Juvenile hormone resistance gene Methoprenetolerant controls entry into metamorphosis in the beetle Tribolium castaneum Barbora Konopova* and Marek Jindra†‡ *Department of Molecular Biology, University of South Bohemia, and †Biology Center, Czech Academy of Sciences, 37005 Ceske Budejovice, Czech Republic Edited by David L. Denlinger, Ohio State University, Columbus, OH, and approved May 1, 2007 (received for review April 23, 2007) Besides being a spectacular developmental process, metamorphosis is key to insect success. Entry into metamorphosis is controlled by juvenile hormone (JH). In larvae, JH prevents pupal and adult morphogenesis, thus keeping the insect in its immature state. How JH signals to preclude metamorphosis is poorly understood, and a JH receptor remains unknown. One candidate for the JH receptor role is the Methoprene-tolerant (Met) Per-Arnt-Sim (PAS) domain protein [also called Resistance to JH, Rst (1)JH], whose loss confers tolerance to JH and its mimic methoprene in the fruit fly Drosophila melanogaster. However, Met deficiency does not affect the larval– pupal transition, possibly because this process does not require JH absence in Drosophila. By contrast, the red flour beetle Tribolium castaneum is sensitive to developmental regulation by JH, thus making an ideal system to examine the role of Met in the antimetamorphic JH action. Here we show that impaired function of the Met ortholog TcMet renders Tribolium resistant to the effects of ectopic JH and, in a striking contrast to Drosophila, causes early-stage beetle larvae to undergo precocious metamorphosis. This is evident as TcMet-deficient larvae pupate prematurely or develop specific heterochronic phenotypes such as pupal-like cuticular structures, appendages, and compound eyes. Our results demonstrate that TcMet functions in JH response and provide the critical evidence that the putative JH receptor Met mediates the antimetamorphic effect of JH. insect metamorphosis 兩 postembryonic development 兩 endocrine regulation 兩 bHLH-PAS domain 兩 RNAi M etamorphosis is a marked change between larval and adult forms that occurs in all winged insects (1, 2). Holometabolous larvae metamorphose into adults by a stage termed the pupa. More than 70 years ago, V. B. Wigglesworth discovered that the entry into metamorphosis depends on juvenile hormone (JH) (3, 4). In larvae, JH prevents the steroid molting hormones (ecdysteroids) from initiating metamorphosis, so that after a molt another larval stage follows (5, 6). Therefore, in most species, supply of JH makes an insect reiterate its juvenile stage, whereas experimental removal of JH causes it to metamorphose prematurely (1, 7–12). An exception from this paradigm is the ‘‘higher’’ (cyclorrhaphous) Diptera including the fruit fly, Drosophila melanogaster, where exogenous JH cannot induce extra larval stages (13). In Drosophila, ectopic JH blocks only adult differentiation of the abdominal histoblasts, whereas the rest of the adult body that derives from imaginal discs is insensitive to JH (14–17). The mode of JH action remains an enigma, because neither its receptor nor a signaling pathway is known (6, 18–20). In 1986, Wilson and Fabian reported Drosophila mutants that survive toxic doses of JH or its mimic methoprene (21). The Methoprenetolerant (Met) gene [also called Resistance to juvenile hormone, Rst (1)JH] encodes a transcriptional regulator of the basic helix–loop–helix (bHLH)- Per-Arnt-Sim (PAS) domain family (22). Met has been shown to bind JH at physiological concentrations (23, 24) and therefore is a good candidate for the elusive JH receptor (6, 25–27). 10488 –10493 兩 PNAS 兩 June 19, 2007 兩 vol. 104 兩 no. 25 However, the critical evidence that Met is required for the antimetamorphic JH function is missing, because Met-null mutants are fully viable (27–29). A likely reason for the lack of an expected developmental phenotype is the weak effect of JH on preadult Drosophila. Another explanation might be a potential functional redundancy between Met and a paralogous Drosophila gene germ-cell expressed (gce) (30, 31), whose protein product can dimerize with Met in a JH-sensitive manner (26). The beetle Tribolium castaneum shows the classical developmental response to JH, which can cause repetition of juvenile stages (ref. 32 and this work). Moreover, the recently available genome information indicates that the beetle possesses a single ortholog of Drosophila Met and gce. Tribolium therefore offers an ideal opportunity to examine the role of Met in metamorphosis without the complication of redundancy and the atypical JH response. Here, we show that depletion of Met renders Tribolium resistant to JH, and that in beetle larvae it causes premature pupal morphogenesis. These results establish Met as an essential mediator of the antimetamorphic