Supporting Information Wiley-VCH 2014 69451 Weinheim, Germany Irreversible Denaturation of Proteins through Aluminum-Induced Formation of Backbone Ring Structures** Bo Song,* Qian Sun, Haikuo Li, Baosheng Ge, Ji Sheng Pan, Andrew Thye Shen Wee, Yong Zhang, Shaohua Huang, Ruhong Zhou, Xingyu Gao,* Fang Huang,* and Haiping Fang anie_201307955_sm_miscellaneous_information.pdf 1. DETAILS OF APPLIED METHODS 1.1 Calculations using ab initio methods. The calculations of the short peptide HCO-Ala-NH2 (C4N2O2H8) were performed using an ab initio method based on the second-order Møller-Plesset perturbation theory (MP2).[23] To realize the relaxation on the long peptide HCO-[Ala]5-NH2, we applied an ab initio method based on the density functional theory (DFT), where the B3LYP functional[s1,s2] within the generalized gradient approximation (GGA) in the framework of DFT was used. The 6311++G(d,p) basis set of triple-Zeta quality and including diffuse functions was applied on all atoms. The calculations were carried out using the Gaussian-09 package.[s3] The initial state in the calculations was: the peptide HCO-Ala-NH2 (C4N2O2H8) and a hydrated Al ion [AlOH(H2O)4]2+ separated by a far distance (Fig. 1a). Here, the five-coordinate hydrated Al ion with two positive charges was applied for the biochemically critical pH range of 4.3 to 7.0.[22] (I) The binding energy Ebinding ( Al) of the Al ion bound with the oxygen in the backbone of State I (Fig. 1b) was calculated via the following formula: (I) E binding ( Al ) = E ([C 4 N 2 O 2 H 8 AlOH(H 2 O) 3 ]2 + ) + E ( H 2 O) − E (C 4 N 2 O 2 H 8 ) − E ([ AlOH(H 2 O) 4 ]2 + ), where E([C4N2O2H8AlOH(H2O)3]2+) denotes the energy of the peptide with the hydrated Al ion bound in State I, E(H2O) indicates the energy of a water molecule, while E(C4N2O2H8) stands for the energy of the pristine peptide, and E([AlOH(H2O)42+]) for the energy of the pristine hydrated Al ion. (I) The binding energy Ebinding (M ) (M = Na, K, Mg or Ca) of the M ion bound with the oxygen in the backbone of State I was calculated via the following formula: (I) Ebinding (M ) = E ([C 4 N 2O 2 H8 M(H 2O)5 ]n + ) + E (H 2O) − E (C 4 N 2O 2 H8 ) − E ([M(H 2O)6 ]n + ), where n = 1 when M = Na or K, and n = 2 when M = Mg or Ca. E([C4N2O2H8M(H2O)5]n+) denotes the energy of the peptide bound with the hydrated M ion in State I, and E([M(H2O)6]n+) indicates the energy of the hydrated M ion. (II) ( Al) for State II (Fig. 1c) of the hydrated Al ion simultaneously binding The binding energy E binding to the atoms N1 and O2 in the peptide backbone was calculated via the following formula: (II) Ebinding (Al) = E ([C 4 N 2 O 2 H 7 AlOH(H 2 O) 2 ]+ ) + E ([H 3O]+ ) + E ([H 2 O]) − E (C 4 N 2 O 2 H 8 ) − E ([AlOH(H 2 O) 4 ]2+ ), where E([C4N2O2H7AlOH(H2O)2]+) denotes the energy of the peptide with the hydrated Al ion bound in State II, while E([H3O]+) indicates the energy of a hydronium ion consisting of the dropped hydrogen ion (H1) from the peptide and the dropped water molecule from the hydrated Al ion. (II) (M) for State II of the M ion in the hydrated group simultaneously The binding energy Ebinding binding to the atoms N1 and O2 in the peptide backbone was calculated via the following formula: (II) Ebinding (M ) = E ([C 4 N 2O 2 H 7 M(H 2O) 4 ]( n−1)+ ) + E ([H 3O]+ ) + E ([H 2O]) − E (C 4 N 2O 2 H 8 ) − E ([M(H 2O)6 ]n+ ). E([C4N2O2H7M(H2O)4](n-1)+) denotes the energy of the peptide with the hydrated M ion bound in State II. 1.2 Classical molecular dynamics simulations. We performed classical dynamics simulations using one poly-Ala peptide [Ala]5 in AlCl3 solution. The concentration of the Al ions was set at 50 mM. The simulations were carried out at a constant pressure of 1 bar, a temperature of 350 K and an initial box size of 5.0 nm × 5.0 nm × 5.0 nm with Gromacs 4.0,[s4] using the particle mesh Ewald method[s5] for full electrostatics with a cut-off