close

Enter

Log in using OpenID

Che DNA hai nel piatto?

embedDownload
PROGETTO DIDATTICO DI GENETICA MOLECOLARE
LA “ MEMORIA” GENETICA DELL’ORTO LIGURE
CHE DNA HAI
NEL PIATTO ?
“Detecting genetically modified foods”
UNIVERSITA’ DEGLI STUDI DI GENOVA
COOP LIGURIA
Beatrice Zanini
1
QUADRO GENERALE DELL’ATTIVITA’
MODULO DI GENETICA MOLECOLARE:
MATERIALE:
Laboratorio di bioinformatica
Laboratorio di Genetica molecolare
Copie del testo
Testi in PP
TECNICHE UTILIZZATE IN LABORATORIO
ADATTA PER :
Estrazione di DNA da cellule vegetali
PCR
Gel Elettroforesi del DNA
Triennio della scuola superiore
CONCETTI CHIAVE
Gene/Locus/Allele
Polimorfismo allelico
Controllo dell’espressione genica
Plasmidi e ricombinazione batterica
Allestimento del costrutto trangenico
PREREQUISITI
1. La struttura del DNA.
2.. Dal DNA al cromosoma
3. Aploidia/Diploidia
4 Gene/Locus/Allele
5. Genotipo/Fenotipo
6. Duplicazione del DNA
7. Trascrizione del mRNA
8. Traduzione
9.
10.
11.
12.
13.
14.
15.
16.
Struttura dei geni
Regolazione dell’espressione genica.
Il promotore
Splicing .
Enzimi di restrizione
Cellula batterica
Plasmidi e ricombinazione batterica
Cellula vegetale
ATTIVITA’ WEBSITE
http://learn.genetics.utah.edu/
Virtual lab
DNA Learning Center-Cold Spring Harbor http://www.dnalc.org
GUIDA PER IL DOCENTE
A.
B.
C.
D.
INTRODUZIONE ALL’ATTIVITA’
OBIETTIVI DELL’APPRENDIMENTO
STRATEGIA D’INSEGNAMENTO
ABSTRACT
E. BACKGROUND DI CONOSCENZE DI BIOLOGIA MOLECOLARE
1. Trascrizione e maturazione dell’RNA
2. Struttura ed espressione dei geni. Il promotore. Regolazione della trascrizione.
Dal DNA al cromosoma. Replicazione del DNA.
3. La cellula batterica.Vettori di clonazione. Plasmidi e ricombinazione batterica
4. Enzimi di restrizione
F. CHE DNA HAI NEL PIATTO ?
1. Che cosa sono gli ogm ?
2. Come si fanno gli ogm ?
3. Perché si fanno gli ogm?
4. Come si fa un test di identificazione di ogm ?
2
pag.4
pag.5
pag.10
5. Perchè fare un test per evidenziare la presenza di ogm ?
6. Perchè c’è un dibattito sugli OGM ?
7. Legislazione italiana sugli OGM
G. TECNICHE UTILIZZATE IN LABORATORIO
1. Analisi molecolare del DNA:
2. Estrazione del DNA
3. PCR
Termociclatori
Taq polimerasi
Scelta dei primer
4. Elettroforesi su gel di agarosio
H. PROTOCOLLO DI LABORATORIO
1. Attività di Bioinformatica
2. Attività hands-on in laboratorio
pag. 16
pag. 18
pag. 23
GUIDA PER LO STUDENTE
1. Unità di misura usate in laboratorio
2. Diluizioni
3. Soluzioni da preparare
4. Pre-Test
5. Post-Test
6. Glossario
7. Bibliografia e Letture raccomandate
8. Una lettura da Scitable
9. Strumentazione e materiale a disposizione
10. Norme generali di sicurezza in laboratorio
pag.26
pag. 32
pag. 34
pag. 37
pag. 38
3
GUIDA PER IL DOCENTE
A. INTRODUZIONE ALL’ATTIVITÀ
Questa attività di laboratorio serve per esplorare e investigare le caratteristiche degli organismi (piante)
geneticamente modificati e permettere quindi agli studenti di eseguire un test genetico che identifica la
presenza di organismi geneticamente modificati (OGMs) nel cibo acquistato al supermercato.
