Volume 26, Number 7 by Christina Hood, German Fuentes, Hirendra Patel, Karen Page, Mahendra Menakuru, and Jae H. Park TECHNICAL ARTICLE Low-Cost, Fast, Conventional Peptide Synthesis With HCTU and Automated Peptide Synthesizers Out of a concern for purity and yield, many peptide chemists today choose to extend their reaction times excessively in order to obtain as high a purity and yield as possible. Typical reaction times for conventional Fmoc solid-phase peptide synthesis (SPPS) are deprotection times of 10–30 min, and coupling times of 20 min to over an hour, which can result in cycle times of up to 2 hr. As a result, conventional peptide synthesis chemistry is perceived as slow, but this is not necessarily the case. Historically, the biggest contribution to increasing the speed of peptide synthesis was undoubtedly the invention of solid-phase peptide synthesis by Bruce Merrifield in 1963. 1 By attaching the growing peptide chain to a solid support, his method eliminated time-consuming purification steps and paved the way for automating the process. Since then, advances in automation and chemistry have made it possible to increase the speed at which peptides can be made. Most chemistry methods have focused on the development of more efficient activators for the coupling step. O-benzotriazole-N,N,N′,N′-tetramethyluronium hexafluorophosphate (HBTU) was the first of these activators, and was introduced in 1990 for performing FastMoc™ chemistry (Applied Biosystems, Foster City, CA) with coupling times of 10–30 minutes.2 In 1993, Carpino introduced the activator O-(7azabenzotriazole-1-yl)-N,N,N′N′-tetramethyluronium hexafluorophosphate (HATU), which was used four years later by Alewood and Miranda to perform 1–2 min couplings with Boc chemistry.3,4 Similar fast methods have not been developed for Fmoc chemistry, and for many laboratories, HATU is too expensive to use for all but the most difficult couplings. In 2002, the activator 1H-benzotriazolium 1-[bis(dimethylamino)methylene]-5-chlorohexafluorophosphate (1-),3-oxide (HCTU) was introduced by Luxembourg Laboratories (Rehovat, Israel), and is available at a significantly lower price than HATU.5 The authors tested the efficiency of HCTU by synthesizing a phosphorylated peptide (H- CRRKGpSQKVS-NH 2 ) using HBTU and HCTU, and found that HCTU produced the higherpurity peptide (data not shown). They then synthesized the 65–74 fragment of the acyl carrier protein (65–74ACP) (H-VQAAIDYING-OH) using HCTU; HATU; HBTU; benzotriazol-1-yl-oxytripyrrolidinophosphonium hexafluoro-phosphate (PyBOP); and O-(benzotriazol-1-yl)-N,N,N′,N′-tetramethyluronium tetrafluoroborate (TBTU). They found that HCTU and HATU produced peptides of extremely similar purity, while the remaining activators had additional impurities (data not shown). From this, it was concluded that HCTU was a highly efficient coupling reagent. The goal was to synthesize peptides as quickly and inexpensively as possible. The authors were able to achieve extremely rapid coupling times using the activator HCTU. This paper demonstrates this on seven peptides with a variety of properties: long, short, hydrophobic, hydrophilic, cyclic, and peptides containing D-amino acids and pseudoproline dipeptides. Table 1 Summary of reaction and synthesis times for linear peptides; peptide lengths are also given Peptide GHRP-6 Oxytocin 65–74 ACP G-LHRH C-peptide hAmylin1–37 β-Amyloid1–42 a b Length 6-mer 9-mer 10-mer 10-mer 31-mer 37-mer 42-mer Dep. time 2 × 30 sec 2 × 30 sec 