of 1 nm. Considering that an Al ion in water usually binds to one hydroxyl group under the biochemically critical pH range of 4.3 to 7.0,[22] we applied a form of [Al-OH]2+. The Amber03 force field[s6] was used for the peptide, the Cl ions of AlCl3 in the solution, and the hydroxyl group of [Al-OH]2+. In order to maintain the +2 e charge of the [Al-OH]2+, based on the NBO analysis, we modeled the Al ion as the particle with a charge of qAl = +2.45 e. For the Lennard-Jones (L-J) potential of the Al ion, the cross-section and depth were set as σAl = 0.40 nm and εAl = 0.5045 kcal/mol, respectively.[s7] An Al-O bond length of 0.17 nm and Al-O-H bond angle of 128° were maintained by harmonic potentials with spring constants of 68,665 kcal/mol·nm-2 and 44 kcal/mol·rad-2 before relaxation, where the parameters were calculated based on the MP2 method. The TIP3P water model[s8,s9] was applied. A time step of 1 femtosecond (fs) was used, and data were collected every 1 picosecond (ps). 1.3 Circular dichroism spectra. Denaturation experiments were performed using several salts, including Al2(SO4)3, K2SO4, MgSO4 and CaSO4. Due to the poor solubility of Al3+ at neutral pH, the experiments were carried out at pH = 3.8. The final concentration of Al2(SO4)3 was 1 mM, while the concentrations of the other salts reached 2 mM. In all experiments, the N-terminal domain of PGK was dissolved in sodium acetate buffer (200 mM sodium acetate plus the corresponding salt, pH = 3.8) to keep the solution stable when Al2(SO4)3 was added. The concentration of the N-terminal domain of PGK was 30 µM. The denaturation experiments were carried out in the temperature between 278 and 368 K. 1.4 X-ray photoelectron spectra. For X-ray photoelectron experiments, the buffer solution, the protein concentration, and the preparation of irreversibly thermodenatured samples were the same as in the above-described circular dichroism experiments. Sample 1 was initially mixed with 1 mM Al2(SO4)3, and Sample 2 with both 1 mM Al2(SO4)3 and 2 mM MgSO4. After being irreversibly denatured and aggregated, the samples were transferred into centrifugal tubes with the bottom covered by a copper sheet, then centrifuged in horizontal centrifuge rotors at 18,000 × g for 30 minutes. The supernatants were discarded and the samples were washed twice with ultrapure water. In this way, the aggregated proteins depositing on the copper substrate were prepared as the samples for XPS experiments. The XPS experiments were performed using a VG ESCALAB 220i-XL instrument equipped with a monochromatic Al Ka (1486.7 eV photons), a concentric hemispherical analyser, and a magnetic immersion lens (XL lens) to increase the sensitivity of the instrument. The background pressure in the chamber was in the low 10−10 mbar range during analysis. The instrument was calibrated with pure gold. All spectra were recorded in the constant pass energy mode of the analyzer using the monochromatic Al Ka X-ray source. Survey spectra were recorded with a pass energy of 150 eV and a 1-eV step width. The narrow scans for high-resolution spectra were recorded with a pass energy of 20 eV and 0.1-eV step width. The spectra in Fig. 3 show that the Al 2s peak can be distinguished from the Cu 3s peak. 1.5 Calculations of Al-2s binding energy. Using an ab initio method based on the relativistic density functional theory, we calculated the binding energy of a core electron (CE) on the 2s level of Al (Al-2s) in the Al-involved molecule. To include the relativistic effects of the core electrons, we applied the exact two component method (X2C).[s10,s11] The P86 exchange[s12] and P86 correlation[s13] functional of the generalized gradient approximation was employed with self-interaction correction (SIC) according to Stoll et al[s14]. The STO-TZ2P basis set of triple-Zeta quality was applied on all atoms. The calculations were carried out with the BDF program package.