Inoltre, questo laboratorio fornisce agli studenti l’opportunità di discutere sulle problematiche associate agli
OGM e al loro utilizzo nel cibo.
Nell’attività di laboratorio, gli studenti testeranno vari prodotti alimentari per determinare se essi contengono
mais geneticamente modificato.
B. OBIETTIVI DELL’APPRENDIMENTO
Gli studenti
 impareranno a impostare una ricerca scientifica
 condurranno un esperimento utilizzando tecniche complesse e controlli multistep
 potranno applicare i risultati di questi esperimenti ad argomenti scientifici
 imposteranno i calcoli per predisposrre le soluzioni necessarie
dovranno comprendere ed eseguire
 la tecnica di estrazione del DNA
 la Reazione di Polimerizzazione a Catena (PCR)
 la tecnica di elettroforesi su gel di Agarosio
dovranno definire
 la ricombinazione genetica
 il ruolo dei plasmidi batterici
 il significato degli organismi geneticamente modificati
dovranno descrivere
 il processo di trasformazione
 il ruolo dei batteri nelle odierne biotecnologie
 come e perchè vengono prodotti cibi geneticamente modificati
 i contributi significativi delle biotecnologie alla società, compresi gli aspetti relative ai settori
dell’agroalimentare e del farmaceutico
C. STRATEGIA D’INSEGNAMENTO:
1. Attività di Bioinformatica:
Abstract:
Gli studenti navigano nel Modulo
”Percorso di Bioinformatica”
per compiere una ricerca web e per
imparare l’approccio metodologico
di un lavoro di ricerca
Durata: Due ore
2.
Materiale:
Computers con accesso a Internet
Laboratorio di Genetica Molecolare
Abstract:
Il kit per la ricerca dell’OGM in campioni di cibo utilizza la tecnica della PCR per individuare la presenza
di due differenti sequenze associate a OGM: il promotore 35S del virus del mosaic del cavolfiore
(CaMV35S) e il terminatore del gene Nopaline sintetasi (NOS) del Agrobacterium Tumefaciens. Queste
sequenze, una o entrambe, sono presenti nelle sementi GM approvate e distribuite in Nord America, Asia ed
Europa. Con questo kit potremo condurre gli studenti alla conoscenza dell’argomento, con un approccio
“guided-inquiry” a vari livelli di verifica dei risultati, mimando un lavoro di ricerca che utilizza molteplici
procedure per affrontare domande aperte. L’integrità del DNA vegetale estratto è verificata con una
terza sequenza di DNA amplificata mediante PCR, il gene del cloroplasto del fotosistema II, presente in
tutti i vegetali. Nel kit viene fornito anche:
1. un campione di DNA di riferimento per valutare la corretta reazione di amplificazione delle due
sequenze geniche introdotte (CaMV35S e NOS).
2. un campione di DNA di cibo non OGM (certificato) per valutare eventuali contaminazioni dei campioni
utilizzati in laboratorio.
Durata: 4 ore
4
D. BACKGROUND DI CONOSCENZE E CONCETTI CHIAVE
STRUTTURA DEL DNA EUCARIOTICO
La molecola del DNA è un polimero, ossia è un insieme di tanti monomeri: i nucleotidi.
Ogni nucleotide è costituito da tre componenti: un gruppo fosfato, uno zucchero (desossiribosio) e una base
azotata.
La molecola di DNA è formata da due catene polinucleotidiche avvolte
l’una intorno all’altra con andamento destrorso. Le due catene sono
antiparallele, cioè i due singoli filamenti sono orientati uno in direzione
5’->3’ e l’altro 3’->5’. Gli scheletri zucchero –fosfato si trovano
all’esterno, le basi azotate all’interno. Le basi delle due catene sono
unite tra loro mediante legami a idrogeno (Fig. 1). Le basi sono
complementari e il loro appaiamento è: A=T Adenina – Timina G =C
Guanina - Citosina
L’informazione genetica risiede nella sequenza di basi.
