Microparticles Rich −β Shedding of Proinflammatory IL

This information is current as
of June 14, 2017.
Lipopolysaccharide Signaling without a
Nucleus: Kinase Cascades Stimulate Platelet
Shedding of Proinflammatory IL-1β−Rich
Microparticles
G. Thomas Brown and Thomas M. McIntyre
J Immunol 2011; 186:5489-5496; Prepublished online 23
March 2011;
doi: 10.4049/jimmunol.1001623
http://www.jimmunol.org/content/186/9/5489
Subscription
Permissions
Email Alerts
This article cites 51 articles, 31 of which you can access for free at:
http://www.jimmunol.org/content/186/9/5489.full#ref-list-1
Information about subscribing to The Journal of Immunology is online at:
http://jimmunol.org/subscription
Submit copyright permission requests at:
http://www.aai.org/About/Publications/JI/copyright.html
Receive free email-alerts when new articles cite this article. Sign up at:
http://jimmunol.org/alerts
The Journal of Immunology is published twice each month by
The American Association of Immunologists, Inc.,
1451 Rockville Pike, Suite 650, Rockville, MD 20852
Copyright © 2011 by The American Association of
Immunologists, Inc. All rights reserved.
Print ISSN: 0022-1767 Online ISSN: 1550-6606.
Downloaded from http://www.jimmunol.org/ by guest on June 14, 2017
References
The Journal of Immunology
Lipopolysaccharide Signaling without a Nucleus: Kinase
Cascades Stimulate Platelet Shedding of Proinflammatory
IL-1b–Rich Microparticles
G. Thomas Brown*,† and Thomas M. McIntyre†
P
latelet activation plays an important role in a variety of
high-mortality prothrombotic/proinflammatory disease states,
including disseminated intravascular coagulation and
acute respiratory distress syndrome. Gram-negative sepsis is a
leading cause of acute respiratory distress syndrome, resulting in
pulmonary platelet sequestration, elevated proinflammatory cytokines, and diffuse alveolar damage (1). LPS of Gram-negative
bacteria causes rapid thrombocytopenia and platelet sequestration in the lungs and liver (2–4). Despite this, the role of platelets
in sepsis is poorly understood. Mice that lack the TLR4, the LPS
receptor, cannot recognize LPS and are resistant to its pathologic
effects (5), and platelet experiments from wild-type mice introduced into TLR42/2 mice show platelets themselves are required for the septic response (6). LPS is not a typical platelet
agonist, as isolated platelets do not aggregate in its presence (7).
In fact, platelets can respond in a variety of ways aside from
aggregation, such as bacterial trapping and killing (8) and promoting apoptosis in intraerythrocytic malarial parasites (9). We
previously demonstrated LPS is a direct platelet agonist resulting
*Medical Scientist Training Program, Case Western Reserve University School of
Medicine, Cleveland, OH 44106; and †Department of Cell Biology, Lerner Research
Institute, Cleveland Clinic Lerner College of Medicine, Cleveland, OH 44195
Received for publication May 17, 2010. Accepted for publication March 3, 2011.
This work was supported by National Institutes of Health Grant 1 P01 HL087018.
Address correspondence and reprint requests to Dr. Thomas M. McIntyre, Department of Cell Biology, NE10, Lerner Research Institute, Cleveland Clinic Lerner
College of Medicine, 9500 Euclid Avenue, Cleveland, OH 44195. E-mail address:
[email protected]
Abbreviations used in this article: CLK-1, Cdc2-like kinase; LBP, LPS binding protein.
Copyright Ó 2011 by The American Association of Immunologists, Inc. 0022-1767/11/$16.00
www.jimmunol.org/cgi/doi/10.4049/jimmunol.1001623
in production and release of proinflammatory cytokines (10).
Platelets can splice stored intron-containing heteronuclear RNA to
produce mature mRNA from which cytokines and other factors
are produced (10, 11). Most notably, human platelets splice tissue
factor and IL-1b RNA when exposed to thrombin. For these types
of responses, LPS is more effective than thrombin.
Platelets detect and respond to LPS via TLR4, a trans-membrane
member of a family of receptors important in recognizing pathogenic molecules (6, 12, 13). Platelets lack CD14, a lipid-binding
chaperone required for TLR4 activation, but plasma contains
soluble CD14 in sufficient concentrations to present LPS to
platelet TLR4 (14). LPS-activated TLR4 recruits either of two
downstream signaling complexes that are MyD88-dependent or
MyD88-independent. The MyD88-dependent complex recruits
and activates the kinases IRAK1 and IRAK4 that, in nucleated
cells, promotes IkB degradation and translocation of the transcription factor NF-kB to the nucleus. Although platelets contain
NF-kB (15, 16), they lack nuclei, and their activation does not
include NF-kB–driven gene expression. How LPS therefore stimulates a select group of platelet functions is unknown but likely
lies in kinase activation that in nucleated cells are between TLR4
and NF-kB translocation.
Although much is known about MAPKs in nucleated cells,
their role in platelet biology is incompletely understood. Kauskot
et al. (17) demonstrated that JNK is involved in ADP-dependent
collagen-induced platelet aggregation, but not platelet adhesion.
Studies by Chen et al. (18) revealed that oxidized-low density
lipoprotein signaled through CD36 and increased JNK activity via
src kinases, contributing to platelet hyperactivity in hyperlipidemia models. Akt is a kinase with antiapoptotic properties in many
cell types, but in platelets it is involved in aggregation subsequent
to GPVI collagen receptor activation (19, 20). Exceedingly high,
Downloaded from http://www.jimmunol.org/ by guest on June 14, 2017
Platelets contain unspliced heteronuclear IL-1b RNA, which is rapidly spliced and translated upon activation. LPS is a superior
agonist for this atypical platelet response, but how LPS induces proinflammatory cytokine production in anucleate cells lacking
NF-kB is unknown. Platelets express functional TLR4, and stimulation by LPS induced rapid splicing, translation, and secretion
of mature IL-1b after caspase-1 processing. LPS stimulated microparticle shedding, and secreted IL-1b was exclusively present in
these particles. Microparticles from LPS-stimulated platelets induced VCAM-1 production by cultured human endothelial cells,
and blockade of endothelial IL-1b receptor with IL-1 receptor antagonist completely suppressed endothelial activation. Splicing
was posttranscriptional as the SR kinase inhibitor TG003 blocked IL-1b RNA production by platelets, but not by monocytes, and
was dependent on exogenous CD14—a property of platelets. We used a combination of small-molecule inhibitors, cell-penetrating
chimeric peptide inhibitors, and gene-targeted animals to show splicing required MyD88 and TIRAP, and IRAK1/4, Akt, and JNK
phosphorylation and activation. Traf6 couples MyD88 to the Akt pathway and, remarkably, a Traf6 interacting peptide–antennapedia chimera was more effective than LPS in stimulating IL-1b splicing. The Traf6 chimera did not, however, stimulate
microparticle shedding, nor was IL-1b released. We conclude LPS-induced kinase cascades are sufficient to alter cellular
responses, that three signals emanate from platelet TLR4, and that Akt and JNK activation are sufficient to initiate posttranscriptional splicing while another event couples microparticle shedding to TLR4 activation. Platelets contribute to the inflammatory response to LPS through production of microparticles that promote endothelial cell activation. The Journal of
Immunology, 2011, 186: 5489–5496.
