, S. Methods. Enzymol. 1996, 271, 377-402. (24) Burlingame, A. L. Curr. Opin. Biotechnol. 1996, 7, 4-10. (25) Rudd, P. M.; Dwek, R. A. Curr. Opin. Biotechnol. 1997, 8, 488-497. (26) Dell, A.; Morris, H. R. Science 2001, 291, 2351-2356. (27) Boss, H. J.; Watson, D. B.; Rush, R. S. Electrophoresis 1998, 19, 26542664. (28) Yang, L.; Tang, Q.; Harrata, A. K.; Lee, C. S. Anal. Biochem. 1996, 243, 140-149. 5876 Analytical Chemistry, Vol. 73, No. 24, December 15, 2001 trifluoroacetic acid (TFA) was purchased from Merck (Schuchardt, Germany); Staphylococcus aureus protease (Glu-C) was obtained from Pierce (Rockford, IL); PNGase F was purchased from Roche (Mannheim, Germany); TPCK-trypsin was made in our laboratory; and all water was distilled and deionized (18 Ω) using a Milli-Q system from Millipore (Bedford, MA). TSL was purified according to the method described by Liang et al.29 Protein Reduction and Alkylation. A 0.2-mg portion of RNase B was dissolved in 80 µL of 30 mM NH4HCO3 buffer (pH 7.8), and 10 µL of 50 mM DTT solution was added. The reaction mixture was incubated for 15 min at 50 °C and cooled to room temperature. A 10-µL portion of 100 mM IAA solution was added, and the reaction was continued for another 15 min at 37 °C in the dark. In the case of TSL, the protein concentration was 1 mg/ mL, and 0.5 M DTT was added to a final concentration of 50 mM. The mixture was reacted for 1 h at 50 °C. IAA (1 M) was added at room temperature to a final concentration of 100 mM. The reaction was continued for another 30 min at 37 °C in the dark. Purification of S-Carboxyamidomethylated Glycoprotein. Alkylated proteins were purified by a HP 1100 reversed-phase HPLC (Palo Alto, CA) using a C8 column (RP-300, 5 µm, 30 mm × 2.1 mm i.d., Applied Biosystems, Foster City, CA). The conditions were as follows: A solution, 0.01% TFA in water; B solution, 0.01% TFA in ACN; flow rate, 200 µL/min; gradient, 0∼2 min, 0% B solution; 2∼15 min, 0∼100% B solution. Protease Digestion. A 100-µg poriton of alkylated protein was dissolved in 100 µL of NH4HCO3 buffer (pH 7.8 for tryptic or Lys-C digestion) or in 100 µL of ammonium acetate buffer (pH 4.0 for Glu-C digestion). A 2.5-µL portion of protease solution (1 µg/µL) was added, and the reaction mixture was incubated at 37 °C for 4 h, then another 2.5 µL of enzyme solution was added for overnight digestion at 37 °C. The digests were kept at -20 °C. Glycosidase Digestion. In PNGase F digestion, 10 µL of a 1 U/µL PNGase F solution was mixed with 90 µL of protease digests, and the mixture was incubated at 37 °C for 4 h. In R-mannosidase digestion, 10 µL of a 0.1 U/µL enzyme solution (containing 3.0 M (NH4)2SO4, 0.1 M ZnSO4, pH 7.5) were mixed with 90 µL of Glu-C digests, and the mixture was incubated at 37 °C for 6 h. The digests were kept at -20 °C. CE-MS. All CE experiments were performed using an eCAP uncoated fused-silica capillary (80 cm × 50 µm I. D., 360 µm O. D.) with an eCAP user-assembled capillary cartridge (Beckman, Fullerton, CA). Dynamic cationic coating was performed basically according to the methods described by Wiktorowicz et al.7 and Kelly et al.8 The capillary was reconditioned by flushing under pressure (138 kPa) with 1 M NaOH (15 min), followed by rinsing with water (5 min), 0.1 M HCl (5 min), and water again (5 min). Then a coating solution, 5% (w/v) Polybrene and 2% (v/v) ethylene glycol, was infused into the capillary for 5 min. Finally, the capillary was rinsed with CE buffer (2 M formic acid) for 5 min. The capillary surface was recoated after each run using the same method. Beckman P/ACE system 5500 was coupled on-line to a Finnigan MAT LCQ electrospray ion trap mass spectrometer (San Jose, CA) via a sheath-liquid interface supplied by Finnigan. The LCQ was tuned by angiotensin (Sigma) and calibrated by infusing an aqueous solution of Ultramark (Finnigan) at a rate of 2 µL/ min. The sheath liquid made up of 60/39/1 (v/v/v) MeOH/water/ (29) Liang, X. L.; Wang, K. Y. Acta Biochem. Biophys. Sin. 1993, 25, 515-521. Figure 1. Summed MS spectra (A) and observed masses (B) of RNase B by flow injection. Hexn means the sugar chain attached to the peptide backbone has a structure of HexNAc2Hexn. formic acid was delivered to the probe tip at a rate of 2 µL/min by a syringe pump on LCQ. No sheath gas or auxiliary gas was used. The polyimine coating was burned off 2-3 mm from the outlet end and was washed off with ethanol to ensure the electric contact. The other end of the capillary (injection end) was immersed in a reservoir containing 2 M formic acid buffer. To minimize the influence of gravity flow, the whole CE apparatus was placed on a height-adjustable platform, and care was taken to ensure that the CE buffer reservoir and the electrospray end of the capillary were at the same level. An ESI voltage of +4.25 kV was applied to the electrospray tip, and the net separation voltage applied was -15 kV. The LCQ was operated with automatic gain control (AGC) for all of the experiments unless stated otherwise. In full scan mode, the mass analyzer was scanned from 600 to 2000 u. The number of microscans was 3 for all modes: full MS, zoom scan, and MS/MS. According to these settings, the most intense ion in the spectrum was selected automatically to perform a zoom scan, followed by a collisioninduced dissociation (CID) scan with an isolation width of 3 u after scanning each range in full scan mode. The relative collision energy was set to 45. Other operating parameters were set as follows: heated capillary temperature, 180 °C; capillary voltage, 24 V; tube lens offset, -5 V. To avoid bubble formation that may arise from the injection of bicarbonate buffer in the capillary filled with 2 M formic acid, samples were freeze-dried and redissolved in 20 µL 2 M formic acid buffer. After centrifugation at 6000 rpm for 10 min, the samples were injected under pressure (138 kPa) for 30 s. RESULTS AND DISCUSSION Comparative Mass Mapping of RNase B. The amino acid sequence of RNase B is the same as that of RNase A. The difference between these two proteins is that the Asn34 residue in RNase B is glycosylated. Flow injection of an RNase B sample (2 mg/mL) directly from the CE instrument under pressure of 138 kPa clearly revealed the existence of minor RNase A (Mr 13681.0) in commercial RNase B (Figure 1). The glycoprotein RNase B shows obvious microheterogeneity, the observed molecular weights of its five glycoforms are 14898.0, 15061.0, 15223.0, 15386.0, and 15549.0. Considering the mass shifts between each two adjacent glycoforms (162 Da) and those between glycoforms and RNase A (from 1217 to 1868 Da), the structure of oligosaccharides attached to the peptide was assigned as HexNAc2Hex5∼9. There is only one tripeptide sequon for N-glycosylation in the amino acid sequence of RNase B: Asn34-Leu-Thr. The N-glycosylation sites in glycoprotein can be discovered by comparative peptide mass mapping using Lys-C digestion. Typical CE-MS profiles before and after PNGase F treatment shown in Figure 2 are very similar to each other. Table 1 summarizes the interpreted results. Almost all of the expected peptides were found in the mass Analytical Chemistry, Vol. 73, No. 24, December 15, 2001 5877 Table 1. Peptide Mapping by Lys-C Digestion of RNase B by CE-MSa peptide residue sequence tr (min) calc massd obs massd obs ions L1 L2 L3e L3′ L4 L5 1-7 