REPLICAZIONE DEL DNA
La replicazione del DNA in tutte le cellule viventi, dai batteri all’uomo, è un processo complesso, che richiede
l’intervento di più di una dozzina di enzimi diversi. La replicazione comincia in corrispondenza di siti detti
origine di replicazione presenti ad intervalli sul DNA; alcune proteine srotolano la doppia elica di DNA,
rompendo i legami a idrogeno tra le basi dei filamenti complementari.
L’allineamento e unione tra loro dei nucleotidi complementari avviene per azione della DNA polimerasi che
procede solo in direzione 5’-> 3’. La DNA polimerasi, per iniziare il processo, ha anche bisogno di un innesco
(detto anche primer), a cui attaccarsi e procedere con la polimerizzazione a intervalli lungo i cromosomi.
Durante la replicazione del DNA, il primer è costituito da una corta sequenza polinucleotidica di RNA. La
replicazione è semiconservativa: ogni emi-elica (singolo filamento) della molecola madre serve da stampo per la
sintesi di un nuovo filamento, per cui ogni doppia elica figlia sarà costituita da un filamento vecchio e da un
filamento nuovo. Le molecole risultanti sono copie esatte dell’originale. Da una doppia elica madre derivano due
doppie eliche figlie uguali tra loro e uguali alla molecola madre.
DAL DNA AL CROMOSOMA
Alla molecola di DNA sono associati gli istoni (proteine basiche),
essenziali per permettere l’avvolgimento e il ripiegamento del DNA
in strutture estremamente compatte, vale a dire i cromosomi,
visibili solo durante la divisione cellulare
Il cromosoma:
 Unità strutturale e colorabile che porta i geni disposti in modo lineare.
 E’ considerato anche come un insieme di geni - o gruppo di associazione
- organizzati secondo una successione lineare che tendono ad essere
ereditati insieme.
5
STRUTTURA ED ESPRESSIONE DEI GENI
Dal punto di vista della Genetica Molecolare per gene s’intende una sequenza di DNA potenzialmente
trascrivibile in RNA funzionalmente attivo. Tale RNA può svolgere direttamente una funzione
strutturale e/o catalitica (rRNA, tRNA) oppure trasportare l’informazione per la sintesi di una proteina
(mRNA). Nel genoma umano si stima che siano presenti circa 23.000 geni codificanti proteine e 1000-2000 geni
codificanti RNA strutturali. Da recenti studi emergerebbe però l’esistenza di diverse migliaia (o decine di
migliaia) di trascritti non codificanti che potrebbero non avere alcuna funzione o, viceversa, svolgere un
ruolo fondamentale nella regolazione della conformazione della cromatina e della trascrizione di geni
codificanti proteine.
TRASCRIZIONE E MATURAZIONE DEGLI RNA
L’informazione genetica contenuta nelle sequenze del DNA viene trasferita all’RNA e dall’RNA al polipeptide
corrispondente. Durante la trascrizione, un complesso proteico, comprendente l’enzima RNA polimerasi,
sintetizza le molecole di RNA sullo stampo delle sequenze di DNA che costituiscono le unità di trascrizione.