5490
nonphysiologic amounts of LPS stimulate CD14-independent kinase activation in impure platelet preparations (21), promoting
their degranulation. These responses are not seen in response to
low amounts of LPS presented by CD14 (10). Whether platelets
use intermediary kinases in their response to LPS when presented
in a pathophysiologically relevant way is unknown.
Platelets compose an essential component of the response to
sepsis (4, 22), but what makes platelets distinctive in this cytokine
storm evoked by LPS is incompletely described. We hypothesize
that one or more of the kinases promoting platelet response to
typical agonists would cooperate with kinases found in nucleated
cells and together transmit responses from platelet TLR4 in response to LPS. We found LPS does activate a kinase cascade in
platelets that is required for stimulated IL-1b production. We also
observed that LPS signaling promoted the production of platelet
microparticles and that these were proinflammatory by virtue of
the caspase-1–dependent IL-1b they express.
Materials and Methods
Human blood was drawn into acid-citrate-dextrose and centrifuged (200 3
g, 20 min) to obtain platelet-rich plasma in a protocol approved by the
Cleveland Clinic Institutional Review Board. All centrifugations were
performed without braking. Platelet-rich plasma was filtered through two
layers of 5-mm mesh (BioDesign) to remove nucleated cells and recentrifuged (500 3 g, 20 min) in the presence of 100 nM PGE1. The pellet
was resuspended in 50 ml PIPES/saline/glucose (5 mM PIPES, 145 mM
NaCl, 4 mM KCl, 50 mM Na2HPO4, 1 mM MgCl2, and 5.5 mM glucose)
containing 100 nM PGE1. These cells were centrifuged (500 3 g, 20 min),
resuspended in AutoMACS sample buffer, 5 ml anti-CD45–, anti-CD15–,
anti-CD14–, and anti-glycophorin–coated magnetic beads (Miltenyi Biotec) per 109 cells for 25 min with constant rotation before purification in an
AutoMACS magnetic separator (Miltenyi Biotec). For some experiments,
this negative microbead selection was repeated. Platelets are primarily null
for these Ags, but negative selection may exclude small populations that
have acquired these markers. This negative selection sorting process
resulted in a platelet population containing ∼1 monocyte per 2 3 109
platelets based on CD14 mRNA content (10). Light microscopy was used
to confirm the cells had a discoidal, unactivated shape. Recovered platelets
were centrifuged (500 3 g, 20 min) and resuspended in 0.5% human serum
albumin in HBSS at 2 3 108 cells/ml for quantitative RT-PCR, and at 8 3
108 platelets/ml for all other uses. Platelet activation was induced for the
stated time with 100 ng/ml LPS with addition of 100 ng/ml each of human
recombinant CD14 and LPS binding protein (LBP).
Mouse blood was a generous gift from the laboratory of Dr. Clifford Harding
(Case Western Reserve University). Briefly, whole blood was obtained via
cardiac puncture into acid-citrate-dextrose containing 100 nM PGE1 and
centrifuged (100 3 g, 10 min) to obtain platelet-rich plasma. Reduction of
nucleated cells was achieved by gel filtration of platelet-rich plasma. Platelet
yield was determined by cell counting using a hemocytometer.
HUVEC cell culture and VCAM-1 expression
HUVECs were kindly provided by Dr. Paul DiCorletto (Cleveland Clinic
Foundation, Lerner Research Institute). Briefly, HUVECs were plated
overnight in 96-well plates in MCDB-105 media supplemented with 15%
FBS. The next day, cells were washed twice with PBS (pH 7.4) and preincubated with IL-1 receptor antagonist for 30 min. HUVECs were incubated with microparticles for 6 h. Cells were then washed three times with
PBS (pH 7.4) and fixed in 4% paraformaldehyde for 30 min on ice. Cells
were subsequently washed and blocked overnight with 5% BSA. The day
after blocking, cells were incubated with anti–VCAM-1 primary Ab (Santa
Cruz Biotechnology) for 2 h at room temperature. After three washes with
PBS (pH 7.4), cells were incubated with sheep anti-mouse HRP-conjugated secondary Ab (Bio-Rad) for 1 h at room temperature. 3,39,5,59Tetramethylbenzidine substrate was subsequently added to each well and
the reaction stopped after 20 min by addition of 1 M HCl. Absorbance was
recorded at 450 nm on a 96-well plate reader (Spectramax 384 Plus;
Molecular Devices, Sunnyvale, CA).
Microparticle quantification
Human platelet microparticles were counted using known amounts of 3-mm
polystyrene latex beads (Sigma) added to FACS tubes just prior to analysis.
forward scatter and side scatter gates were drawn to include 50,000 3-mm
events. Microparticle size was determined using 1-mm beads (Sigma).
FACS analysis was performed using settings where the threshold was
lowered to 200 and FSC and SSC gates were drawn to include events 1 mm
in size and smaller.
IL-1b ELISA
Isolated platelets from human donors were incubated for 6 h at 37˚C in the
presence or absence of 100 ng/ml LPS. Cells were lysed and analyzed via
ELISA detecting mature IL-1b and pro–IL-1b (R&D Systems). We compared resting platelets to treated platelets and then subtracted signal from
pro–IL-1b. Ratios were then generated against control platelets, expressing the data as fold-increase of mature IL-1b protein over controls.
RNA isolation and real-time RT-PCR
Total RNA from 2.0 3 108 platelets was isolated using RNeasy Mini Kit
(Qiagen) and treated with RNase-free DNase (Qiagen). Total RNA was
quantitated by NanoDrop and used to normalize PCR samples. Real-time
RT-PCR primers were as follows: human IL-1b mRNA, sense 59-AAACCTCTTCGAGGCACAAG-39 (exon 1), antisense 59-GTTTAGGGCCATCAGCTTCA-39 (exon 3); mouse IL-1b, sense 59-CGAGGCTAATAGGCTCATCT-39, antisense 59-GTTTGGAAGCAGCCCTTCAT-39. Conditions
for IL-1b were as follows: reverse transcription (50˚C, 30 min); PCR
(94˚C, 15 s; 61˚C, 30 s; 72˚C, 30 s); data collection (80˚C, 15 s), 40–45
cycles with SYBR Green I in a Bio-Rad MyiQ iCycler. Amplification
across intron 2 does not detect unprocessed heteronuclear IL-1b RNA.