[31] The binding energy of core electron on the 2s level of Al (Al-2s) in the Al-involved molecule was CE ( Al - 2 s ) = E ( Al - 2 s1) − E ( Al - 2 s 2) .[s15] Here, E(Al-2s2) denotes the calculated by the formula Ebinding energy of the neutral molecule that the Al-2s level is fully occupied with two electrons, E(Al-2s1) indicates the energy of the core-ionized molecule that the Al-2s level is half occupied with one electron. 2. FURTHER RESULTS AND DISCUSSIONS 2.1 Simulations and discussion of the Al ions contacting the O atoms on the peptide backbone Based on our classical molecular dynamics (MD) simulations, to determine the contact of the Al ions with the O atoms on the peptide backbone (labeled by Opb) in water, the smallest distance d between the Al ions and the kth Opb atom ( O kpb ) in the peptide was calculated per 10 snapshots. We specified the Al ion contacting the O kpb atom (i.e., no water molecule between Al and O kpb ) when d < 0.35 nm. In Fig. S1, there present the results of the smallest distance d. In many intervals of time (such as, t = 23.70 ~ 23.85 ns for O 2pb , 23.31 ~ 23.44 ns for O 3pb ), the smallest Al - O kpb distances are smaller than 0.35 nm, indicating the Al ions can conquer the potential barrier in water and contact the O kpb atoms during these times. The contacts are unstable in the MD simulations, because the charge −0.55 e of the Opb atom is weaker than the charge −0.80 e of the O atom in a water molecule (labeled by Owm), leading to the interaction of Al with Opb weaker than the interaction with Owm if only considering the electrical interaction within the classical force field. However, as suggested by the ab initio calculations in the main text, due to the charge transfer and the covalent bond between Al and Opb in the peptide, the interaction of Al with Opb is stronger of 27.05 kcal/mol than the interaction with Owm. Thus, we conclude that the O atoms on the backbone are able to absorb Al ion stably in the presence of water. Figure S1. Smallest distance (d) of the Al ions with the kth oxygen atom ( O kpb ) on the backbone of the poly-Ala peptide [Ala]5 with respect to the simulation time. Ignoring the terminal effect, we just consider the two oxygen atoms (black curve for k = 2 and red curve for k = 3) in the middle area of the peptide. The green line denotes the critical distance of 0.35 nm. The snapshot at 24 nm is presented in the inset. The cyan, blue, red, white and green balls represent carbon, nitrogen, oxygen, hydrogen and aluminum, respectively. The yellow ribbon represents the peptide backbone, while the dotted lines indicate the Al-O distance. There is no water molecule between the atoms Al and O 2pb . 2.2 Content of amino acids in the sequence The sequence of the applied N-terminal domain, containing residues 1 to 174 of the full-length PGK coded by 1PHP in Protein Data Bank, is as follows: MNKKTIRDVDVRGKRVFCRVDFNVPMEQGAITDDTRIRAALPTIRYLIEHGAKVILASHLGRPKGKVVEELRLD AVAKRLGELLERPVAKTNEAVGDEVKAAVDRLNEGDVLLLENVRFYPGEEKNDPELAKAFAELADLYVNDAF GAAHRAHASTEGIAHYLPAVAGFLMEKE It is rich in nonpolar and neural amino acids (such as glycine, alanine and valine), poor in negatively charged amino acids, and much poor in aromatic amino acids (Fig. S2). Figure S2. Content of amino acids in the N-terminal domain of PGK. In the left, middle and right highlighted areas, there are the nonpolar-and-neutral, aromatic and negatively-charged amino acids, respectively. 