JH signal and support its putative receptor role. Results Met Is Conserved and Constitutively Expressed in Tribolium. Based on the T. castaneum genome database and using rapid amplification of cDNA ends, we have isolated a presumably full-length copy of a transcript that encodes 516 amino acids. The deduced protein is identical to a previously annotated Tribolium protein (XM㛭961449), except that its N-terminal sequence is 69 amino acids shorter than in the GenBank entry. Our ORF starts with the Kozak translation start site consensus ACCAUGG and is preceded by a stop codon. The protein contains the bHLH domain, two PAS domains (A and B), and a PAS C-terminal motif PAC (Fig. 1A) that are all conserved with D. melanogaster Met (22), DmGce, and proteins from mosquitoes (31) and the honey bee [see supporting information (SI)]. In its bHLH and PAS-B (but not PAS-A and PAC) domains, the Tribolium protein appears more similar to DmGce than DmMet. The number and positions of Tribolium introns are better conserved with those of Dmgce and the Aedes aegypti genes than with the single intron in DmMet (Fig. 1 A and ref. 31). Similar to mosquitoes and the honey bee, the Tribolium genome apparently Author contributions: B.K. and M.J. designed research; B.K. and M.J. performed research; B.K. and M.J. analyzed data; and B.K. and M.J. wrote the paper. The authors declare no conflict of interest. This article is a PNAS Direct Submission. Abbreviations: JH, juvenile hormone; Met, Methoprene-tolerant; bHLH, basic helix–loop– helix domain; PAS, Per-Arnt-Sim domain. Data deposition: The sequence reported in this paper has been deposited in the GenBank database (accession no. EF468474). See Commentary on page 10297. ‡To whom correspondence should be addressed. E-mail: [email protected]. This article contains supporting information online at www.pnas.org/cgi/content/full/ 0703719104/DC1. © 2007 by The National Academy of Sciences of the USA www.pnas.org兾cgi兾doi兾10.1073兾pnas.0703719104 contains only one counterpart of Dmgce and DmMet. Our phylogenetic analysis confirms a previous notion that Dmgce and DmMet are paralogs that arose by a lineage-specific duplication in higher Diptera (31) and shows that the Tribolium gene is a single ortholog of Drosophila gce and Met (see SI). Because of its functional similarity to Met (see below) and in keeping with the literature, we will refer to the Tribolium gene as TcMet. To find out whether TcMet is transcriptionally regulated in diverse developmental stages, we analyzed its expression by using RT-PCR (Fig. 1B). The transcript was detected in all stages examined: embryos, fifth instar larvae, prepupae (i.e., immobile pharate pupae that displayed a crooked posture), pupae, and adults. Thus, at the level of mRNA TcMet seems to be continuously expressed throughout beetle development. TcMet Silencing Confers Insensitivity to Ectopic JH. To establish whether TcMet mediates JH response in the beetle as Met does in Drosophila, we have tested for resistance against the hormone and its mimic methoprene in TcMet(RNAi) Tribolium pupae. It has been well documented that upon exposure to JH analogs, pupae of a closely related beetle Tenebrio molitor, will produce Fig. 2. TcMet knockdown provides resistance against a potent JH mimic methoprene during pupal stage. (A) Topical application of methoprene (0.3-mM solution) to a freshly ecdysed control pupa that had been injected with egfp dsRNA before pupation induced formation of an abnormal second pupal stage and death. The tip of the abdominal pupal cuticle was peeled off (from the line indicated by the arrowhead) to reveal a second pupal cuticle underneath it and a second set of pupal urogomphi (arrow). (B and C) TcMet(RNAi) pupae after the same methoprene treatment developed into apparently normal adults that either eclosed (B) or died unable to shed the pupal cuticle (C). (Scale bar: 1 mm.) a supernumerary (second) pupa instead of an adult (33–35). When we treated early Tribolium pupae with methoprene or with JH naturally occurring in beetles (JH-III), nearly all of the animals died after molting to a second pupal stage, and none emerged as adult (Table 1 and Fig. 2A). Geraniol and farnesol, compounds that are structurally related to JH but lack JH activity, had no such effect even at much higher doses (Table 1). Strikingly, RNAi knockdown of TcMet was sufficient to neutralize the action of methoprene and JH-III on pupae (Fig. 2 and Table 1). TcMet dsRNA was injected into early prepupae. This late treatment caused no lethality while reducing TcMet mRNA level at the beginning of the pupal stage (Fig. 1C). The newly ecdysed TcMet(RNAi) pupae were given JH-III or methoprene as previously. Only 2% of the JH-treated TcMet(RNAi) individuals arrested as second pupae, whereas 68% molted to normal viable adults (Table 1). The remaining 30% died as pharate adults just before imaginal eclosion, a phenotype that was likely caused by the silencing of Met itself rather than by JH treatment, because ecdysis defects were also frequent in TcMet(RNAi) acetone controls (Table 1). Thus, depletion of TcMet was able Table 1. TcMet RNAi confers resistance to JH-III and methoprene in Tribolium dsRNA egfp TcMet None Treatment* n Second pupae Uneclosed adults Normal adults Methoprene (0.3 mM) Methoprene (0.03 mM) JH-III (0.3 mM) Acetone Methoprene (0.3 mM) Methoprene (0.03 mM) JH-III (0.3 mM) Acetone Geraniol (57 mM) Geraniol (0.6 mM) Farnesol (40 mM) Farnesol (0.4 mM) 20 8 41 33 26 6 47 11 35 15 31 15 20 8 38 — 4 1 1 — — — — — — — 3 — 3 — 14 6 — — — — — — — 33 19 5 32 5 35 15 31 15 *Early seventh- or eighth-instar prepupae were injected with dsRNA and allowed to pupate, then, within 0 –12 h after ecdysis, briefly dipped in acetone or acetone-diluted compounds. Konopova and Jindra PNAS 兩 June 19, 2007 兩 vol. 104 兩 no. 25 兩 10489 DEVELOPMENTAL BIOLOGY Fig. 1. Structure and expression of Tribolium Met. (A) Schematic representation of Tribolium Met as compared with orthologous proteins from A. aegypti (Aa) and D. melanogaster (Dm). Numbers indicate amino acid identities within the conserved domains. Black arrowheads mark intron positions in all four respective genes. See also SI for detailed alignment and phylogenetic analysis. (B) Total RNA prepared from staged embryos or from 4 to 11 larvae, prepupae (i.e., pharate pupae), pupae, and adults was treated with DNase and assayed for TcMet expression by using RT-PCR. Contamination with genomic DNA was excluded by PCR on samples processed without reverse transcriptase (not shown). In addition, the TcMet primers flanked a 4.4-kb intron. Numbers denote age (in days) of the indicated stages. F, female; M, male. (C) Early prepupae were injected with either TcMet or egfp dsRNA and allowed to pupate. Reduced TcMet expression is shown in two such individual pupae (a, b) aged 0 –12 h after ecdysis. A similar transcript depletion was seen after dsRNA injection in larvae (not shown). Expression of rp49 served for control. C B SEE COMMENTARY A A B C D E F Fig. 3. Silencing of TcMet in Tribolium larvae induces premature metamorphosis. (A) Summary of the fate of animals injected with dsRNA during third to fifth instars (L3–L5). Numbers in gray box indicate how many larval instars (since hatching) occurred either before the animals died or before they reached adulthood. Whereas 7 and 8 represent the normal count of larval instars, the numbers 5 and 6 imply precocious metamorphic development, manifest as prothetelic larvae (blue; for phenotypes, see Fig. 5), prepupae (pink; for phenotypes, see Fig. 4), or pupae (yellow), all of which were lethal. Examples of premature pupation (yellow) after TcMet dsRNA injection in the third and fourth instars are depicted in C, D, and F, respectively. Larvae injected with egfp dsRNA pupated in the seventh (E) or eighth instar (B). Some of the TcMet(RNAi) premature pupae did not ecdyse properly (C) and had larval exuvia attached along the ventral side (arrows). Arrowheads indicate formation of compound eyes. (Scale bar: 1 mm.) to rescue 98% of pupae (n ⫽ 47) from the JH-induced reiteration of pupal development. Similar results were obtained with methoprene (Fig. 2 and Table 1). The increased incidence of second pupae in methoprene-treated TcMet(RNAi) animals was likely due to the fact that methoprene is metabolically nondegradable and therefore more potent than JH-III. Our data clearly demonstrate that TcMet knockdown renders Tribolium pupae insensitive to natural JH as well as to its analog methoprene. This finding suggests a developmental role for TcMet in JH signaling. Loss of TcMet Causes Premature Pupation. We next asked whether TcMet mediates the antimetamorphic function of JH, which is manifested as extranumerary larval stages instead of pupation in T. castaneum (see SI and ref. 32). Conversely, experimental depletion of JH in many insects including beetles (11, 36) induces premature pupation, and exactly this phenotype would be expected upon TcMet knockdown if JH prevented precocious metamorphosis by TcMet. Under our breeding conditions Tribolium larvae normally pass through seven or (less frequently) eight instars before they pupate. Injection of TcMet dsRNA into larvae at the beginning of the third and fourth instars caused precocious metamorphosis (Fig. 3). Most notably, RNAi triggered during the third instar induced pupation of four of 52 animals at the end of the fifth instar (Fig. 3 A, C, and D). Similarly, silencing of TcMet from the beginning of the fourth instar caused 22% of the larvae to pupate early, usually at the end of their sixth instar (Fig. 3 A and F). Some of the minute pupae resulting from