Results were normalized using real-time PCR data of 18S rRNA (Ambion).
Products were analyzed by melting curve, gel electrophoresis, and sequencing. DNase I treatment did not affect IL-1b mRNA expression,
whereas RNase I treatment and reverse transcriptase removal abolished
amplification.
Chemicals and reagents
Chemicals and reagents were purchased from the following sources: sterile
filtered HBSS and M199 (BioWhittaker); sterile tissue culture plates
(Falcon Labware); human serum albumin (Baxter Healthcare); endotoxinfree PBS, phenol-extracted LPS (Escherichia coli O111:B4) that is free of
lipoprotein contamination (List Biological Laboratories); Cdc2-like kinase
(CLK-1) inhibitor TG003 (Calbiochem); recombinant soluble CD14, LBP,
and IL-1b ELISA kit (R&D Systems); p-JNK, total JNK, p-Akt, and total
Akt ELISA kits (Cell Signaling). The JNK inhibitor SP600125 and Akt
inhibitor VIII were obtained from EMD Biosciences. The monoclonal 3ZD
anti–IL-1b Ab, which recognizes both 33-kDa pro–IL-1b and 17-kDa
mature IL-1b in Western blot analysis, was a generous gift from the laboratory of Dr. George Dubyak (Case Western Reserve University) and
provided by the Biological Resources Branch, National Cancer Institute,
Frederick Cancer Research and Development Center (Frederick, MD).
Caspase-1 inhibitor (FMK002) was obtained from R&D Systems. Caspase-1
Ab (sc-515) was obtained from Santa Cruz Biotechnology. Other
chemicals were from Sigma-Aldrich or Biomol Research Laboratories. The
amino acid sequences of inhibitory peptides (Imgenex) are as follows:
MyD88, DRQIKIWFQNRRMKWKKRDVLPGT; TIRAP, DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS; and Traf6, DRQIKIWFQNRRMKWKKRKIPTEDEY. Underlined amino acids represent antennapedia protein
transduction domain.
Expression of data and statistics
Experiments were performed at least three times with cells from different
donors, and all assays were performed in triplicate. The SEs of the mean
from all experiments are presented as error bars. Graphing of figures and
statistical analyses were generated with Prism4 (GraphPad Software). A
value of p , 0.05 was considered statistically significant.
Results
LPS stimulates platelet release of inflammatory microparticles
containing IL-1b
Platelets treated with LPS shed approximately three times as many
microparticles as control platelets (Fig. 1A). Release of IL-1b
protein from LPS-stimulated human platelets was time-dependent
with a 5-fold increase 6 h after stimulation that increased to 8-fold
by 18 h as measured by ELISA (Fig. 1B). Platelets not exposed to
LPS also release IL-1b protein during this incubation, although to
a lesser extent than stimulated cells. IL-1b protein emanating from
Downloaded from http://www.jimmunol.org/ by guest on June 14, 2017
Cell isolation
LPS STIMULATION OF PLATELETS
The Journal of Immunology
5491
LPS-stimulated cells, and those undergoing limited self-activation
in the absence of LPS, was completely dependent on splicing of
IL-1b heteronuclear RNA to remove introns because the SR kinase inhibitor TG003 that blocks this process (23) abolished IL-1b
release. This inhibitor of posttranscriptional RNA processing did
not block cotranscriptional IL-1b production in nucleated cells
(data not shown). Additionally, the transcriptional inhibitors actinomycin D and a-O-amanitin failed to inhibit this enriched
platelet population but were active against monocyte preparations
in concordant experiments (data not shown).
We collected microparticles from LPS-treated platelets and
determined they contained mainly the proteolytically processed
form of IL-1b by SDS-PAGE and Western blot analysis, whereas
unstimulated platelets or those treated with thrombin contained
undetectable levels of either form of IL-1 due to reduced sensitivity of Western blot analysis compared with that of ELISA data
(Fig. 1C versus 1B). We probed platelet lysates for activated
caspase-1 using an Ab recognizing the p10 subunit and found the
active 10-kDa fragment in LPS-stimulated cells (data not shown).
We also found by ELISA that capsase-1 inhibition by either of
two selective inhibitors prevented the formation of mature IL-1b
protein via ELISA experiments (Fig. 1D). Thus, platelets treated
with LPS showed significant processing of IL-1b protein, which
was absent in control platelets.
We recovered these particles and also found they induced a 3fold increase in VCAM-1 expression in quiescent endothelial cells
(Fig. 1E). The inflammatory principle present in the purified
microparticles was nearly exclusively particle-bound IL-1b because endothelial cell VCAM-1 expression was ablated by the
specific IL-1 receptor antagonist IL-1Ra. VCAM-1 induction was
a property of the platelet-derived microparticles themselves, and
not from LPS carryover, because only platelets require an exogenous source of CD14, and platelets exposed to LPS without this
cofactor did not initiate VCAM-1 expression by HUVECs (data
not shown). Additionally, HUVECs treated with polymyxin B to
interfere with LPS stimulation responded to LPS-induced microparticles, ruling out LPS carryover as the agent responsible for
endothelial activation in our experiments. Finally, platelet microparticles generated in response to thrombin stimulation, and subsequently incubated with LPS, washed, and then applied to
Downloaded from http://www.jimmunol.org/ by guest on June 14, 2017
FIGURE 1. LPS-stimulated platelets splice IL-1b RNA, process IL-1b protein, and shed IL-1b–laden microparticles, which activate endothelial cells. A,
Platelet microparticles were collected after overnight LPS exposure (100 ng/ml in the presence of recombinant CD14 and LBP) or a Traf6 interacting
chimeric peptide before quantitation by flow cytometry. B, Human platelets (4 3 108 per condition) were treated with LPS for the stated times in combination with recombinant human CD14 and LBP, and secreted IL-1b protein was measured by ELISA. C, Microparticles generated after overnight
treatments were resuspended in reducing SDS sample buffer and probed for IL-1b after SDS-PAGE in a Western blot. D, Platelet lysates were probed by
ELISA for mature and pro–IL-1b protein after LPS treatment, in the presence or absence of caspase inhibitors. E, Purified platelet microparticles were
added to HUVECs for 6 h before VCAM-1 expression was determined by ELISA. IL-1Ra (150 ng/ml) was added 30 min prior to microparticle addition.