8-31 32-37 32-37 42-61 62-91 92-98 99-104 105-124 KETAAAK FERQHMDSSTSAASSSNYCbNQMMK SRNcLTK SRDLTK PVNTFVHESLADVQAVCSQK NGQTNCYQSYSTMSITDCRETGSSK YPNCAYK TTQANK HIIVACEGNPYVPVHFDASV 29.94 10.88 9.89 30.21 8.77 4.66 717.8 2798.1 1934.7 718.8 2230.4 2876.1 916.0 661.7 2225.5 717.8 2797.5 1934.6 718.5 2229.6 2876.7 718.8+ 933.53+ 968.32+ 719.5+ 744.23+ 959.93+ 661.4 2223.8 662.4+ 1112.92+ L6 L7 a 16.00 8.49 Peptide mass above 600 Da. b All cysteines were alkylated. c Glycosylation site. d Average mass. e Dominant sugar chain is HexNAc2Hex5. Table 2. Peptide Mapping by Glu-C Digestion of RNase B by CE-MSa f peptide residue sequence tr (min) calc massd obs massd obs ions G1 G2e G2′f G3 G4 G5 1-9 10-49 10-49 50-86 87-111 112-124 KETAAAKFE RQHMDSSTSAASSSNYCbNQMMKSRNcLTKDRCKPVNTFVHE RQHMDSSTSAASSSNYCNQMMKSRNcLTKDRCKPVNTFVHE SLADVQAVSQKNVACKNGQTNCYQSYSTMSITDCRE TGSSKYPNCAYKTTQANKHIIVACE GNPYVPVHFDASV 17.81 14.40 14.73 5.14 13.25 5.42 994.1 5922.1 5597.9 4275.7 2842.2 1401.5 993.6 5923.5 5598.5 4274.8 2842.2 1401.4 994.6+ 1185.75+ 1120.75+ 1069.74+ 948.43+ 701.7+ a Peptide mass above 600 Da. b All cysteines were modified by IAA. c Glycosylation site. d Average mass. e Dominant sugar chain is HexNAc Hex . 2 5 Dominant sugar chain is HexNAc2Hex3. Figure 3. Base peak and extracted ion chromatogram for glycopeptides resulting from Lys-C digestion of RNase B. Relative abundance of doubly charged ions was listed for comparison. Figure 2. Comparative PMM by Lys-C digestion of RNase B before (A) and after (B) PNGase F treatment. Separation was carried out by applying a net voltage of -15 kV using charge reversal. spectra. Glycopeptide L3 was eluted at 9.9 min (Figure 2a). After PNGase F treatment, L3 disappeared and another peak corre5878 Analytical Chemistry, Vol. 73, No. 24, December 15, 2001 sponding to its deglycosylated product appeared at 30.2 min (Figure 2b). The separation of glycopeptides and their relative abundance is shown by the extracted ion chromatogram (EIC): HexNAc2Hex5/HexNAc2Hex6/HexNAc2Hex7/HexNAc2Hex8 is 6.3 × 107/3.6 × 107/1.0 × 107/8.0 × 106 (Figure 3). The relatively good resolution of glycoforms allowed the mass spectrometer to have enough time to perform zoom scan and MS/MS analysis for each of the glycopeptides. Comparing the MS/MS spectra of two adjacent glycopeptides clearly revealed that their structures differed only in one mannose residue attached to the sugar chain (Figure 4). Under the current MS conditions, the breakage mainly occurred at the covalent bonds between sugar residues. The number of sugar residues and their linkage could be deduced from the ion pattern and the differences of CID spectra. After Figure 4. MS/MS spectra of glycopeptides L3-HexNAc2Hex5 (A) and L3-HexNAc2Hex6 (B). Figure 5. MS/MS spectra of glycopeptide G2′-HexNAc2Hex3. PNGase F treatment, the glycopeptides were converted to peptide SRD34LTK, which was also confirmed by its CID spectrum. In high-mannose-type N-glycosylation, the mannose residues were linked by R-glycosidic bonds, which makes it different from other types of N-glycosylation. So if the mannose residues appended to the pentasaccharide core can be removed by R-mannosidase or if the structure of oligosaccharide left is GlcNAc2Man1, the glycosylation can be assigned as high-mannose type. Accordingly, RNase B was digested by Glu-C protease and then by R-mannosidase. The results of comparative PMM were summarized in Table 2. The sugar chains in glycopeptide G2 were all converted to GlcNAc2Man3 after R-mannosidase treatment for 6 h (Figure 5). A longer period of R-mannosidase treatment (>48 h) could give rise to a structure of GlcNAc2Man1 (data not shown). These results showed that