2 × 30 sec 2 × 30 sec 2 × 1.5 min 2 × 1 min 2 × 1 min Coup. time 2 × 1 min 2 × 1 min 2 × 1 min 2 × 1 min 2 × 2 min 2 × 2.5 min 1 × 5 min Cycle timea 14 min 14 min 14 min 14 min 18 min 19 min 17 min Synth. timeb 1.4 hr 2.1 hr 2.1 hr 2.3 hr 9 hr 10.8 hr 11.6 hr Determined from Prelude with 0.5 min × 6 DMF top washes. Cycle time × number of cycles. Experimental Peptides were synthesized as described previously on either a Symphony® or Prelude™ peptide synthesizer from Protein Technologies, Inc. (Tucson, AZ).6 The Prelude automated peptide synthesizer was used to save money on expensive monomer additions, because its Single-Shot™ delivery feature delivers the entire contents of an amino acid bottle to a specified reaction vessel without priming or waste. HPLC and mass spectrometry analysis were also carried out as described previously.6 Results and discussion Figure 1 HPLC of crude GHRP-6. This 6-mer peptide was synthesized in 1.4 hr with 2 × 30 sec deprotection times and 2 × 1 min coupling times. Using HCTU as the coupling reagent, the authors were able to synthesize the shorter peptides (10 residues or less) using 1-min deprotection times and 2-min coupling times. The reaction times for the longer peptides (over 30 residues) were reduced to 2–3 min for deprotection and 5 min for coupling, resulting in cycle times of 14–19 min (Table 1). Specific results for each peptide are detailed below. a Peptide containing D-amino acids GHRP-6 (H-HwAWfK-NH2) is a growth hormone releasing peptide that contains two amino acids with D-configuration (D-Trp and D-Phe).7 GHRP-6 was synthesized with 2 × 30 sec deprotection times and 2 × 1 min coupling times, resulting in a total synthesis time of 1.4 hr (Figure 1). D-amino acids were added using the SingleShot delivery feature on the Prelude. b Oxytocin Oxytocin (H-CYIQNCPLG-NH 2) is a component of the prohormone. It is located at the N-terminal end of the sequence and contains a disulfide bridge between Cys-1 and Cys-6. Linear oxytocin was synthesized with deprotection times of 2 × 30 sec and coupling times of 2 × 1 min, resulting in a total synthesis time of 2.1 hr (Figure 2a). It was cyclized on the resin for 2 × 40 min using thallium (III) trifluoroacetate delivered by the Prelude’s Single-Shot delivery feature prior to cleavage (Figure 2b). The cyclization time was not optimized. Figure 2 HPLCs of crude a) linear and b) cyclized oxytocin. The 9-mer linear peptide was synthesized in 2.1 hr with 2 × 30 sec deprotection times and 2 × 1 min coupling times. It was then cyclized for 2 × 40 min for a total synthesis time of 3.4 hr. continued 22 / JUNE/JULY 2008 • AMERICAN BIOTECHNOLOGY LABORATORY B.pg22-25.Hood.LO.indd 1 6/11/08 10:32:34 AM Volume 26, Number 7 TECHNICAL ARTICLE control of the Symphony and Prelude peptide synthesizers. G-LHRH was synthesized in 2.3 hr using deprotection times of 2 × 30 sec and coupling times of 2 × 1 min (Figure 4). a C-peptide Chain A of the human proinsulin C-peptide9 (H-EAEDLQVGQVELGGGPGAGSLQPLALE GLG-OH) (Q is replaced with G) was synthesized using reaction times of 2 × 1.5 min and 2 × 2 min for deprotection and coupling, respectively, in a total synthesis time of 9 hr (Figure 5). Figure 3 HPLC of crude 65–74ACP. This 10-mer peptide was synthesized in 2.1 hr with 2 × 30 sec deprotection times and 2 × 1 min coupling times. Human amylin1–37 Human amylin1–37 (H-KCNTATCATQRLA NFLVHSSNNFGAILSSTNVGSNTYNH2) is a major component of the amyloid deposits found in the pancreases of type-II diabetes patients and contains a disulfide bridge between Cys-2 and Cys-7. 