Error bars = 61 SE, n = 3 for A–D and n = 8 for E.
5492
HUVECs, failed to stimulate the endothelial cells to produce
VCAM-1 (data not shown).
MyD88 and TIRAP are involved in LPS-stimulated IL-1b
production
FIGURE 2. LPS-induced IL-1b mRNA splicing requires MyD88 and
TIRAP. Purified human (A) or mouse (B) platelets were treated with or
without LPS, soluble CD14, and LBP for 3 h at 37˚C. RNA was isolated
from cell lysates, and spliced IL-1b mRNA was measured by real-time
quantitative PCR. Peptide-based decoy peptide inhibitors were used at
a concentration of 50 mM. IRAK inhibitor was used at a concentration of 2
mM. Error bars = 6SE, n = 7 human donors (A). Error bars = 61 SE, n = 5
experiments of pooled mouse blood from two to four mice each (B).
dent processes may contribute to LPS signaling in platelets.
MyD88-null mice would provide a definitive answer to this, but
we had to first determine whether murine platelets contained
unspliced heteronuclear IL-1b RNA and whether this could be
spliced in a stimulated, posttranscriptional manner. We found that
murine platelets behaved as human platelets and accumulated
spliced RNA in response to LPS. Murine platelets appeared to be
less sensitive to stimulation over a prolonged incubation and produced little spliced IL-1b by themselves (Fig. 2B). So, not only is
the relative signal after LPS stimulation of murine platelets
greater than that of human platelets, but also there was only a
negligible increase in autoactivation levels (i.e., background) to
obfuscate the role of MyD88 in splicing. The level of autostimulation in MyD88-null platelets was below that of untreated
cells, amounting to a reduction by one half compared with that of
control platelets. IL-1b splicing, at least in murine cells, was
completely dependent on MyD88, as platelets from mice lacking
this adapter molecule were completely insensitive to LPS exposure (Fig. 2B).
Traf6, Akt, and JNK promote LPS-induced IL-1b splicing
LPS couples to JNK phosphorylation in platelets, as phosphorylation of residues T183 and Y185 of this kinase increased more than
2-fold after just 5 min of stimulation (Fig. 3A). The enhanced level
of JNK phosphorylation was prolonged and had diminished
by just half 60 min after stimulation. LPS also stimulated phosphorylation along the Akt pathway, with a rapid increase in both
T308 and S473 phosphorylation (Fig. 3B, 3C). In contrast to JNK
phosphorylation, phosphorylation of Akt was transient. A modest
second wave of S473 phosphorylation appeared after 30 min of
LPS exposure.
We determined whether Akt or JNK activity was downstream of
TLR4 in platelets and required for stimulated IL-1b RNA splicing
by using small-molecule inhibitors to JNK (Fig. 4A) or Akt (Fig.
4B). Inhibition of either kinase sharply reduced the appearance
of mature IL-1b in response to LPS, with the JNK inhibitor
SP600125 being almost completely effective.
Traf6 lies between IRAK1/4 and the Akt and MAPK cascades.
We used a combination of peptides and pharmacological inhibitors
to determine if Traf6 was present and functional in platelets and
whether one or both kinase pathways responded to LPS. To do this,
we used a Traf6 decoy peptide derived from CD40–Traf6 interaction. This interaction is defined at atomic resolution (26) and
has been shown to interfere functionally with Traf6-mediated
signaling (27). We found the Traf6 decoy peptide had a marked
effect on the production of spliced IL-1b mRNA, but rather than
blocking IL-1b splicing, it was an agonist exceeding LPS stimulation by 5-fold (Fig. 5A). This was not an effect of contaminating
LPS in the preparation because, unlike LPS, stimulation by the
peptide was CD14 independent. Neither a scrambled Traf6 peptide
conjugated to the antennapedia translocation peptide, the antennapedia sequence itself, nor an unconjugated Traf6 sequence induced IL-1b splicing (data not shown).
The Traf6 decoy peptide is the most effective agent in generating
mature IL-1b identified to date, and if this peptide truly affects
Traf6 interaction, then the peptide should stimulate Akt and JNK
phosphorylation. Indeed, the Traf6 decoy peptide stimulated the
accumulation of p-JNK over the first 10 min of stimulation and
was equally effective at this as LPS (Fig. 5B). Similarly, the Traf6
decoy induced a large increase in Akt phosphorylation at residues
T308 and S473 (Fig. 5C, 5D). The single notable difference between the Traf6 decoy peptide- and LPS-induced Akt phosphorylation was the delayed response of platelets to the peptide.
Inhibitors of JNK, Akt, and CLK-1 blocked Traf6-induced IL-1b
Downloaded from http://www.jimmunol.org/ by guest on June 14, 2017
Resting platelets contain virtually no processed and functional
IL-1b mRNA (11). After 3 h of stimulation by LPS, the level of
processed, intronless RNA increased by nearly 100-fold (Fig. 2A).
Platelets are sensitive cells and after 3 h of incubation underwent
mild autoactivation that increased spliced IL-1b RNA by 35-fold.
We tested the involvement of MyD88 in the response of platelets
to LPS using a chimeric peptide that blocks LPS-stimulated IL-1
production in dendritic cells (24). This peptide consists of an
antennapedia sequence that translocates across membranes and
a sequence from MyD88 that competitively blocks MyD88 homodimerization. We found that the antennapedia–MyD88 chimeric
peptide reduced spliced IL-1b in platelets by nearly half. This
reduced level of spliced IL-1b was not significantly different from
the content in unstimulated platelets after 3 h of incubation. A
similar competition for binding partners for the MyD88 interacting molecule TIRAP completely abolished LPS-initiated (and
autostimulated, data not shown) IL-1b mRNA accumulation. A
second TIRAP chimeric peptide (RQIKIWFQNRRMKWKK)
(25) also effectively blocked splicing (data not shown). We determined whether IRAK activity was required for IL-1b RNA
processing using a small-molecule inhibitor selective for IRAK1
and IRAK4. Inhibition of these kinases dramatically reduced the
amount of spliced IL-1b in platelets when exposed to LPS,
resulting in an 80% reduction to a level comparable with that of
control platelets. Loss of LPS-stimulated splicing was not due to
cell death, as peptide-treated platelets maintained thrombin sensitivity as shown by aggregometry (not shown).
Inhibition of IL-1b mRNA production just to the level of autoactivated cells leaves open the possibility that MyD88-indepen-
LPS STIMULATION OF PLATELETS
The Journal of Immunology
5493
FIGURE 3. LPS activates JNK and Akt in human platelets. Platelets
were treated with LPS, soluble CD14, and LBP before lysates were made
at the stated times. A significant increase in JNK phosphorylation (A) and
Akt phosphorylation [(B) p-Tyr308-Akt and (C) p-Ser473-Akt] was measured by ELISA. Data are expressed as the ratio of phospho-proteins to
total kinase protein. Error bars = 61 SE, n = 3.
splicing in human platelets (data not shown). Inhibitors alone
failed to induce significant levels of splicing.