these experiments could not completely ecdyse from their larval cuticles and soon died (Fig. 3C), whereas others survived for several days, forming superficially perfect yet eventually lethal pharate adults that were 10490 兩 www.pnas.org兾cgi兾doi兾10.1073兾pnas.0703719104 unable to eclose (Fig. 3F). When TcMet dsRNA was diluted 2-fold before injection, we occasionally obtained miniature adult beetles from sixth instar pupae (not shown). By contrast to TcMet RNAi, no signs of precocious metamorphosis were seen in controls that had been injected with egfp dsRNA as third to fifth instar larvae (Fig. 3 A, B, and E). On average, 91% of these controls developed to adults normally (Fig. 3A), except that relative to noninjected animals, their pupation was often delayed until the eighth instar, presumably in response to the injury. Because the same injury occurred also in the injected TcMet(RNAi) larvae, their pupation might have been early not by one or two but rather by two or three molts. In addition to early metamorphic phenotypes (see also below), TcMet(RNAi) animals at various stages also suffered ecdysis defects (Figs. 2C, 3C, and 4A). Even larvae that were injected early in the final (seventh) instar and that pupated at the right stage died, being unable to shed the larval or pupal cuticles (not shown). Disrupted ecdysis might thus be a second effect of TcMet deficiency. On average, 46% of larvae that had been injected with TcMet dsRNA in their third and fourth instars, and nearly all of those injected in the fifth instar, were unable to shed the larval cuticle and died as undersized prepupae (pharate pupae) during the next, i.e., the fifth (Figs. 3A and 4) or sixth instar (Fig. 3A). Before death, these animals displayed a wandering-like behavior that is typical of the final larval instar (37), and premature compound eye development became visible underneath their apolysed larval cuticle (Fig. 4A). To provide further evidence that these TcMet(RNAi) animals were true pharate pupae, two of those that had arrested at the fifth instar were removed from the larval cuticle and subjected to scanning electron microscopy. As expected, both of them showed typical pupal hallmarks such as the presence of wings, gin traps, and pupal genital papillae Konopova and Jindra B Fig. 4. Most TcMet(RNAi) larvae are unable to ecdyse and arrest as premature prepupae (see Fig. 3A, pink). (A) Arrested fifth instar TcMet(RNAi) prepupa and a control (egfp dsRNA) eighth instar prepupa are shown; both had been injected with dsRNAs as early-third instar larvae. Note the smaller body size and advanced eye pigmentation (arrow) in TcMet(RNAi) prepupa. (B) The premature TcMet(RNAi) prepupa from A after it had been removed from the larval cuticle bears typical pupal features including wings (asterisks), gin traps (arrowheads and Inset), and pupal (female) genital papillae (arrow). (Scale bars: A, 1 mm; B, 500 m.) (Fig. 4B). Thus, up to 67% of the third-to-fifth instar larvae injected with TcMet dsRNA form premature pupae, although most of them fail to ecdyse. Prothetely Marks Precocious Metamorphosis in TcMet(RNAi) Animals. Approximately 44% and 21%, respectively, of the larvae injected in third and fourth instars arrested after two or three molts (Fig. 3A). During the instar in which they arrested, the larvae did not feed, sometimes had reduced pigmentation, and finally died within 1 or 2 days after ecdysis, occasionally with pieces of old (previous instar) cuticle attached to their legs or mouthparts. Despite their overall larval appearance, many of these animals displayed a mix of pupal characters (prothetely) (Fig. 5). Some had larva-like body only with prematurely advanced development of antennae and eyes (Fig. 5 K and L) or wings of various sizes (Fig. 5M). Other pupal characters in these larvae included gin traps, elongated urogomphi, or pupal genital papillae (compare Fig. 5 N and O with D and I and with E and J, respectively). We also noticed elongated legs with double claws and reduced number of sensillae (not shown). Taken together, our observations reveal that silencing of TcMet in young Tribolium larvae induces precocious pupal morphogenesis. Discussion How JH controls metamorphosis at the genetic and molecular level is poorly understood, mainly because neither a JH receptor nor downstream components of JH signaling have been clearly identified. Genetic studies on JH action have been hampered by the fact that the highly evolved Drosophila metamorphosis is only marginally sensitive to JH (16, 17). Thus, although Drosophila has been an excellent system for disclosing important genes such Konopova and Jindra Methods Tribolium Breeding and Staging. Wild-type T. castaneum (strain San Bernardino) beetles were maintained on flour–yeast diet at 32°C in constant darkness. Eggs were collected