10 Linear hAmylin 1–37 was synthesized with deprotection times of 2 × 1 min, and acylation times of 2 × 2.5 min, resulting in a total synthesis time of 10.8 hr (Figure 6a). Pseudoproline dipeptides were incorporated into the sequence using the Prelude’s Single-Shot delivery feature. Fmoc-Ala-ThrΨMe,Mepro-OH was coupled at position A8T, Fmoc-Ser-Ser-Ψ Me,Mepro-OH was coupled at S 19S, and Fmoc-Leu-Ser-Ψ Me,Mepro-OH was coupled at position L 27S. The peptide was then cyclized on the resin in 10 min by treatment with thallium (III) trifluoroacetate delivered by the Prelude’s Single-Shot delivery feature, producing the cyclized peptide in a total synthesis time of 11 hr (Figure 6b). Figure 4 HPLC of crude G-LHRH. This 10-mer peptide was synthesized in 2.3 hr with 2 × 30 sec deprotection times and 2 × 1 min coupling times. b Figure 6 HPLCs of crude a) linear and b) cyclized hAmylin1-37. The 37-mer linear peptide was synthesized in 10.8 hr with 2 × 1 min deprotection times and 2 × 2.5 min coupling times. It was then cyclized in 10 min for a total synthesis time of 11 hr. a β-Amyloid1–42 Synthesis of the human β-amyloid1-42 peptide (H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH) by conventional SPPS has been reported to be difficult due to on-resin aggregation and the high hydrophobicity of the C-terminal segment.11 The authors synthesized β-amyloid1–42 with deprotection times of 2 × 1 min and acylation times of 1 × 5 min for a total synthesis time of 11.6 hr (Table 1, Figure 7a). The peptide was then purified by analytical HPLC (Figure 7b). The HPLC product peaks were slightly broadened, as seen before with this peptide.12 Figure 5 HPLC of crude C-peptide. This 31-mer peptide was synthesized in 9 hr with 2 × 1.5 min deprotection times and 2 × 2 min coupling times. The 65–74 fragment of the acyl carrier protein 65–74 ACP is a well-known diffi cult sequence used to test new synthesis protocols and used at Protein Technologies, Inc. for quality control purposes. ACP was synthesized with 2 × 30 sec deprotection times and 2 × 1 min couplings for a total synthesis time of 2.1 hr. HPLC analysis of the crude peptide showed a significant prepeak due to incomplete coupling of the valine (data not shown). However, it was found that this prepeak could be eliminated by coupling the valine in 1:1 dimethylformamide:dimethylsulfoxide (DMF:DMSO) for 2 × 5 min (Figure 3).8 G-LHRH G-LHRH (H-GHWSYGLRPG-NH2) is a modified version of the luteinizing hormone releasing hormone, and is also used as a test peptide for quality b Conclusion The authors demonstrated that HCTU is a highly efficient coupling agent by using it to synthesize seven peptides with deprotection times of 3 min or less and coupling times of 5 min or less. Combining fast chemistry with peptide synthesizers like the Prelude or Symphony, which have been optimized for fast fluid deliveries, resulted in cycle times as short as 14 min. Cost-savings were realized using HCTU as a less expensive activator, and minimizing reagent loss with the Prelude’s Single-Shot delivery feature. Figure 7 HPLCs of a) crude and b) purified human β-amyloid1-42. This 42-mer peptide was synthesized in 11.6 hr with 2 × 1 min deprotection times and 1 × 5 min coupling times. References 1. 