LPS, but not the Traf6 decoy peptide, stimulates release of
IL-1b–expressing microparticles
The Traf6–antennapedia chimeric peptide stimulated the Akt and
MAPK pathways and IL-1b RNA splicing, similar to LPS. To
determine if this is sufficient to stimulate the release of IL-1b–
expressing microparticles, we again treated HUVECs with microparticles recovered from platelets treated in various ways before measuring endothelial VCAM-1 expression. Microparticles
from LPS-treated platelets caused an increase in VCAM-1 expression that was blocked by the TIRAP peptide and the IL-1
receptor antagonist, but not by the antennapedia control peptide
(Fig. 6). In contrast, the Traf6 competing chimera, which was a
very effective agonist for IL-1b production, did not produce microparticles (Fig. 1A) able to stimulate HUVEC VCAM-1 production (Fig. 6). We concluded another event below TIRAP but
above Traf6 is required for the production of IL-1b–containing
microparticles and that IL-1b incorporation into microparticles
requires events beyond IL-1b accumulation.
Discussion
In this report, we show that human platelets can directly participate
in the inflammatory response to endotoxin by activating endothelial
cells. Platelets secrete microparticles that contain newly synthesized mature IL-1b, although pro–IL-1b can be detected as well,
in response to LPS stimulation. This upregulates endothelial cell
VCAM-1 expression that in turn promotes leukocyte interaction
with these cells. This process is dependent on the TLR4 pathway,
which leads to JNK and Akt activation in platelets, as in nucleated
cells (28, 29). We also show that the compound TG003, which
inhibits the splicing kinase CLK-1, is an effective inhibitor of
LPS-induced IL-1b protein release, indicating that TLR4 activation leads to transcript processing in platelets. In addition to
transcript processing, we present data showing that IL-1b protein
maturation occurs in a caspase-1–dependent manner. It is notable
that the process of activation-dependent splicing, transcription,
and transfer of unspliced heteronuclear RNA into platelets as they
mature is retained in mice. This indicates that, in contrast to tissue
factor RNA (30), heteronuclear RNA for IL-1b can be sorted or
differentially processed in both species so that the proinflammatory potential, and not the anticoagulant potential, is what has
been retained over evolution.
Intracellular interference with protein–protein interaction reveals several of the molecular components in the platelet TLR4
pathway leading to IL-1b splicing. First, it is interesting that cells
as sensitive as platelets can be exposed to cell-penetrating peptides
without becoming sufficiently activated to induce IL-1b splicing,
aggregation, or an increase in intracellular calcium (data not
shown). We found that a competitive TIRAP peptide inhibitor
completely blocked splicing, so this interaction is needed for both
LPS-stimulated and self-stimulated IL-1b production, but in contrast, a MyD88 peptide was not equally effective and only reduced splicing to that of control cells. We complemented this
approach with peptides by using MyD882/2 mice to find that mice
lacking MyD88 were unable splice IL-1b mRNA in response to
LPS, so at least in mice that do not undergo self-stimulation,
splicing is fully MyD88 dependent.
Downloaded from http://www.jimmunol.org/ by guest on June 14, 2017
FIGURE 4. Inhibition of JNK and Akt pathways block IL-1b mRNA
splicing in human platelets. Platelets were treated with or without LPS,
soluble CD14, and LBP for 3 h and IL-1b splicing determined by real-time
quantitative PCR as in Fig. 2. The JNK inhibitor SP600125 (500 nM)
inhibits IL-1b splicing (A). An inhibitor of Akt (1.5 mM) also inhibits
splicing (B). Error bars = 61 SE, n = 3.
5494
LPS STIMULATION OF PLATELETS
FIGURE 6. LPS, but not the Traf6 chimeric peptide, generates IL-1b–
containing platelet-derived microparticles. This experiment was performed
as in Fig. 1, but in the presence or absence of the stated peptides during
LPS stimulation. Error bars = 61 SE, n = 4.
Unexpectedly, a decoy peptide designed to inhibit Traf6 interaction with its partners strongly initiated message splicing and
kinase activation in platelets. This peptide was marginally effective
at blocking message splicing in human monocyte preparations
(data not shown), and a CD40-derived peptide failed to block the
Downloaded from http://www.jimmunol.org/ by guest on June 14, 2017
FIGURE 5. Traf6 peptide activates human platelets in the absence of
CD14. Platelets were treated with a chimeric Traf6–antennapedia peptide
(5 mM), and lysates were made at stated times. The Traf6 chimeric peptide
caused a significant increase in spliced IL-1b mRNA (A). JNK (B) and Akt
(C, D) phosphorylation was measured by ELISA. Data are expressed as the
ratio of phospho-kinase to total kinase. Error bars = 61 SE, n = 7 for A and
n = 3 for B–D.
actions of the Traf6 decoy peptide in human platelets (data not
shown). Although our data show the Traf6 decoy peptide is an
effective splicing agonist, it failed to elicit IL-1b release from
platelets (data not shown) and in fact failed to stimulate microparticle release beyond the level of control platelets. To date, we
know of no better agonist that promotes message splicing in human platelets. What this peptide does show is that activation of
Akt and MAPK signaling is sufficient to initiate heteronuclear
RNA splicing, but that another second signal, not initiated by the
Traf6 peptide, JNK, or Akt, is required for particle shedding. This
signal is still dependent on MyD88 and TIRAP, but not Traf6
interactions.
Various studies have implicated PI3K in platelet function including aggregation (31, 32) and thrombus formation (33). Akt is
a classic downstream target of PI3K, and several groups have
suggested Akt may be an important molecule in platelet function
(34–37). Other studies suggest Akt can activate splicing in neurons (38). These facts led us to hypothesize that Akt may modulate
mRNA splicing in platelets, and we found that LPS caused
a profound increase in phosphorylation of Akt, and that small
molecular inhibitors of this kinase block LPS-induced splicing.
The time frame of Akt activation suggests that Akt is a transient
second messenger, because whereas peak Akt activation occurred
within minutes, peak splicing and IL-1b protein release occurred
well after Akt activation had subsided. The complex interaction
of Akt and several platelet mechanisms suggests Akt inhibition
may represent a useful adjunct of anti-inflammatory as well as
an antithrombotic therapy.
Several lines of evidence suggest that TLR4-dependent JNK
activation is an important proinflammatory pathway (21, 39, 40).