by sifting, and larvae were kept on food in Petri dishes until the desired stage. Because second to final instar larvae cannot be distinguished by obvious morphological markers, staging into instars was based on the number of undergone ecdyses. Under constant condiPNAS 兩 June 19, 2007 兩 vol. 104 兩 no. 25 兩 10491 SEE COMMENTARY as Met, it has not revealed its role in the fundamental function of JH: maintaining the status quo in juvenile insects. In this study, we show that Tribolium Met mediates JH response and is required in the beetle larvae for the proper timing of entry to the metamorphic pupal program. Silencing of TcMet produced two major lines of evidence. First, by making pupae resistant to high doses of JH-III and methoprene, it established that the single Tribolium ortholog of the Met/gce genes has a similar function to Met. The function of gce is presently unknown, and future studies in Drosophila should yield interesting comparisons. Second, deficiency of TcMet in young larvae induced premature pupation and other heterochronic phenotypes that mark precocious metamorphosis. The presence of prothetelic larvae likely reflected temporal differences of diverse tissues in the acquisition of the pupal fate and/or their uneven sensitivity to TcMet RNAi. Both variables might bear some influence, because pupal characters in these larvae did not appear in an exact sequence, and individual animals displayed different sets of phenotypes. Generally, however, unlike the appendages, eyes, or wings, the thoracic and abdominal cuticle often retained its larval character, suggesting that, as in other insects (38, 39), Tribolium epidermis becomes pupally committed later than these organs. Premature metamorphosis can be elicited in many insects by removal of the JH-producing corpora allata gland. However, when such ablation is carried out in very young larvae, one or two additional ecdyses are usually necessary before signs of metamorphosis appear (2, 7, 10). Depletion of JH via continuous overexpression of JH esterase also fails to cause premature pupation in silkworm larvae that are younger than third instar (12), suggesting that insect tissues require certain time of postembryonic development before acquiring the competence to metamorphose in response to ecdysteroid in the absence of JH. These findings help explain why in our experiments metamorphic changes typically followed two or three molts after injection of TcMet dsRNA. Another reason for this delay may be a time lag before sufficient depletion of the protein. How might TcMet prevent metamorphosis in response to JH? Drosophila Met has been linked with JH in several ways. Met mutants tolerate harmful effects of JH (21, 28), and their tissues display reduced affinity to JH (23). The recombinant Met protein has been shown to bind JH and to stimulate transcription in response to JH-III (24). Finally, Met can form homodimers and heterodimers with Gce in the absence of JH (26). Met thus presents the best known candidate for the JH receptor role. bHLH-PAS domain proteins are particularly interesting signaling molecules, because many of them act as sensors of external stimuli such as hypoxia, xenobiotics or hormones (reviewed in ref. 40). At this point, we have no biochemical evidence for JH binding and JH-dependent transactivation by TcMet; however, our results encourage such studies. The work presented here discloses the long-elusive role of Met in the JH-controlled process of entry into metamorphosis. This evidence supports the hypothesis that Met might serve as a JH receptor or its essential constituent. Further genetic studies in Tribolium should address interactions of TcMet with other signaling pathways and ultimately improve our understanding of insect metamorphosis and its hormonal regulation. DEVELOPMENTAL BIOLOGY A A F K B G L C D E H M I N J O Fig. 5. TcMet RNAi causes larval prothetely. TcMet dsRNA was injected at the beginning of the third or fourth larval instar. Shown are examples of heterochronic pupal characters in several different TcMet(RNAi) individuals. When compared with wild-type larvae (A–E) and pupae (F–J), TcMet(RNAi) larvae (K–O) display pupa-like antennae (K, an) and eyes (L). Wings (arrows in H and M) and gin traps (gt) appear in normal pupae and TcMet(RNAi) animals (compare H with M and I with N) but are absent in larvae (see their presumptive positions marked with asterisks in C and D). Urogomphi at the distal abdomen of TcMet(RNAi) animals are elongated like those in pupae (arrows, compare O with E and J). Larval pygopods (E, py) disappear, whereas genital papillae on the ninth abdominal segment develop (arrowheads in J and O, females shown). The larva in A is of the second instar, and larvae in B–E are of the seventh instar. Anterior is to the left in all images; I is a dorsal and N