2.3 Further discussion on XPS results In X-ray photoelectron spectrum for the denatured PGK protein (Fig. S3), there are C 1s, N 1s,O 1s, Cu 2p3/2 and Cu 2p1/2 photoemission peaks together with three Cu LMM Auger peaks. The peak at about 76 eV (1753 kcal/mol) are mainly from Cu 3p overlapped with photoemission from Al 2p. The small features at about 120 eV (2767 kcal/mol) are from Al 2s and Cu 3s photoemission, which is well resolved in the XPS narrow scan as shown in Fig. 3 of the main text. Figure S3. Survey of X-ray photoelectron spectrum for the irreversibly denatured and aggregated PGK protein depositing on a copper substrate. (a) The sample of the PGK protein only mixed with Al ions. (b) The Sample of the PGK protein mixed with Al and Mg ions. The upper scale (green) shows the binding energy in the unit of kcal/mol. The Cu-related peaks come from the copper substrate that PGK deposits on. The Cu 3s photoemission peak with its binding energy comes from the Cu substrate oxidized slightly on the surface before the sample preparation ex situ, which is also confirmed from the Cu 2p XPS spectrum. The Al 2s binding energy of 117.3 eV (2705 kcal/mol) indicates that the aluminum in the sample does not come from the aluminum sulfate used in the solution, because those binding energies of trivalent Al ions are with much higher values. For example, Al 2s photoemission peak of aluminum sulfate was found at a binding energy of about 118.3 eV (2728 kcal/mol).[s16] In fact, the binding energy of 117.3 eV is more similar to the Al-2s binding energy of 117.8±0.2 eV in metallic aluminum (Fig. S4). Figure S4. X-ray photoelectron spectrum of oxidized Al metal. The red curve denotes the experimental results, fitted by the black and blue curves. The left peak at 117.8±0.2 eV falls in the area of metallic Al 2s. The right peak at 120.8±0.2 eV comes from Al 2s of Al2O3. 2.4 NMR results and discussion We have performed NMR experiments of an unstructured short peptide (RGDS) by Al2(SO4)3 and Na2SO4, together with the control experiment without sulfate salt. The concentration of the short peptide was 1 mM. In order to keep the same effect of sulfate ions, the concentration of Al2(SO4)3 and Na2SO4 was set to 4.5 mM and 13.5 mM, respectively. The experiments were carried out at pH = 3.8 with a sodium acetate buffer of 200 mM. All NMR experiments were performed on a Bruker AVANCE III 600 MHz spectrometer operating at 600.13 MHz. For all 1H-NMR experiments, the acquisition parameters were set as follows: Pulprog = p3919 gp, SW = 15 ppm, TD = 32 K, D1 = 2 S, NS = 256, T = 298.0 K, and the processing parameters: WDW = EM, LB = 0.3 Hz. For TOCSY experiment, the acquisition parameters were set as follows: Pulprog = mlevgpphprzf, SW1 = SW2 =15 ppm, TD (F2) = 2K, TD (F1) = 256, D1 = 1.5 S, D9 = 0.1 S, NS = 40, DS = 16, T = 298.0 K, and the processing parameters: TD (F2) = TD (F1) = 2K, WDW (F2) = WDW (F1) = QSINE, SSB (F2) = SSB (F1) = 2. Additionally, the Sodium Trimethylsilylpropionate (TSP) was used as an external reference in NMR experiments, and the intensity of NMR signals of all 1H-NMR spectra was determined by the intensity of TSP signals. To present the intensity of 1H-NMR signal clearly, the integration of the signal was carried out in the Bruker software TopSpin 2.1, and calibrated by the integral of the NMR signals of TSP. The NMR-signal integration value was determined via bias correction. Fig. S5. NMR spectra of an unstructured peptide RGDS. a) 1H-NMR spectra with Na2SO4 (upper curve), Al2(SO4)3 (middle curve) without sulfate salt (lower curve). b) 1H-1H TOCSY NMR spectra with no sulfate salt. c) Molecular structure of the peptide RGDS. In the case of no sulfate salt, four signals are observed in the region of chemical shift δ = 7.0 ~ 9.0 ppm (Fig. S5a), which fall in the area of H atom binding to amide N. As suggested by 1H-1H TOCSY NMR spectra (Fig. S5b), the signals S1 ~ S3 correspond to the three H atoms binding to the amide N on the backbone, and the signal S4 corresponds to the H atom binding to the amide N of the Arg residue (Fig. S5c). When Na2SO4 is added, as presented by the NMR-signal integration value in Table S1, the intensity of the four signals S1 ~ S4 simultaneously reduces to about one third of the intensity of the signals in the case without sulfate salt. This results