2. Merrifield, R.B. Solid phase peptide synthesis 1. Synthesis of a tetrapeptide. J. Am. Chem. Soc.1963, 85, 2149–54. a) FastMocTM chemistry: HBTU activation chemistry in peptide synthesis on model 430A 1990; Applied Biosystems. b) Fields, C.G.; Lloyd, D.H.; Macdonald, R.L.; Otteson, K.M.; Noble, R.L. HBTU activation for automated Fmoc solid-phase peptide synthesis. Peptide Res. 1991, 4, 95–101. c) Schnolzer, M.; Alewood, P.; Jones, A.; Alewood, D.; Kent, S.B.H. In situ neutralization in Boc-chemistry solid phase peptide synthesis. Int. J. Pep. Protein Res. 1992, 40, 180–93. 24 / JUNE/JULY 2008 • AMERICAN BIOTECHNOLOGY LABORATORY B.pg22-25.Hood.LO.indd 2 6/11/08 10:32:42 AM Volume 26, Number 7 TECHNICAL ARTICLE 3. 4. 5. 6. 7. 8. Carpino, L.A. 1-Hydroxy-7-azabenzotriazole. An efficient peptide coupling additive. J. Am. Chem. Soc. 1993, 115, 4397–8. Alewood, P.; Alewood, D.; Miranda, L.; Love, S.; Meutermans, W.; Wilson, D. Rapid in situ neutralization protocols for Boc and Fmoc solid-phase chemistries. Meth. Enzymol. 1997, 289, 14–29. a) Marder, O.; Shvo, Y.; Albericio, F. HCTU and TCTU: new coupling reagents: development and industrial aspects. Chim. Oggi 2002, 20, 37–41. b) Sabatino, G.; Mulinacci, B.; Alcaro, M.C.; Chelli, M.; Rovero, P.; Papini, A.M. Assessment of new 6-ClHOBt based coupling reagents for peptide synthesis. Part 1: coupling efficiency study. Lett. Pept. Sci. 2002, 9, 119–23. c) Sabatino, G.; Alcaro, M.C.; PozoCarrero, M.D.L.; Chelli, M.; Rovero, P.; Papini, A.M. Assessment of 6Cl-HOBt based coupling reagents in solid-phase cyclopeptide synthesis. In Peptides 2003; Chorev, M.; Sawyer, T.K., Eds.; American Chemical Society: Cardiff, CA, 2004; pp 49–50. Hood, C.A.; Fuentes, G.; Patel, H.; Page, K.; Menakuru, M.; Park, J.H. Fast conventional Fmoc solid-phase peptide synthesis with HCTU. J. Pep. Sci. 2008, 14(1), 97–101. Muccioli, G.; Tschop, M.; Papotti, M.; Deghenghi, R.; Heiman, M.; Ghigo, E. Neuroendocrine and peripheral activities of ghrelin: implications in metabolism and obesity. Eur. J. Pharmacol. 2002, 440, 235–54. a) Fuentes, G.; Hood, C.; Page, K.; Patel, H.; Park, J.H.; Menakuru, M. Fast conventional synthesis of 65–74 ACP on the Symphony® and Prelude™. European B.pg22-25.Hood.LO.indd 3 9. 10. 11. 12. Peptide Symposium 2007; www.peptideinstruments. com/doc_files/doc_5.pdf (last accessed Mar 2008). Heath, W.F.; Belagaje, R.M.; Brooke, G.S.; Chankce, R.E.; Hoffmann, J.A.; Long, H.B.; Reams, S.G.; Roundtree, C.; Shaw, W.N.; Slieker, L.J.; Sundell, K.L.; Dimarchi, R.D. (A-C-B) human proinsulin, a novel insulin agonist and intermediate in the synthesis of biosynthetic human insulin. J. Biol. Chem. 1992, 267, 419–25. Page, K.; Hood, C.; Patel, H.; Fuentes, G.; Menakuru, M.; Park, J.H. Fast Fmoc synthesis of hAmylin1–37 with pseudoproline assisted on-resin disulfide formation. J. Pep. Sci. 2007, 13, 833–8. a) Quibell, M.; Turnell, W.G.; Johnson, T. Preparation and purification of β-amyloid (1–43) via soluble, amide backbone protected intermediates. J. Org. Chem. 1994, 59, 1745–50. b) Tickler, A.; Clippingdale, A.B.; Wade, J.D. Amyloid-β as a “difficult sequence” in solid phase peptide synthesis. Protein and Peptide Letters 2004, 11, 377–84. Burdik, D.; Soreghan, B.; Kwon, M.; Kosmoksi, J.; Knauer, M.; Henschen, A.; Yates, J.; Cotman, C.; Glabe, C. Assembly and aggregation properties of synthetic Alzheimer’s A4/beta amyloid peptide analogs. J. Biol. Chem. 1992, 267, 546–54. The authors are with Protein Technologies, Inc., 4675 S. Coach Dr., Tucson, AZ 85714, U.S.A. ; tel.: 520-629-9626; fax: 520-629-9806; e-mail: [email protected]. All tables and figures were adapted from Ref. 6. 6/11/08 10:33:16 AM
© Copyright 2026 Paperzz