a ventral view. (Scale bars: B, C, G, H, L, and M, 500 m; D–F and I–K, 200 m; O, 100 m; and A and N, 50 m.) tions, larvae developed at a similar rate, and successive ecdyses thus took place at roughly constant time points since hatching. Therefore, ecdysis into the desired instar was assessed from the timetable of ecdyses that had been prepared as follows: eggs from a 6-h egg collection were placed individually into wells of a cell culture plate and checked daily to mark the time of hatching and of each ecdysis. Isolation of Tribolium Met cDNA. Conserved region of TcMet spanning the bHLH through PAC domains was identified in the Tribolium genome database (www.bioinformatics.ksu.edu/ BeetleBase) by using TBLASTN search with the Drosophila Met protein sequence. A cDNA of 2,710 bp was obtained by using RACE (Invitrogen) from embryonic and larval RNA with two gene-specific primers for 5⬘RACE (5⬘-TGGCACTTCTTGCGACCATC-3⬘ and nested 5⬘-TGTCCCTTCGCATCTTTTCC-3⬘) and two for 3⬘RACE (5⬘-ACCACGACCGCCTGCGTATG-3⬘ and nested 5⬘-GAAGCTTCAAGAGAGGAATATG-3⬘). The fulllength transcript was compared with the genome database to identify intron positions. 10492 兩 www.pnas.org兾cgi兾doi兾10.1073兾pnas.0703719104 mRNA Expression Analysis. Total RNA was isolated from decho- rionated eggs, whole larvae, pupae, or adults by using TRIzol (Invitrogen, Carlsbad, CA). After treatment with DNase (Roche, Mannheim, Germany), 2 g of the RNA was used for first-strand cDNA synthesis with oligo(dT) primers and SuperScript II reverse transcriptase (Invitrogen). One microliter of 5-fold-diluted cDNA was used for PCR run for 28 cycles with a pair of primers designed for TcMet (5⬘-GAAGCTTCAAGAGAGGAATATG-3⬘ and 5⬘-TTTCAACAGTTCCCTGGTCG-3⬘) and for 24 cycles with a pair of primers for a Tribolium ribosomal protein gene rp49 (5⬘-T TATGGCA A ACTCA A ACGCA AC-3⬘ and 5⬘-GGTAGCATGTGCT TCGTTTTG-3⬘). That contamination with genomic DNA did not occur was verified by PCR on samples processed without reverse transcriptase. In addition, the primers for TcMet flanked an intron of 4.4 kb. RNAi. TcMet and egfp dsRNAs, at lengths 564 and 720 bp, respectively, were prepared as described (41) by using the T3 and T7 MEGAscript kit (Ambion, Austin, TX). Larvae and pupae Konopova and Jindra Hormonal Treatments. Early-seventh or -eighth instar prepupae were injected with TcMet or egfp dsRNA and allowed to pupate. Within 12 h after ecdysis, the pupae were briefly dipped into acetone (control) or acetone-diluted methoprene (VUOS, Pardubice, Czech Republic), juvenile hormone III, geraniol, or farnesol (the latter three from Sigma, St. Louis, MO). postfixed with 1% osmium tetroxide, dehydrated in ethanol, critical point dried, gold coated, and observed under a JEOL (Tokyo, Japan) 6300 scanning electron microscope. We thank G. Bucher for advice on beetle rearing and RNAi; Y. Tomoyasu for the phylogenetic analysis and comments on the manuscript; T. Shippy, S. Brown, P. Svacha, K. Slama, and F. Sehnal for valuable input; and D. Kodrik for advice on the use of methoprene. This work was supported by Grant IAA5007305 and Project Z5007907 from the Czech Academy of Sciences and Grant LC07032 from the Czech Ministry of Education. B.K. was supported by Student Grant 23/2005/ P-BF from the University of South Bohemia. 23. 24. 25. 26. 27. 28. 29. 30. 31. 32. 33. 34. 35. 36. 37. 38. 39. 40. 41. 42. Shemshedini L, Wilson TG (1990) Proc Natl Acad Sci USA 87:2072–2076. Miura K, Oda M, Makita S, Chinzei Y (2005) FEBS J 272:1169–1178. Flatt T, Tu M-P, Tatar M (2005) BioEssays 27:999–1010. Godlewski J, Wang S, Wilson TG (2006) Biochem Biophys Res Commun 342:1305–1311. Wilson TG, Yerushalmi Y, Donnell DM, Restifo LL (2006) Genetics 172:253– 264. Wilson TG, Ashok M (1998) Proc Natl Acad Sci USA 95:14040–14044. Wilson TG, Wang S, Beno M, Farkas R (2006) Mol Gen Genom 276:294–303. Moore AW, Barbel S, Jan LY, Jan YN (2000) Proc Natl Acad Sci USA 97:10436–10441. Wang S, Baumann A, Wilson TG (2007) J Insect Physiol 53:246–253. Kostyukovsky M, Chen B, Atsmi S, Shaaya E (2000) Insect Biochem Mol Biol 30:891–897. Socha R, Sehnal F (1972) J Insect Physiol 18:317–337. Roberts PE, Willis JH (1980) J Embryol Exp Morphol 56:107–123. Bouhin H, Charles JP, Quennedey B, Delachambre J (1992) Dev Biol 149:112– 122. Slama K (1976) Coll Int CNRS 251:499–506. Connat JL, Delbecque JP, Glitho I, Delachambre J (1991) J Insect Physiol 37:653–622. Zhou B, Riddiford LM (2001) Dev Biol 231:125–137. MacWhinnie SGB, Allee JP, Nelson CA, Riddiford LM, Truman JW, Champlin DT (2005) Dev Biol 285:285–297. Crews ST, Fan CM (1999) Curr Opin Genet Dev 9:580–587. Bucher G, Klingler M (2004) Development (Cambridge, UK) 131:1729–1740. Tomoyasu Y, Denell RE (2004) Dev Genes Evol 214:575–578. DEVELOPMENTAL BIOLOGY 1. Kukalova-Peck J (1991) in The Insects of Australia (Melbourne Univ Press, Carlton, Australia), Vol 1, pp 141–179. 