from the screening effect of sulfate salt on NMR signals. Interestingly, when Al2(SO4)3 is added, the intensity of the signals S1 ~ S3 (corresponding to the HN on the backbone) further reduces to about two third of the intensity of the signals in the case of Na2SO4, while the intensity of the signal S4 corresponding to the HN of the Arg residue is still similar to the intensity of the signal in the case of Na2SO4 (seeing Table S1). It should be noticed that the Al-ion concentration (9.0 mM) is only one third of Na-ion concentration (27.0 mM), to keep the same concentration of sulfate ions (13.5 mM). Therefore the additional reduction of the first-three-signal intensities can be assigned to the substitution of HN by Al, and the substituted HN atoms cannot be distinguished from the water signal in the 1H-NMR. Table S1. Integration value of the 1H-NMR signal of the amide H atom in the peptide RGDS. The integration value indicates the intensity of the NMR signal. The 1H-NMR signals S1 ~ S3 correspond to the three amide H atoms on the backbone, and the signal S4 corresponds to the one amide H atom of the Arg residue. S1 S2 S3 S4 No sulfate salt 0.70 0.78 0.80 0.65 Na2SO4 0.27 0.28 0.30 0.22 Al2(SO4)3 0.19 0.19 0.21 0.21 REFERENCES s1. A. D. Becke, Density-functional exchange-energy approximation with correct asymptotic behavior. Phys. Rev. A 38, 3098−3100 (1988). s2. C. Lee, W. Yang, R. G. Parr,. Development of the Colle-Salvetti correlation-energy formula into a functional of the electron density. Phys. Rev. B 37, 785−789 (1988). s3. M. J. Frisch, et al., Gaussian 03, Revision D.01, Gaussian., Inc., Wallingford (2004). s4. B. Hess, C. Kutzner, D. van der. Spoel, E. Lindahl, GROMACS 4: Algorithms for highly efficient, load-balanced, and scalable molecular simulation. J. Chem. Theory Comput. 4, 435−447 (2008). s5. T. A. Darden, D. M. York, L. G. Pedersen, Particle mesh Ewald: An N.log(N) method for Ewald sums in large systems. J. Chem. Phys. 98, 10089−10092 (1993). s6. E. J. Sorin, V. S. Pande, Exploring the helix-coil transition via all-atom equilibrium ensemble simulations. Biophys. J. 88, 2472−2493 (2005). s7. A. K. Rappié, C. J. Casewit, K. S. Colwell, W. A. Goddard III, W. M. Skiff, UFF, a full periodic table force field for molecular mechanics and molecular dynamics simulations. J. Am. Chem. Soc. 114, 10024−10035 (1992). s8. W. L. Jorgensen, J. Chandrasekhar, J. D. Madura, R. W. Impey, M. L. Klein, Comparison of simple potential functions for simulating liquid water. J. Chem. Phys. 79, 926−935 (1983). s9. P. Xiu, B. Zhou, W. Qi, H. Lu, Y. Tu, H. Fang, Manipulating biomolecules with aqueous liquids confined within single-walled nanotubes. J. Am. Chem. Soc. 131, 2840−2845 (2009). s10. W. Liu, D. Peng, Infinite-order quasirelativistic density functional method based on the exact matrix quasirelativistic theory. J. Chem. Phys. 125, 044102 (2006). s11. D. Peng, W. Liu, Y. Xiao, L. Cheng, Making four- and two-component relativistic density functional methods fully equivalent based on the idea of “from atoms to molecule”. J. Chem. Phys. 127, 104106 (2007). s12. J. P. Perdew, Y. Wang, Accurate and simple density functional for the electronic exchange energy: Generalized gradient approximation. Phys. Rev. B 33, 8800−8802 (1986). s13. J. P. Perdew, Density-functional approximation for the correlation energy of the inhomogeneous electron gas. Phys. Rev. B 33, 8822−8824 (1986). s14. H. Stoll, E. Golka, H. Preuâ, Correlation energies in the spin-density functional formalism. Theor. Chim. Acta. 55, 29−41 (1980). s15. Y. Takahata, A. K. Okamoto, D. P. Chong, DFT calculation of core-electron binding energies of pyrimidine and purine bases. Int. J. of Quantum Chem. 106, 2581−2586 (2006) s16. L. V. Duong, B. J. Wood, J. T. Kloprogge, XPS study of basic aluminum sulphate and basic aluminium nitrate. Mater. Lett. 59 (2005) 1932−1936.
© Copyright 2026 Paperzz