the N-glycosylation in RNase B belongs to the high-mannose type. Comparative Mass Mapping of TSL. TSL is a C-type lectin from the venom of Trimeresurus stejnegeri with galactose binding Analytical Chemistry, Vol. 73, No. 24, December 15, 2001 5879 Table 3. Peptide Mapping by Trypsin Digestion of TSL by CE-MSa peptide T1f T1-O T1-2O T1′ T1′-O T1′-2O T2 T3 T3-O T4 T5 T6 T7 T8 T9 residue sequence tr (min) calc massd obs massd obs ions 1-16 1-16 1-16 1-16 1-16 1-16 17-22 23-32 23-32 34-45 46-61 63-73 76-84 85-94 95-101 104-117 118-126 127-134 SCbCTNcDSLPMNGMCYK 1.31 1.31 1.15 4.48 4.33 4.33 12.80 7.30 7.00 3641.4 3657.4 3673.4 1939.2 1955.2 1971.2 747.9 1344.5 1360.5 1472.7 1867.1 1299.5 1241.3 1301.4 902.0 1709.9 1165.3 1056.2 3641.1 3659.7 3675.6 1939.2 1955.4 1971.2 747.4 1344.2 1360.2 1214.73+ 1220.93+ 1226.23+ 970.62+ 978.72+ 986.62+ 748.4+ 673.12+ 681.12+ 1867.2 1299.4 1241.2 1301.2 623.43+ 650.72+ 621.62+ 651.62+ 1709.4 855.72+ SCCTNcDSLPMNGMdCYK SCCTNcDSLPMdNGMdCYK SCCTDDSLPMNGMCYK SCCTDDSLPMNGMdCYK SCCTDDSLPMdNGMdCYK IFDEPK TWEDAEMFCR TWEDAEMdFCR YKPGCHLASFHR LAESLDIAEYISDYHK QAEVWIGLLDRK DFSWEWTDR SCTDYLNWDK NQPDHYK EFCVELVSLTGYHR WNDQVCESK NSFLCQCK 9.70 9.30 7.99 7.99 10.84 10.29 1055.4 1056.4+ a Peptide mass above 600 Da. b All cysteines were modified by IAA. c Glycosylation site. d Methionine was oxidated. e Average mass. f Dominant sugar chain is HexNAc2Hex8. activity. It has 135 amino acid residues, including 10 cysteine residues, and displayed monomer, dimer, and trimer on nonreducing SDS-PAGE (data not shown), indicating that some cysteines were involved in pairing of an interchain linkage. The analysis of the amino acid sequence of TSL revealed that there is also only one glycosylation site matching the tripeptide recognition signal: Asn5-Asp-Ser. Comparing the base peak (representing the most abundant ion in a peak) of the separation of tryptic digest of TSL before and after PNGase F treatment, it was found that the deglycosylated peptide was eluted about 3 min later than the glycopeptides (Figure 6), indicating that the attachment of the sugar chain had a great influence on the electrophoretic mobility of the peptides. Results in Table 3 show that most of the tryptic peptides were detected by CE-MS. Interestingly, we also found peaks representing the differential oxidation of glycopeptide T1 (S1CCTNDSLPMNGMCYK16) and the Met oxidation of peptide T3 (T23WEDAEMFCR32). Figure 7 shows the summed MS spectrum of glycopeptide T1. Although the peaks were not separated very well because of the presence of differentially oxidized products, it still could be seen clearly that T1 had four major glycoforms. According to the mass shifts between adjacent peaks (162 Da), and those between the glycoforms and peptide (1214 to 1702 Da), the structure of sugar chains was assigned as HexNAc2Hex5∼8. The corresponding mono-oxidized and double-oxidized products of the most abundant glycopeptide (denominated as T1-HexNAc2Hex8-O and T1-HexNAc2Hex8-2O, respectively) were characterized by MS/MS (Figure 8). Fragment ions from T1-HexNAc2Hex1 to T1-HexNAc2Hex7 could be found in the CID spectra, indicating that the breakage mainly occurred mainly between the mannose residues. Closer inspection of these two CID spectra revealed that the doubly charged fragment ions from T1-HexNAc2Hex8-2O were (30) Liu, T.; Zeng, R.; Shao, X. X.; Xia, Q. C. Acta Biochem. Biophys. Sin. 1999, 31, 425-432. (31) Liu, T.; Shao, X. X.; Zeng, R.; Xia, Q. C. J. Chromatogr. A 1999, 855, 695707. (32) Hsu, Y. R.; Narhi, L. O.; Spahr, C.; Langley, K. E.; Lu, H. S. Protein Sci. 1996, 5, 1165-1173. 