2. Sehnal F, Svacha P, Zrzavy J (1996) in Metamorphosis. Postembryonic Reprogramming of Gene Expression in Amphibian and Insect Cells, eds Gilbert LI, Tata JR, Atkinson BG (Academic, San Diego), pp 3–58. 3. Wigglesworth VB (1934) Q J Microsc Sci 77:191–222. 4. Wigglesworth VB (1936) Q J Microsc Sci 79:91–121. 5. Riddiford LM (1994) Adv Insect Physiol 24:213–274. 6. Dubrovsky EB (2005) Trends Endocrinol Metabol 16:6–11. 7. Fukuda S (1944) J Fac Sci Tokyo Univ Sec IV 6:477–532. 8. Williams CM (1961) Biol Bull 121:572–585. 9. Connat JL, Delbecque JP, Delachambre J (1984) J Insect Physiol 30:413–419. 10. Kikukawa S, Tobe SS (1986) J Insect Physiol 32:1035–1042. 11. Quennedey A, Quennedey B (1999) Cell Tissue Res 296:619–634. 12. Tan A, Tanaka H, Tamura T, Shiotsuki T (2005) Proc Natl Acad Sci USA 102:11751–11756. 13. Sehnal F, Zdarek J (1976) J Insect Physiol 22:673–682. 14. Ashburner M (1970) Nature 227:187–189. 15. Postlethwait JH (1974) Biol Bull 147:119–135. 16. Riddiford LM, Ashburner M (1991) Gen Comp Endocrinol 82:172–183. 17. Zhou X, Riddiford LM (2002) Development (Cambridge, UK) 129:2259–2269. 18. Gilbert LI, Granger NA, Roe RM (2000) Insect Biochem Mol Biol 30:617–644. 19. Wheeler DE, Nijhout HF (2003) BioEssays 25:994–1001. 20. Goodman WG, Granger NA (2005) in Comprehensive Molecular Insect Science, eds Gilbert LI, Iatrou K, Gill SS (Elsevier, Oxford), Vol 3, pp 319–408. 21. Wilson T, Fabian J (1986) Dev Biol 118:190–201. 22. Ashok M, Turner C, Wilson TG (1998) Proc Natl Acad Sci USA 95:2761–2766. Scanning-Electron Microscopy. Samples were fixed in 80% ethanol, SEE COMMENTARY just after ecdysis were anesthetized with CO2 and injected into abdomens with dsRNA at concentration 5 g/l until inflation was visible (42). Insects were then kept individually in 24-well microtiter plates supplied with food and were checked daily to count all ecdyses until a developmental arrest occurred. Konopova and Jindra PNAS 兩 June 19, 2007 兩 vol. 104 兩 no. 25 兩 10493 Supporting Results Supporting Fig. 6 Tribolium Aedes Dm_Gce Apis Dm_Met 1 1 1 1 1 --------MDSGDCETEEDSAPEACVSPEGSLLPSNSREMRNRAEKMRRDKLNSYIGELA ------------MKVKFAKLFCIRLALTSAYCKIRNGREARNRAEKNRRDKLNGSIQELS -----------------------------MQTAVQNGREARNRAEKNRRDKLNGSIQELS ------------------------------------------MAEKQRRDNLNTNISAMA MAAPETGNTGSTGSAGSTGSGSGSGSGSGSSSDPANGREARNLAEKQRRDKLNASIQELA Tribolium Aedes Dm_Gce Apis Dm_Met 53 49 32 19 61 TLVPMVARSAKRMDKTSILRLAATHLRIYQTLLSGKNHPHIQLPKHVDQ----------GMVPHVAESPRRVDKTAVLRFSAHALRLKYVFDTEQEQTKQEPSENAAG----------TMVPHVAESPRRVDKTAVLRFAAHALRLKHAFGNSLMQQRP------------------ALVPTVAESPRKMDKISILRLAANFLRIHYTVGRGVSDFLPRELGDLDL----------TMVPHAAESSRRLDKTAVLRFATHGLRLQYVFGKSASRRRKKTGLKGTGMSASPVGDLPN Tribolium Aedes Dm_Gce Apis Dm_Met 102 98 73 68 121 --YLLEQLVCEQLGGFLLILTPNGKIVFVSHTVEHLLGHLQTDLMGQSIFNITSPDDHDR QKTEVHDALFRMLNGFLLTVTCRGQIVLVSASVEHFLGHCQTDLYGQNLFNLIHPDDHNL ---QITDTLMDMLDSFFLTLTCHGHILLISASIEQHLGHCQSDLYGQSIMQITHPEDQNM --EQYIGDNLIKNGSFFIVVTTTGKIVYVSRQVQEHLGHTQADLLGHSLYAFIHPKDEEE PSLHLTDTLMQLLDCCFLTLTCSGQIVLVSTSVEQLLGHCQSDLYGQNLLQITHPDDQDL Tribolium Aedes Dm_Gce Apis Dm_Met 160 158 130 126 181 LRMYIN---TESVLDGDWK----------------------------------------LKQQLVPNNLVNLFDSAVSAPSTSRTSSGTETSAE---------------------EQQR LKQQLIPTELENLFDAHGDSDAEGEP------------------------------RQRS LARNLNPDEMQGVVSSLPQITDGTND-------------------------------NSN LRQQLIPRDIETLFYQHQHHQQQGHNPQQHSTSTSASASGSDLEEEEMETEEHRLGRQQG Tribolium Aedes Dm_Gce Apis Dm_Met 176 197 160 155 241 ----------------------------------KCFNIRLKRAGPRTESA-VYEPVRIM KSQDEED-----------------EIDRKLRQDRRKFTLRIARAGPRSEPT-AYELVTID KAEED-------------------AIDRKLREDRRSFRVRLARAGPRSEPT-AYEVVKID SSEDSTS----------------SKNGKTFQNQRRTFELRMLHRTSSRREHTQYEWFEFS EADDDEDHPYNRRTPSPRRMAHLATIDDRLRMDWRCFTVRLARASTRAEATRHYERVKID Tribolium Aedes Dm_Gce Apis Dm_Met 201 239 200 199 301 GVHRPGFDNDCNKNTST-----------------------------------------SK GFFRRADAAPRGERPSG-PSGLQLLRRARG-------------------RDDGIT---LQ GCFRRSDEAPRGVRSNHFSSNLQLIRRTRG-------------------RDDVIP---LH GILRLADACKTSTSNVNRSRHR------------------------------------EI GCFRRSDSSLTGGAAANYPIVSQLIRRSRNNNMLAAAAAVAAEAATVPPQHDAIAQAALH Tribolium Aedes Dm_Gce Apis Dm_Met 220 276 238 223 361 EIALNNDVLLFFVKVFR---PEPLCE--------RLFEASREEYVTRHLIDGRIIGCDQR SINGNDIVLVAVARVQK---VPTICD--------RLIEACRYEYKTRHLIDGRIVQCDHR TISGNDIILTGCARIIR---PPKIAS--------RLIDANTLEYKTRHLIDGRIIDCDQR TSTSNDIVFVGVAQLLMK-QPLTKIS---------IIDANKNEYITRHLVDGRIIYCDHR GISGNDIVLVAMARVLREERPPEETEGTVGLTIYRQPEPYQLEYHTRHLIDGSIIDCDQR Tribolium Aedes Dm_Gce Apis Dm_Met 269 325 287 273 421 ISFIAGYMTEEVSGLSAFKFMHREDVRWVMIALRQMYDRGESKGSSCYRLLSRNGQFIYL ISVVAGYLTTEVSGLSPFTFMHKDDVRWVIVALRQMYDYSQNYGESCYRLMTRTGDFVYL IGIVAGYMTDEVRNLSPFTFMHNDDVRWVIVALRQMYDCNSSYGESTYRLFTRNGNIIYL VSVVAGYLSEEVSGMSAFGFMHKDDRIWAMVALRQMYDRAETCGSSCYRLTSKTGEPIYL