La RNA polimerasi si lega al sito d’inizio della trascrizione insieme ad altre proteine, dette fattori di
trascrizione. Questi fattori, mediante l’interazione con brevi sequenze di DNA presenti nella regione a monte
dell’inizio della trascrizione (promotore), servono a posizionare la RNA polimerasi nel sito giusto e a separare
i due filamenti di DNA per formare la bolla di trascrizione. L’enzima usa come stampo uno dei due filamenti di
DNA in direzione 5’->3’, catalizzando il legame fosfodiestere tra il gruppo ossidrilico legato al C3’ del
ribonucleotide precedente e il fosfato del nuovo ribonucleotide. Il processo continua fino a che la polimerasi
incontra una sequenza di arresto. A questo punto si stacca e libera la catena di RNA, mentre la bolla di
trascrizione si richiude e il DNA riassume la conformazione a doppia elica. L’RNA neosintetizzato ha la
sequenza di basi identica a quella di uno dei due filamenti di DNA (il filamento senso), anche se la Timina è
sostituita dall’Uracile. Da uno stesso gene possono essere trascritte consecutivamente numerose copie di RNA e
il livello di trascrizione dipende da complessi meccanismi (vedi la regolazione della trascrizione).
E’ importante ricordare che le cellule eucariotiche possiedono tre tipi di RNA polimerasi:
- RNA polimerasi I trascrive i geni degli RNA ribosomiali
- RNA polimerasi II trascrive i geni che codificano proteine sintetizzando i precursori degli RNA
messaggeri e anche alcuni piccoli RNA
- RNA polimerasi III trascrive i geni di tutti gli RNA transfer, un RNA ribosomiale e altri piccoli RNA.
I precursori degli mRNA neosintetizzati (trascritti primari) devono subire una serie di modificazioni prima di
essere trasferiti nel citoplasma per venire tradotti sui ribosomi. Questo processo di maturazione degli
mRNA include le seguenti modificazioni:
• Aggiunta all’estremità 5’ di un cappuccio (cap). Al primo nucleotide all’estremità 5’ della molecola di
RNA nascente viene rimosso il fosfato terminale e viene aggiunta una molecola di Guanosina
monofosfato (GMP) metilata in posizione 7’. Il capping serve per proteggere il trascritto dall’attacco
delle esonucleasi che lo degraderebbero, e per facilitare il trasporto dal nucleo al citoplasma.
• Rimozione di alcune sequenze che non vengono tradotte (processo di splicing). Quasi tutti i geni
eucariotici sono divisi in sequenze codificanti, chiamate esoni, e sequenze non tradotte, dette introni.
Questi ultimi vengono rimossi dai trascritti primari mediante il processo di splicing. Gli introni sono
quindi sequenze di DNA, situate tra due esoni, le quali sono trascritte ma non tradotte. Salvo rare
eccezioni, gli introni iniziano sempre con i nucleotidi GT e terminano con i nucleotidi AG (regola GT-AG).
Nel processo di splicing si verifica prima la scissione all’inizio dell’introne (5’), poi l’estremità libera
dell’introne si ripiega su se stessa formando una struttura simile ad un laccio e infine avviene il taglio
a livello della giunzione 3’ dell’introne. Quindi i due esoni si uniscono mentre l’introne va perso. Una
struttura macromolecolare (costituita da varie subunità di molecole di piccoli RNA nucleari, gli snRNP,
e da una serie di proteine specifiche) promuove e controlla le reazioni dello splicing.
• Aggiunta all’estremità 3’ di una coda poli-A. La maggior parte delle unità di trascrizione hanno una
breve sequenza (AAAAA) che specifica il sito di termine della trascrizione. Circa 15-30 nucleotidi a
valle di questo sito, l’RNA neosintetizzato viene scisso da un enzima, una endonucleasi, e alla molecola
di RNA vengono aggiunti circa 200 residui di Adenosina monofosfato (AMP). Questa coda di poli-A ha lo
scopo di stabilizzare le molecole degli mRNA maturi e di facilitare il loro trasporto dal nucleo al
citoplasma.