5880 Analytical Chemistry, Vol. 73, No. 24, December 15, 2001 Figure 6. Comparative PMM by trypsin digestion of TSL before (A) and after (B) PNGase F treatment. Separation was carried out by applying a net voltage of -15 kV using charge reversal. 8 Da larger than those from T1-HexNAc2Hex8-O, thus confirming the differential Met oxidation in glycopeptides. After PNGase F treatment, glycopeptides T1 were converted to peptide T1′. The influence on the electrophoretic mobility of peptide caused by differential oxidation was much smaller than that by glycosylation. T1′ and its differential oxidation products (T1′-O and T1′-2O) eluted at almost the same time (around 4.5 min), and T1′-2O is the most abundant component (Figure 9). It is noteworthy that, although T1′, T1′-O, and T1′-2O were not well- Figure 7. Summed MS spectra from the labeled peak T1 in the base peak in Figure 6A. Hexn means the sugar chain attached to the peptide backbone has a structure of HexNAc2Hexn. Figure 8. MS/MS spectra of the mono- and doubly oxidized products of glycopeptide T1-HexNAc2Hex8. (A) T1-HexNAc2Hex8-O; (B) T1HexNAc2Hex8-2O. separated, the fast scan speed of MS still allowed their CID spectra to be collected separately. It can be seen clearly from the CID spectrum of T1′-O (SCCTDDSLPM10NGM13CYK) that the preferred oxidation site was Met13 instead of Met10 (Figure 10). The oxidation that took place on peptide T3 was also confirmed by its CID spectrum. Comparative PMM was also performed by using Glu-C protease and R-mannosidase successively to further characterize the type of N-glycosylation in TSL (Figure 11). The results are summarized in Table 4. Two glycopeptides (G1 and G2) containing the same glycosylation site were found by Glu-C protease cleavage. Differential oxidation in these glycopeptides was also observed Analytical Chemistry, Vol. 73, No. 24, December 15, 2001 5881 Figure 9. Summed MS spectra from the labeled peak T1′ in the base peak in Figure 6B shows the doubly charged ions for the deglycosylated peptide and its differential oxidation products. Figure 10. MS/MS spectrum of the mono-oxidized and deglycosylated peptide. M indicates the oxidized Met residue. in PMM using Glu-C protease, indicating strongly that it is a kind of process-induced modification. Comparing the separation profiles of digests before and after R-mannosidase treatment, the treated glycopeptides were all eluted later because of the removal of mannose residues (G1′, 8.4 min vs G1, 6.4 min; G2′, 6.5 min vs G2, 4.7 min), while the other peptides remained at almost the same positions. Although the separation of glycopeptides was not very good because of the presence of differential oxidation products with similar electrophoretic mobilities, the CID spectra of some major components could still be collected separately, and the sugar chain structure and Met oxidation in these glycopeptides could be characterized. In glycopeptides G1 and G2, the dominant sugar chain has a structure of HexNAc2Hex8 (observed ions are 1597.03+ and 1339.73+). For example, G1-HexNAc2Hex8 and its 5882 Analytical Chemistry, Vol. 73, No. 24, December 15, 2001 differential oxidation products (G1-HexNAc2Hex8-O, G1-HexNAc2Hex8-2O) were all identified by MS/MS (Figure 12). Under the specific CID condition, breakage mainly occurred at the glycosidic bonds instead of at the peptide bonds. Fragment ions from G1HexNAc2Hex7 to G1-HexNAc1 could be found in these spectra, from which the sequence of the sugar chain could be deduced. The differential oxidation was also confirmed by comparing these CID spectra. It could be seen from Figure 13 that the sugar chain structure was converted to HexNAc2Hex1∼3 (observed ions are 1218.23+, 1273.23+, 1326.03+, and their differential oxidation