IGLVAGYMKDEVRNLSPFCFMHLDDVRWVIVALRQMYDCNSDYGESCYRLLSRNGRFIYL Tribolium Aedes Dm_Gce Apis Dm_Met 329 385 347 333 481 RTFGFLEIDDQG-TVESFVCVNTLVSEQEGLQLINEMKKRYSALINSQSCPITSSG---KTRGYLEVDDSSKKVQSFVCINTLVSDEEGRRLVREMKHKFSVIVEADELP--------QSKGYLEIDKETNKVHSFVCVNTLLGEEEGKRRVQEMKKKFSVIINT-QIP--------RTHGYLEVDKDTQIAVSLVCINTLVSEEEGIQLMQQMKKRFSATISETMRAIIQNGDDAS HTKGFLEVDRGSNKVHSFLCVNTLLDEEAGRQKVQEMKEKFSTIIKA-EMPTQ------- 1 Supporting Fig. 6 (Continued) Tribolium Aedes Dm_Gce Apis Dm_Met 384 436 397 393 533 -------STDSSSQSVEDPQQVEAAIVHLIANLPSPG------------------------------DESDEPAVENPTQIEKAVLNLLTNLHSEDDEPSERALPSNTSQETDGSEGSQ -------QSTIDVPASEHPALLEKAVLRLIQNLQKSGENGGH-----DDGDEDDDAQDGD IDLGSDSQNPNSKSNMEDPAQLEDAITYLVSDLSSPLPEDCLSPPTQNEQYAKAAMISQH -------SSSPDLPASQAPQQLERIVLYLIENLQKS------------------------ Tribolium Aedes Dm_Gce Apis Dm_Met 414 488 445 453 562 -----------------------------SDQRSTPSPRVYGN----------------LAIIAPSSKAVKSAIVKSMNVIAIASKKMSNGSNSPLRDSTGASPRSKDHSGSPSAIITM DDEEDDDDDQDD-----------------GARSMSEFGDPYGSHHGRSHHG---SSALSS LPPAEAQARRLG--------IKKIDRYLMVQAKATNNQKSESKTNNNKNNSNERQENTRS ----VDSAETVG-----------------GQGMESLMDDGYSSP----------ANTLTL Tribolium Aedes Dm_Gce Apis Dm_Met 428 548 485 505 591 -------------------------------------VNENQDCSTPTENSPTKPYYKLK QRPSVLQKAHSPALESRVPPLHGTDHDFIQPFSPAGSTSSSSSSSGSVFSPASHQRNSRS HG---HGNAKTPPLALVPP--------------EASSVKSAITKSISVVNVTAAKHLRGI SRKTVHEVTKQTRNSTQDE--------------QNSSRINNMSNVESCVNTQRKPGISQL EE---LAPSPTPALALVPP--------------APSSVKSSISKSVSVVNVTAARKFQQE Tribolium Aedes Dm_Gce Apis Dm_Met 451 608 528 551 634 TANNKRPPSTELGTNIYTSSKRQRTSPQLSPMSSLPPYPNRTQITEVTQQTEP------PFGGSIPPTSPPAIAATPSTSVSRIVDNTASGHSRSISVLKRTHSNSCLDSSDGSSIGHT HASTAVKSPSSLGSCTCSDS--HSPCDFCQGAPTTDLQAVGSNLKRGSTAHVE------T ELHQNVDILNPNTTVKKPVATVENNPCNVKIERNMDVYTPETMIEYFEKNAID-----NN HQKQRERDREQLKERTNSTQGVIRQLSSCLSEAETASCILSPASSLSASEAPD------T Tribolium Aedes Dm_Gce Apis Dm_Met 504 668 580 606 688 -------------------------------------SIYQHDQLLRNKV---------ADFVVQKRPKINTILDLDTCRTRLSNPATDLITMLPQAFHAVDQSLLKVDDDTAKLRAQV EEKLSKRRF----------------IPSTEIEHVLHTSLDQIGRNLTQQLNVARNLREQS SDLKSHPYP----------------LKRIYSDEDIKTGCTKKRQYNNVPYASSDTSDEQN PDPHSNTSP----------------PPS------LHTRPSVLHRTLTSTLR--------- Tribolium Aedes Dm_Gce Apis Dm_Met -----------------------------------------------------------728 SGYENLQGKSLQQLDSIVEASHEQRNVLQSIKQELTQFQSNNGSNDQDGAGGRGPIVVND 624 QRYELPHAN--QRFDEIMQEHQKQSELYVNIKSEYEVQLQHKASTRKSSDSDRN-----650 ISYIDCKPFVDEEFSELSTDFNNINPQSLKIAESPNSSLSEVITDYQQVDSSIPLIAPNP ------------------------------------------------------------ Tribolium Aedes Dm_Gce Apis Dm_Met -----------------------------------------------------------788 LLPGGGAIVDDLDPPSLMMEDFPSDSSNLMADLDNNGSLLEGDSPLEFFSSINTPLISPT 676 ---------QEQPPPPLQEDDQD------------------------------------710 ELEAEYGDLQDNSLLSPGLEANPGTELSTVTLHLQTK---------------------------------------------------------------------------------- Tribolium Aedes Dm_Gce Apis Dm_Met ------------------------------------848 TATASVITSSRSVGGTGTGGASGTAGSFYQGADLNPS ------------------------------------------------------------------------------------------------------------- Supporting Fig. 6. Alignment of Tribolium castaneum Met with related proteins from Aedes aegypti (EAT47132), Apis mellifera (XP_395005) and two Drosophila melanogaster proteins, Met (AAC14350) and Gce (NP_511160). The Tribolium protein can be accessed under EF468474 or XM_961449 (amino acid residues 70-585). Conserved domains are indicated with lines above the sequence: bHLH (red), PAS-A (green), PAS-B (blue) and PAC (yellow). 2 Supporting Fig. 7. Phylogenetic analysis. The indicated proteins were aligned by using the ClustalW algorithm implemented in the MEGA 3.1 software (Kumar S, Tamura K, Nei M. 2004. Briefings in Bioinformatics 5:150-163), and the combined conserved domains (outlined in Supporting Fig. 6) were used for construction of phylogenetic trees. (A) Neighbor-joining plot generated by MEGA 3.1 with bootstraping using 5000 replicates. (B) A plot generated with the Treepuzzle maximum likelihood algorithm (http://bioweb.pasteur.fr/seqanal/interfaces/Puzzle.html) (Schmidt HA, Strimmer K, Vingron M, von Haeseler A. 2002. Bioinformatics 18:502-504) using standard settings. Both trees reveal essentially the same information. The Drosophila melanogaster bHLH-PAS protein Spineless (Ss) (NP_476748) served as an outgroup in both types of analysis. 3 Supporting Fig. 8. Anti-metamorphic effect of methoprene on Tribolium. Topical application of methoprene at the beginning of the eighth (final) larval instar produced supernumerary larvae. A giant larva that has reached its eleventh instar (i.e., it completed 10 postembryonic ecdyses) is shown on top in comparison with a normal sized eighth instar larva treated only with acetone. 4
© Copyright 2026 Paperzz