6
IL PROMOTORE
La regione a monte del sito d’inizio della trascrizione è detta promotore. La numerazione dei nucleotidi inizia
da -1, che corrisponde al nucleotide che precede il sito d’inizio della trascrizione (indicato con +1). In questa
regione, di lunghezza variabile, si trova una serie di brevi sequenze che vengono riconosciute e legate da
fattori di trascrizione. I fattori di trascrizione favoriscono il legame dell’RNA polimerasi al sito giusto per
iniziare la sintesi di RNA. I geni che presentano elevati livelli di trascrizione, presentano nel promotore delle
sequenze specifiche ( es. i TATA box a circa -25 bp dal sito d’inizio della trascrizione; il CAAT box a -80 bp
dal sito d’inizio della trascrizione). Accanto a sequenze comuni a molti promotori, vi sono elementi che sono
riconosciuti da fattori di trascrizione tessuto-specifici. Anche i geni che mostrano un’espressione tessutospecifica vengono spesso trascritti a livelli molto bassi in tutte le cellule. Vi sono altre sequenze che vengono
riconosciute da fattori di trascrizione quali gli elementi di risposta, localizzati nel promotore o nella regione 5’
del gene, e gli elementi indicati come enhancer (intensificatori), che servono per aumentare i livelli basali
della trascrizione e sono localizzati a distanza variabile dal gene, talvolta anche a valle del sito d’inizio della
trascrizione, vale a dire all’interno della regione trascritta.
Maturazione del mRNA
Sito d’inizio della trascrizione
+1
segnale di poliA
sito poliA
promotore
CG
box
CG CAAT
box
box
ATG
TATA
box
GT
5’UTR
>>>>>>>>>>>>>
direzione di lettura del gene
precursore dell’mRNA
codone di stop
esone 1
AG
introne 1
GT
esone 2
AG
introne 2
esone3 3’UTR
TRASCRIZIONE
GT
CAP
AG
GT
AG
AAAAA
AAA
SPLICING
mRNA MATURO
CAP
AAAAA
REGOLAZIONE DELLA TRASCRIZIONE
Due sono le condizioni perché si abbia una efficace trascrizione.
1. La presenza nella cellula di specifici fattori di trascrizione che interagiscono con brevi sequenze nel
promotore del gene e con sequenze enhancer e consentono l’assemblaggio del complesso di trascrizione
2. Una conformazione della cromatina del gene “aperta”, ovvero i nucleosomi non compattati e,
possibilmente, il DNA non associato agli istoni nel promotore.
Il controllo dell’espressione genica mediante il legame di fattori proteici con le sequenze di regolazione è
estremamente complesso e coinvolge numerosi fattori che possono essere grossolanamente distinti in fattori
ubiquitari e tessuto-specifici. L’interazione di fattori specifici con gli elementi enhancer è importante per
l’espressione genica tessuto-specifica.
7
Elementi regolatori della trascrizione
1. fattori di trascrizione
2. elementi cis-acting
3. elementi di regolazione distanti anche 1 Mb
4. promotori alternativi/multipli
5. modificazioni in DNA e istoni (acetilazione o metilazione)/accessibilità alla cromatina
6. piccoli RNAs-di tanti tipi.
Enhancers
Gli enhancers sono sequenze nucleotidiche cis-agenti che esplicano la loro funzione aumentando notevolmente
(fino a 200 volte) la frequenza di trascrizione del gene che controllano. Dal punto di vista strutturale, un
enhancer non differisce molto da un promotore. Gli enhancers non devono necessariamente essere vicini ai
promotori: è possibile infatti trovare degli enhancer a parecchie centinaia di migliaia di paia di basi di distanza
a valle o a monte del sito d'inizio della trascrizione.
LA CELLULA BATTERICA
Caratteristiche della cellula batterica
1. Dimensioni relativamente piccole (diametro circa 1 microm)
2. Cromosoma circolare lungo fino a 1 mm.
3. Presenza di un nucleoide: regione della cellula contenente il DNA
4. Capacità di scambiare informazioni genetiche (plasmidi)
5. Capacità di simbiosi (es. microflora intestinale, endosimbionti) o parassitismo (micoplasmi , clamidie,
rickettsie)
NUCLEOIDE
- Singolo cromosoma non circondato da membrana
nucleare
- Unica molecola circolare di DNA ds
- 3 -6×103 geni
- Il DNA è probabilmente organizzato in anse ad alta
superelicità (vi sarebbero circa 50 anse per
cromosoma).