products) after R-mannosidase treatment (Figure 13b shows the identification of the double-oxidized product G1-HexNAc2Hex32O), indicating that all hexoses appended to the pentasaccharide core could be removed by R-mannosidase. So the glycosylation Table 4. Peptide Mapping by Glu-C Digestion of TSL by CE-MSa peptide G1f G1-O G1-2O G1′g G1′-O G1′-2O G2f G2-O G2-2O G2′g G3 G4 G4-O G5 G6 G7 G8 residue sequence tr (min) calc massd obs massd obs ions 1-25 1-25 1-25 1-25 1-25 1-25 1-19 1-19 1-19 1-19 20-25 29-48 29-48 49-54 55-65 66-80 81-104 109-124 125-135 SCbCTNcDSLPMNGMCYKIFDEPKTWE 6.41 6.41 6.27 8.41 8.41 8.28 4.69 4.69 4.69 6.50 15.87 39.55 38.82 7.18 26.67 4787.7 4803.7 4819.7 3977.2 3993.2 4009.2 4016.7 4032.7 4048.7 3206.2 788.9 2509.0 2525.0 646.7 1409.5 1892.2 3115.3 1977.2 1418.7 4788.0 4802.4 4820.4 3975.0 3993.9 4008.3 4016.1 4034.4 4049.7 3206.4 788.5 2508.8 2524.8 646.3 1049.6 1597.03+ 1601.83+ 1607.83+ 1326.03+ 1332.33+ 1337.13+ 1339.73+ 1345.83+ 1350.93+ 1604.22+ 789.5+ 628.24+ 632.24+ 647.3+ 705.82+ 1976.6 1418.4 989.32+ 710.22+ SCCTNcDSLPMNGMdCYKIFDEPKTWE SCCTNcDSLPMdNGMdCYKIFDEPKTWE SCCTNcDSLPMNGMCYKIFDEPKTWE SCCTNcDSLPMNGMdCYKIFDEPKTWE SCCTNcDSLPMdNGMdCYKIFDEPKTWE SCCTNcDSLPMNGMCYKIFD SCCTNcDSLPMNGMdCYKIFD SCCTNcDSLPMdNGMdCYKIFD SCCTNcDSLPMNGMCYKIFD EPKTWE MFCRKYKPGCHLASFHRLAE MdFCRKYKPGCHLASFHRLAE SLDIAE YISDYHKRQAE VWIGLLDRKKDFSWE WTDRSCTDYLNWDKNQPDHYKDKE LVSLTGYHRWNDQVCE SKNSFLCQCKF 12.48 18.65 a Peptide mass above 600 Da. b All cysteines were modified by IAA. c Glycosylation site. d Methionine was oxidated. e Average mass. f Dominant sugar chain is HexNAc2Hex8. g Dominant sugar chain is HexNAc2Hex3. Figure 11. Comparative PMM by Glu-C digestion of TSL before (A) and after (B) R-mannosidase treatment. Separation was carried out by applying a net voltage of -15 kV using charge reversal. in TSL can be assigned as high-mannose-type N-glycosylation, and the molecular formula of the sugar chains is GlcNAc2Man5∼8. CONCLUSIONS In this paper, a strategy of glycoprotein digestion by protease combined with glycosidase to characterize the high-mannose-type N-glycosylation by CE-ESI-MS is described. PNGase F can remove all N-linked sugar chains from the peptide. Its optimal pH range is 7∼8, so it can be used directly after trypsin or Lys-C digestion to determine the N-glycosylation sites. R-Mannosidase with an optimal pH range of 4∼5 can be used right after Glu-C digestion to determine the linkage of the pentasaccharide core with other sugar residues. Using this strategy to perform comparative peptide mass mapping by CE-MS/MS, the highmannose-type N-glycosylation in RNase B and TSL were characterized rapidly and conveniently. The use of charge reversal can improve the resolution of glycoforms when it is combined with CE-MS/MS, and glycoforms can be separated and characterized without any extra oligosaccharide release, derivatization, labeling, or purification; thus, the whole analytical procedure is straightforward with minimal sample loss and contamination. Sensitivity at the low picomole level can be achieved in this study, although only a conventional sheath-flow interface with a much higher flow rate, as compared to the microspray interface and nanospray interface, was used. In our previous study, protein identification and modification characterization could be accomplished at a low picomole level using this analytical system and automatic database searching.30,31 A minimal sample concentration of 5 × 10-6 M still needs to be used, because no other sample preconcentration techniques were employed. In comparison to traditional LC-MS, CE-MS has better sensitivity and a similar limit of detection for sample concentration. In