Several groups have shown various MAPKs are activated during
platelet stimulation (17, 41, 42). Additionally, Charruyer et al.
(43) showed that UV-C radiation caused increase ceramide and
JNK activation in platelets. Because of JNK’s role in inflammation
and TLR4 signaling, we hypothesized that LPS-induced mRNA
splicing in platelets is dependent on JNK. Like Akt, JNK is highly
phosphorylated within minutes of LPS exposure, but then quickly
subsides. JNK inhibition effectively blocked this process, indicating this kinase and the Akt pathway separately modulate
platelet posttranscriptional splicing. Posttranscriptional splicing,
a recently described event (11), has a major role in hematopoietic
stem cell maturation (44) and has not been appreciated to require
these two kinase cascades.
Zhang et al. (21) report that LPS potentiates platelet aggregation via a TLR4–MyD88–cGMP kinase pathway, independent of
CD14 presentation of LPS to its receptor. The absent role of CD14
The Journal of Immunology
Acknowledgments
The technical aid of Mark Calabro and Erin Brady is greatly appreciated.
We thank Dr. Clifford Harding and Daimon Simmons (Department of Pathology, Case Western Reserve University School of Medicine, Cleveland,
OH) for the gift of knockout mouse blood, Arundhati Undurti for assistance
with VCAM-1 experiments, and Dr. Pavel Shashkin for aid with early
experiments. We greatly appreciate the advice and reagents from Dr. George
Dubyak (Department of Biophysics and Physiology, Case Western Reserve
University School of Medicine). HUVECs were kindly provided by Dr. Paul
DiCoreletto and technician Lisa Dechert.
Disclosures
The authors have no financial conflicts of interest.
References
1. Heffner, J. E., S. A. Sahn, and J. E. Repine. 1987. The role of platelets in the
adult respiratory distress syndrome. Culprits or bystanders? Am. Rev. Respir. Dis.
135: 482–492.
2. Davis, R. B., W. R. Meeker, and D. G. McQuarrie. 1960. Immediate effects of
intravenous endotoxin on serotonin concentrations and blood platelets. Circ. Res.
8: 234–239.
3. Shibazaki, M., Y. Kawabata, T. Yokochi, A. Nishida, H. Takada, and Y. Endo.
1999. Complement-dependent accumulation and degradation of platelets in the
lung and liver induced by injection of lipopolysaccharides. Infect. Immun. 67:
5186–5191.
4. Vincent, J. L., A. Yagushi, and O. Pradier. 2002. Platelet function in sepsis. Crit.
Care Med. 30(5, Suppl): S313–S317.
5. Rumbaut, R. E., R. V. Bellera, J. K. Randhawa, C. N. Shrimpton, S. K. Dasgupta,
J. F. Dong, and A. R. Burns. 2006. Endotoxin enhances microvascular thrombosis in mouse cremaster venules via a TLR4-dependent, neutrophil-independent
mechanism. Am. J. Physiol. Heart Circ. Physiol. 290: H1671–H1679.
6. Andonegui, G., S. M. Kerfoot, K. McNagny, K. V. Ebbert, K. D. Patel, and
P. Kubes. 2005. Platelets express functional Toll-like receptor-4. Blood 106:
2417–2423.
7. Abdelnoor, A. M., H. Kassem, A. B. Bikhazi, and A. Nowotny. 1980. Effect of
gram-negative bacterial lipopolysaccharide-derived polysaccharides, glycolipids,
and lipopolysaccharides on rabbit and human platelets in vitro. Immunobiology
157: 145–153.
8. Clark, S. R., A. C. Ma, S. A. Tavener, B. McDonald, Z. Goodarzi, M. M. Kelly,
K. D. Patel, S. Chakrabarti, E. McAvoy, G. D. Sinclair, et al. 2007. Platelet TLR4
activates neutrophil extracellular traps to ensnare bacteria in septic blood. Nat.
Med. 13: 463–469.
9. McMorran, B. J., V. M. Marshall, C. de Graaf, K. E. Drysdale, M. Shabbar,
G. K. Smyth, J. E. Corbin, W. S. Alexander, and S. J. Foote. 2009. Platelets kill
intraerythrocytic malarial parasites and mediate survival to infection. Science
323: 797–800.
10. Shashkin, P. N., G. T. Brown, A. Ghosh, G. K. Marathe, and T. M. McIntyre.
2008. Lipopolysaccharide is a direct agonist for platelet RNA splicing. J.
Immunol. 181: 3495–3502.
11. Denis, M. M., N. D. Tolley, M. Bunting, H. Schwertz, H. Jiang, S. Lindemann,
C. C. Yost, F. J. Rubner, K. H. Albertine, K. J. Swoboda, et al. 2005. Escaping
the nuclear confines: signal-dependent pre-mRNA splicing in anucleate platelets.
Cell 122: 379–391.
12. Aslam, R., E. R. Speck, M. Kim, A. R. Crow, K. W. Bang, F. P. Nestel, H. Ni,
A. H. Lazarus, J. Freedman, and J. W. Semple. 2006. Platelet Toll-like receptor
expression modulates lipopolysaccharide-induced thrombocytopenia and tumor
necrosis factor-alpha production in vivo. Blood 107: 637–641.
13. Cognasse, F., H. Hamzeh, P. Chavarin, S. Acquart, C. Genin, and O. Garraud.
2005. Evidence of Toll-like receptor molecules on human platelets. Immunol.
Cell Biol. 83: 196–198.
14. Lødrup Carlsen, K. C., and B. Granum. 2007. Soluble CD14: role in atopic
disease and recurrent infections, including otitis media. Curr. Allergy Asthma
Rep. 7: 436–443.
15. Liu, F., S. Morris, J. Epps, and R. Carroll. 2002. Demonstration of an activation
regulated NF-kappaB/I-kappaBalpha complex in human platelets. Thromb. Res.
106: 199–203.
16. Malaver, E., M. A. Romaniuk, L. P. D’Atri, R. G. Pozner, S. Negrotto,
R. Benzadón, and M. Schattner. 2009. NF-kappaB inhibitors impair platelet
activation responses. J. Thromb. Haemost. 7: 1333–1343.
17. Kauskot, A., F. Adam, A. Mazharian, N. Ajzenberg, E. Berrou, A. Bonnefoy,
J. P. Rosa, M. F. Hoylaerts, and M. Bryckaert. 2007. Involvement of the mitogenactivated protein kinase c-Jun NH2-terminal kinase 1 in thrombus formation. J.
Biol. Chem. 282: 31990–31999.
18. Chen, K., M. Febbraio, W. Li, and R. L. Silverstein. 2008. A specific CD36dependent signaling pathway is required for platelet activation by oxidized lowdensity lipoprotein. Circ. Res. 102: 1512–1519.