- Ogni ansa sarebbe stabilizzata da una molecola di RNA.
PLASMIDI
- Sono piccole porzioni di materiale genetico extracromosomiale, circolare.
- Possono replicarsi autonomamente e permanere nella cellula batterica per numerose generazioni.
- Sono di solito costituiti da porzioni di DNA a doppia elica, che posseggono le proprietà di un piccolo
cromosoma (possibilità di replicarsi)
- Sono da 1/20 a 1/100 della dimensione di un cromosoma
- Contengono da 50 a 100 geni
- Le informazioni che veicolano non sono essenziali per la sopravvivenza della cellula
8
VETTORI DI CLONAZIONE
Per ottenere piante geneticamente modificate si utilizza un
vettore naturale, il plasmide Ti, presente nel batterio
Agrobacterium tumefaciens
CHE COS’E’ UN VETTORE?
Un vettore è una molecola di DNA capace di replicarsi in una cellula ospite. I vettori più frequentemente usati
in biotecnologia sono i plasmidi del batterio Escherichia. coli. I plasmidi sono piccole molecole di DNA circolare
a doppio filamento, extracromosomico, che esistono naturalmente nei batteri, con cui convivono come simbionti.
Si replicano autonomamente nella cellula ospite, grazie alla presenza di una sequenza di origine (ORI) della
replicazione. Molti plasmidi contengono geni che forniscono benefici alla cellula ospite (per esempio geni che
codificano enzimi che inattivano gli antibiotici, e quindi conferiscono resistenza ad essi), o geni di trasferimento,
che codificano proteine capaci di formare un tubo macromolecolare attraverso cui il DNA plasmidico può essere
trasferito ad altre cellule.
COME SI CLONA UN GENE?
Per il clonaggio del DNA si usano plasmidi modificati geneticamente in laboratorio, da cui sono stati eliminati
praticamente tutti i geni e che contengono solamente una origine di replicazione del DNA (ORI), un gene che
consente la selezione (in genere un gene per la resistenza a un antibiotico, ad esempio il gene ampr che
conferisce resistenza all’antibiotico ampicillina) e una regione (T-DNA) in cui possono essere inseriti i segmenti
di DNA esogeno. Il transgene è quindi inserito in un vettore capace di entrare in una cellula target.
Per fare questo, bisogna rimuovere le porzioni di DNA dannose e lasciare i geni da trasferire nella cellula
ospite. Una volta dentro la cellula ospite, i geni entreranno a far parte del genoma ospite.
A questo punto, ogni volta che il DNA si replica e nuove cellule si formeranno, il transgene passerà in ogni
nuova cellula. Un clone batterico può essere fatto crescere a piacimento e quindi si avranno a disposizione
grosse quantità di DNA ricombinante. Questa tecnica è detta clonazione molecolare. Si può anche fare in modo
che il DNA estraneo introdotto in un batterio venga non solo replicato, ma anche espresso. Se questo DNA
viene provvisto delle opportune regioni di controllo che mettono in moto l'apparato di trascrizione e poi di
traduzione del batterio, esso si comporterà come un normale gene di quest'ultimo. Il batterio produrrà quanto
codificato dal DNA "ospite". In questo modo si sono ottenuti Microrganismi Geneticamente Modificati (MGM)
facenti parte dell'ampio gruppo degli OGM. I microrganismi così ottenuti sono, per così dire, "fabbriche
molecolari" in grado di produrre una grandissima varietà di prodotti.
Questa tecnologia è stata sfruttata dall'industria a partire dalla seconda metà degli anni settanta. Si ricordi
che tra i primi prodotti ottenuti per via biotecnologica spicca l'insulina umana, prodotta in E. coli in cui è
stato inserito il gene che codifica per questo ormone (1978, USA, Genetech).