addition, its detection limits can be further enhanced by using low flowrate interfaces and sample preconcentration techniques (e.g., solidphase microextration). Up to now, quantification is relatively hard to carry out on this analytical system, because the electrospray in CE-MS is hard to keep consistent using a coaxial sheath-flow interface with a much lower flow rate than that in LC-MS, yet the determination of the relative abundance of individual glycoforms still can be achieved by this technique (e.g., the relative abundance of tryptic glycopeptides of RNase B: HexNAc2Hex5/ HexNAc2Hex6/HexNAc2Hex7/HexNAc2Hex8 is 53.8/30.8/8.5/ 6.8%). Its ability of quantification may well be improved by using more stable sheathless interfaces and internal calibrants. Relatively Analytical Chemistry, Vol. 73, No. 24, December 15, 2001 5883 Figure 12. MS/MS spectra of glycopeptide G1 and its differential oxidation products. (A) G1-HexNAc2Hex8, (B) G1-HexNAc2Hex8-O, and (C) G1-HexNAc2Hex8-2O. good reproducibility could be obtained when fresh coating was used for each run. A standard deviation of retention time of ∼0.10.3 min was obtained routinely. The value could be enlarged to ∼0.2-0.4 min in comparative PMM, because the sample properties were changed slightly after glycosidase treatment (See Figures 2, 6, and 11). Met oxidation could happen when proteins were processed at room temperature for a long time. It is very common in in-gel protein digestion, although the mechanism of methionine oxidation is still not clear, but the possibility that it might happen in the junction between CE and MS or in the ion source of MS can 5884 Analytical Chemistry, Vol. 73, No. 24, December 15, 2001 be eliminated. The PMMs of RNase B and cytochrome c were carried out under the same conditions as TSL, but no Met oxidation was found. It seems like the oxidation of methionine residues may be related to the nature of Met-containing peptides (e.g., its amino acid sequence and its local position in the macromolecule). In vitro Met-oxidation experiments revealed that the initial oxidation rates for the methionine residues of recombinant human stem cell factor were quite different.32 Analysis of process-induced protein modification can be a challenge when it is coexisting with other kinds of posttranslational modifications. In this study, the differential Met oxidation Figure 13. (A) Summed MS spectra from the labeled peak G1′ in the base peak in Figure 11B shows the triply charged ions for the R-mannosidase-treated glycopeptide and their differential oxidation products. (B) MS/MS spectrum of a double-oxidized glycopeptide G1-HexNAc2Hex3-2O. that occurred in the glycopeptides of TSL had added extra microheterogeneity to the glycopeptides. Although the highly heterogeneous peptides were not well-separated, the fast scan speed and strong MS/MS capacity of the ion trap mass spectrometer allowed most of these heterogeneous peptides to be identified. In particular, the preferred oxidation site in the doubleoxidized peptide was identified by interpreting the high-quality MS/MS spectrum. Carefully controlling the relative CID energy can make the breakage occur mainly at the glycosidic bonds instead of at the peptide bonds, thus greatly facilitating the interpretation of the sequence of oligosaccharides. ACKNOWLEDGMENT This work was supported by a grant from the “863” Biotechnology Project of China, no. 102-08-06-02, and by a grant for a key project from the National Natural Science Foundation of China, no. 39990600. Received for review June 19, 2001. Accepted September 18, 2001. AC0106748 Analytical Chemistry, Vol. 73, No. 24, December 15, 2001 5885
© Copyright 2026 Paperzz