19. Barry, F. A., and J. M. Gibbins. 2002. Protein kinase B is regulated in platelets by
the collagen receptor glycoprotein VI. J. Biol. Chem. 277: 12874–12878.
20. Kim, S., P. Mangin, C. Dangelmaier, R. Lillian, S. P. Jackson, J. L. Daniel, and
S. P. Kunapuli. 2009. Role of phosphoinositide 3-kinase beta in glycoprotein VImediated Akt activation in platelets. J. Biol. Chem. 284: 33763–33772.
Downloaded from http://www.jimmunol.org/ by guest on June 14, 2017
may be explained by the extremely high amounts of LPS used
in that study, reaching 10 to 100 mg/ml. Although is has been
reported that those levels can be achieved in septic patients (45),
recent studies suggest most patient plasma samples contain less
than 500 pg/ml in the setting of severe sepsis and septic shock
(46–48). Additionally, the use of relatively unpurified platelets in
the Zhang study may confound results via secretion products of
contaminating monocytes and lymphocytes. We eliminate this
source of contamination by using two rounds of negative selection
based on Ab-coated magnetic beads to CD14, CD15, CD45, and
glycophorin leaving behind a very pure population of platelets that
are not contaminated with monocytes, which also respond to LPS
and make IL-1b. We note that low concentrations of LPS presented by CD14 stimulate signaling events that couple to IL-1b
splicing through a kinase cascade above or independent of NO
formation that synergizes with standard agonists to enhance aggregation (21).
Platelet production of IL-1b–enriched microparticles differs
from soluble IL-1b release from peripheral blood monocytes in
that maximum platelet IL-1b–positive particle release was more
rapid, a few hours versus overnight, although ultimately producing
less IL-1b. There may also be a qualitative difference between
these cellular IL-1b sources in that multiple IL-1b molecules may
be expressed by a single platelet-derived microparticle, and these
could derive the effective concentration at the IL-1b receptor
through avidity. Finally, platelets did not need to be adherent to
shed these cytokine-containing microparticles and so all circulating platelets can alter endothelial cell function. We were surprised to find that platelets with robust IL-1b production after
exposure to the Traf6 interacting peptide did not shed IL-1b–
containing microparticles. These cells, like control platelets, shed
some microparticles, but because they lacked IL-1b, we concluded first that an unidentified signal emanating from TLR4 is
required for microparticle shedding, and second that additional
stimulation-dependent events are required for microparticles to
acquire IL-1b.
Like IL-1b, caspase-1 is also synthesized as a proprotein that
must be cleaved for activation. Accordingly, we find that platelets
contain caspase-1 and activated caspase-1. Platelets activated by
thrombin or platelet-activating factor have previously been found
to contain both pro–IL-1b and processed IL-1b, with the processed form predominating at all times (49).
Finally, through the use of IL-1 receptor antagonist, we found
that platelets express functional IL-1 receptors, which couples to
IL-1b mRNA splicing like LPS. The slow rate, relative to aggregation, of IL-1b mRNA processing in platelets requires incubation times that are several hours long. We routinely observed
“autoactivation” when untreated incubated platelets expressed
significantly more processed IL-1b mRNA than that of freshly
isolated resting platelets. This artificially increases background
through IL-1b protein-mediated IL-1b RNA splicing via IL-1
receptors and obfuscates the need for MyD88 in LPS-mediated
splicing in human platelets.
These data show that activated, but not necessarily aggregated,
platelets can independently influence endothelial activation. Because of the endothelial role in cardiovascular disease, we have
provided a new link between platelets and the septic syndrome.
Although our experiments used LPS, there are endogenous TLR4
ligands that may play a potential role in mediating aseptic, noninfectious inflammatory states (50, 51). Because platelets lack
nuclei, this research represents a useful and simple model for
studying posttranscriptional splicing in nucleated cells, such as
hematopoietic stem cells, where cotranscriptional processing obfuscates this process.
5495
5496
37. Chen, J., S. De, D. S. Damron, W. S. Chen, N. Hay, and T. V. Byzova. 2004.
Impaired platelet responses to thrombin and collagen in AKT-1-deficient mice.
Blood 104: 1703–1710.
38. Jang, S. W., X. Liu, H. Fu, H. Rees, M. Yepes, A. Levey, and K. Ye. 2009.
Interaction of Akt-phosphorylated SRPK2 with 14-3-3 mediates cell cycle and
cell death in neurons. J. Biol. Chem. 284: 24512–24525.
39. Cheng, C., Y. Qin, X. Shao, H. Wang, Y. Gao, M. Cheng, and A. Shen. 2007.
Induction of TNF-alpha by LPS in Schwann cell is regulated by MAPK activation signals. Cell. Mol. Neurobiol. 27: 909–921.
40. Rodriguez, N., R. Lang, N. Wantia, C. Cirl, T. Ertl, S. Dürr, H. Wagner, and
T. Miethke. 2008. Induction of iNOS by Chlamydophila pneumoniae requires
MyD88-dependent activation of JNK. J. Leukoc. Biol. 84: 1585–1593.
41. Flevaris, P., Z. Li, G. Zhang, Y. Zheng, J. Liu, and X. Du. 2009. Two distinct
roles of mitogen-activated protein kinases in platelets and a novel Rac1MAPK-dependent integrin outside-in retractile signaling pathway. Blood 113:
893–901.
42. Jackson, E. C., and A. McNicol. 2010. Cyclic nucleotides inhibit MAP kinase
activity in low-dose collagen-stimulated platelets. Thromb. Res. 125: 147–151.
43. Charruyer, A., S. Grazide, C. Bezombes, S. Müller, G. Laurent, and
J. P. Jaffrézou. 2005. UV-C light induces raft-associated acid sphingomyelinase
and JNK activation and translocation independently on a nuclear signal. J. Biol.
Chem. 280: 19196–19204.
44. Bowman, T. V., A. J. McCooey, A. A. Merchant, C. A. Ramos, P. Fonseca,
A. Poindexter, S. B. Bradfute, D. M. Oliveira, R. Green, Y. Zheng, et al. 2006.
Differential mRNA processing in hematopoietic stem cells. Stem Cells 24: 662–
670.
45. Behre, G., I. Schedel, B. Nentwig, B. Wörmann, M. Essink, and W. Hiddemann.
1992. Endotoxin concentration in neutropenic patients with suspected gramnegative sepsis: correlation with clinical outcome and determination of antiendotoxin core antibodies during therapy with polyclonal immunoglobulin
M-enriched immunoglobulins. Antimicrob. Agents Chemother. 36: 2139–
2146.