Struttura di un plasmide: OR = origine di replicazione del DNA
ampr = gene per la resistenza all’antibiotico ampicillina
Con questa tecnologia, oltre a modificare geneticamente i microrganismi (MGM) per far loro produrre farmaci,
prodotti chimici, enzimi per l'industria alimentare e per altre produzioni industriali, è stato possibile cambiare
9
in maniera mirata le caratteristiche genetiche di organismi superiori, come le piante. Alcune piante sono state
geneticamente modificate (PGM) ottenendo piante transgeniche con caratteristiche utili (ad es: resistenza agli
insetti, ai pesticidi e agli stress ambientali o maggiore resa produttiva).
Come abbiamo già detto a proposito dei microorganismi, la manipolazione delle piante non è soltanto quella
dell'ingegneria genetica. Già nell'antichità si selezionavano attraverso incroci programmati le specie più adatte,
quelle più resistenti e/o quelle che davano i migliori raccolti; anche la pratica delle talee è nota da tempo.
Le tecniche dell’ingegneria genetica consentono anche la produzione di animali geneticamente modificati.
Questo argomento esula dai contenuti di questo testo e ci limitiamo quindi a darne un breve cenno.
A differenza delle piante, che hanno cellule totipotenti, per ottenere un animale geneticamente modificato è
necessario riuscire a manipolarne la linea germinale, ossia introdurre il gene esogeno nelle cellule uovo o negli
spermatozoi. Il procedimento per produrre un animale geneticamente modificato è quindi più complesso:
attualmente viene per lo più utilizzata una strategia di tipo indiretto che comporta l’introduzione del DNA
esogeno in cellule embrionali staminali di una linea che cresce in coltura; la selezione delle cellule staminali
modificate e la loro iniezione in un embrione precoce isolato in vitro; la reintroduzione dell’embrione manipolato
in una femmina pseudogravida e la selezione degli animali della progenie in cui il gene è presente nelle cellule
della linea germinale. Disponendo di attrezzature molto sofisticate è anche possibile micromanipolare
direttamente una cellula uovo.
ENZIMI DI RESTRIZIONE
Una endonucleasi di restrizione è un enzima che taglia il legame fosfodiesterico nel DNA a doppia elica a livello
di sequenze specifiche, i siti di restrizione . Le sequenze target sono relativamente corte. Esempio, il
comune enzima di restrizione EcoRi1 ha una sequenza target di 6 bp. Ad oggi, sono stati isolati centinaia di
enzimi di restrizione, soprattutto dai batteri. I batteri usano questi enzimi come un meccanismo di difesa
perchè riconoscono ed eliminano DNA estranei (virus).
Gli enzimi di restrizione tagliano il doppio filamento di DNA in alcuni modi: qualche volta si tagliano entrambi i
filamenti nella stessa posizione, formando le estremità blunt. Altre volte si tagliano i filamenti in punti
diversi determinando delle sporgenze; questo significa che un filamento è più lungo dell’altro e le estremità si
chiamano “sticky ends”.
La digestione con ER va condotta a 37°C in una soluzione tampone
(fornita insieme all’enzima dal produttore) che garantisce le condizioni
ottimali (di salinità e pH) per la digestione. Il tempo di incubazione
varia a seconda se si digerisce DNA genomico o frammenti di DNA corti
Nel primo caso la digestione richiede almeno 8 ore (o tutta la notte).
Nel secondo caso sono sufficienti da 1-4 ore. Gli ER sono reagenti
costosi e delicati. Temono le contaminazioni (usare precauzioni nel
prelevare l’enzima dalla soluzione stock) e l’inattivazione (si devono
conservare a -20°C e, al momento dell’uso, mantenere sempre in un
bagno di ghiaccio)
10
“CHE DNA HAI NEL PIATTO?”
1. CHE COSA SONO GLI ORGANISMI GENETICAMENTE MODIFICATI (OGM) ?
Definizione
L'Art.3 del D.lgs n. 92 del 3-3-93 definisce l'OGM come:
" un organismo il cui materiale genetico è stato modificato in modo diverso da quanto si verifica in natura
mediante incrocio o con la ricombinazione naturale".