46. Opal, S. M., P. J. Scannon, J. L. Vincent, M. White, S. F. Carroll, J. E. Palardy,
N. A. Parejo, J. P. Pribble, and J. H. Lemke. 1999. Relationship between plasma
levels of lipopolysaccharide (LPS) and LPS-binding protein in patients with
severe sepsis and septic shock. J. Infect. Dis. 180: 1584–1589.
47. Ilkka, L., and J. Takala. 1996. Plasma endotoxin levels in the early phase of
septic shock. Intensive Care Med. 22(Suppl. 1): S9.
48. Guidet, B., V. Barakett, T. Vassal, J. C. Petit, and G. Offenstadt. 1994. Endotoxemia and bacteremia in patients with sepsis syndrome in the intensive care
unit. Chest 106: 1194–1201.
49. Lindemann, S., N. D. Tolley, D. A. Dixon, T. M. McIntyre, S. M. Prescott,
G. A. Zimmerman, and A. S. Weyrich. 2001. Activated platelets mediate inflammatory signaling by regulated interleukin 1beta synthesis. J. Cell Biol. 154:
485–490.
50. Park, J. S., F. Gamboni-Robertson, Q. He, D. Svetkauskaite, J. Y. Kim,
D. Strassheim, J. W. Sohn, S. Yamada, I. Maruyama, A. Banerjee, et al. 2006.
High mobility group box 1 protein interacts with multiple Toll-like receptors.
Am. J. Physiol. Cell Physiol. 290: C917–C924.
51. Vogl, T., K. Tenbrock, S. Ludwig, N. Leukert, C. Ehrhardt, M. A. van Zoelen,
W. Nacken, D. Foell, T. van der Poll, C. Sorg, and J. Roth. 2007. Mrp8 and
Mrp14 are endogenous activators of Toll-like receptor 4, promoting lethal,
endotoxin-induced shock. Nat. Med. 13: 1042–1049.
Downloaded from http://www.jimmunol.org/ by guest on June 14, 2017
21. Zhang, B., G. Ramesh, S. Uematsu, S. Akira, and W. B. Reeves. 2008. TLR4
signaling mediates inflammation and tissue injury in nephrotoxicity. J. Am. Soc.
Nephrol. 19: 923–932.
22. Kirschenbaum, L. A., D. McKevitt, M. Rullan, B. Reisbeck, T. Fujii, and
M. E. Astiz. 2004. Importance of platelets and fibrinogen in neutrophilendothelial cell interactions in septic shock. Crit. Care Med. 32: 1904–1909.
23. Muraki, M., B. Ohkawara, T. Hosoya, H. Onogi, J. Koizumi, T. Koizumi,
K. Sumi, J. Yomoda, M. V. Murray, H. Kimura, et al. 2004. Manipulation of
alternative splicing by a newly developed inhibitor of Clks. J. Biol. Chem. 279:
24246–24254.
24. Uto, T., X. Wang, K. Sato, M. Haraguchi, T. Akagi, M. Akashi, and M. Baba.
2007. Targeting of antigen to dendritic cells with poly(gamma-glutamic acid)
nanoparticles induces antigen-specific humoral and cellular immunity. J.
Immunol. 178: 2979–2986.
25. Horng, T., G. M. Barton, and R. Medzhitov. 2001. TIRAP: an adapter molecule
in the Toll signaling pathway. Nat. Immunol. 2: 835–841.
26. McWhirter, S. M., S. S. Pullen, J. M. Holton, J. J. Crute, M. R. Kehry, and
T. Alber. 1999. Crystallographic analysis of CD40 recognition and signaling by
human TRAF2. Proc. Natl. Acad. Sci. USA 96: 8408–8413.
27. Bharti, A. C., Y. Takada, S. Shishodia, and B. B. Aggarwal. 2004. Evidence that
receptor activator of nuclear factor (NF)-kappaB ligand can suppress cell proliferation and induce apoptosis through activation of a NF-kappaB-independent
and TRAF6-dependent mechanism. J. Biol. Chem. 279: 6065–6076.
28. Comalada, M., J. Xaus, A. F. Valledor, C. López-López, D. J. Pennington, and
A. Celada. 2003. PKC epsilon is involved in JNK activation that mediates LPSinduced TNF-alpha, which induces apoptosis in macrophages. Am. J. Physiol.
Cell Physiol. 285: C1235–C1245.
29. Martin, M., K. Rehani, R. S. Jope, and S. M. Michalek. 2005. Toll-like receptormediated cytokine production is differentially regulated by glycogen synthase
kinase 3. Nat. Immunol. 6: 777–784.
30. Pawlinski, R., J. G. Wang, A. P. Owens, III, J. Williams, S. Antoniak, M. Tencati,
T. Luther, J. W. Rowley, E. N. Low, A. S. Weyrich, and N. Mackman. 2010.
Hematopoietic and nonhematopoietic cell tissue factor activates the coagulation
cascade in endotoxemic mice. Blood 116: 806–814.
31. Cosemans, J. M., I. C. Munnix, R. Wetzker, R. Heller, S. P. Jackson, and
J. W. Heemskerk. 2006. Continuous signaling via PI3K isoforms beta and
gamma is required for platelet ADP receptor function in dynamic thrombus
stabilization. Blood 108: 3045–3052.
32. Trumel, C., B. Payrastre, M. Plantavid, B. Hechler, C. Viala, P. Presek,
E. A. Martinson, J. P. Cazenave, H. Chap, and C. Gachet. 1999. A key role of
adenosine diphosphate in the irreversible platelet aggregation induced by the
PAR1-activating peptide through the late activation of phosphoinositide 3-kinase. Blood 94: 4156–4165.
33. Jackson, S. P., S. M. Schoenwaelder, I. Goncalves, W. S. Nesbitt, C. L. Yap,
C. E. Wright, V. Kenche, K. E. Anderson, S. M. Dopheide, Y. Yuan, et al. 2005. PI
3-kinase p110beta: a new target for antithrombotic therapy. Nat. Med. 11: 507–514.
34. Yin, H., A. Stojanovic, N. Hay, and X. Du. 2008. The role of Akt in the signaling
pathway of the glycoprotein Ib-IX induced platelet activation. Blood 111: 658–665.
35. Kroner, C., K. Eybrechts, and J. W. Akkerman. 2000. Dual regulation of platelet
protein kinase B. J. Biol. Chem. 275: 27790–27798.
36. Woulfe, D., H. Jiang, A. Morgans, R. Monks, M. Birnbaum, and L. F. Brass.
2004. Defects in secretion, aggregation, and thrombus formation in platelets
from mice lacking Akt2. J. Clin. Invest. 113: 441–450.
LPS STIMULATION OF PLATELETS