Grazie all'ingegneria genetica è possibile introdurre in un organismo una caratteristica nuova in modo preciso e
mirato ed in tempi relativamente brevi. Per sottolineare la delicatezza della nuova tecnologia, nei diversi paesi
in cui viene applicata per scopi scientifici, ne è stata data una precisa definizione "legale", conseguenza di una
specifica legislazione governativa rivolta al suo controllo.
Ecco, ad esempio, la definizione di ingegneria genetica data dal Governo britannico:
"Produzione di nuove combinazioni di materiale ereditabile, ottenute mediante l'inserzione di molecole di acido
nucleico (DNA), di qualunque provenienza, in un organismo ospite, nel quale tali molecole di DNA non sono
presenti naturalmente, ma nel quale, una volta acquisite, possono propagarsi indefinitamente."
Gli OGM sono organismi le cui caratteristiche genetiche sono state manipolate in laboratorio e possono essere
virus, batteri, funghi, piante od animali. Questo è possibile grazie all'universalità del codice genetico, al fatto
cioè che tutti gli esseri viventi, dal punto di vista genetico, parlano la stessa lingua. Un gene umano, introdotto
in una cellula batterica, o un gene batterico introdotto in una cellula vegetale, faranno sintetizzare nella
cellula ricevente la stessa proteina prodotta nella cellula donatrice.
Un organismo geneticamente modificato contiene DNA esogeno, cioè non presente naturalmente nell’organismo.
Spesso la modificazione consiste nell’introduzione di nuove e/o modificate caratteristiche nell’organismo. Gli
OGM sono diventati sempre più presenti e comuni in agricoltura.
Uno dei primi esempi di organismo geneticamente modificato si ebbe nel 1978 quando l’industria Genetech
trasferì il gene dell’Insulina umana in un ceppo di E.coli. Le cellule di E.coli erano in grado di produrre insulina
che poi sarebbe stata raccolta e usata per la cura del diabete.
Da allora molti altri organismi sono stati geneticamente modificati: batteri, topo, pesce e piante.
2. COME SI FANNO LE PIANTE OGM ?
1°STEP. Bisogna identificare la proteina che ha la potenzialità di migliorare le colture di cereali. Una comune
classe di colture GM ha inserito nel proprio genoma un gene (transgene) del batterio Bacillus thuringiensis (Bt)
che vive nel terreno. I cereali Bt producono una proteina chiamata delta-endotossina . I coltivatori che
seminano cereali Bt non devono usare insetticidi perché le piante producono questa tossina nelle loro cellule
che uccide gli insetti.
2° STEP. Bisogna quindi isolare il gene che codifica per questa proteina. Questo gene deve essere dapprima
localizzato nel genoma di un organismo ( il batterio Bt); quindi deve essere copiato in modo da essere poi
clonato fuori dall’organismo.
3° STEP. I geni contengono segnali che regolano l’espressione nelle loro cellule ospiti, ma questi segnali
possono non essere riconosciuti da cellule di altri organismi. Quindi il terzo step consiste nella
ingegnerizzazione del gene, in modo che le cellule delle piante di cereali riescano a leggere correttamente il
gene e produrre la proteina d’interesse. Questo si fa “alleggerendo” il gene delle sequenze introniche non
codificanti, e aggiungendo o cambiando le sequenze che renderanno il gene capace di esprimersi all’interno
delle cellule dei cereali, compresi il promotore e il terminatore.
11
Il promotore serve come sito d’attacco della RNA polimerasi e come segnale per indicare dove iniziare a
trascrivere il gene.
Il terminatore è il segnale di stop, fine trascrizione.
I promotori e i terminatori di geni non modificati interagiscono con altri componenti di una cellula ospite per
accendere o spegnere i geni a seconda del tipo di cellule e della situazione, ma gli scienziati possono
ingegnerizzare i costrutti per gli OGM cosicchè il gene estraneo venga continuamente trascritto e la proteina
estranea sia prodotta dall’intera pianta. Il promotore più comune usato nei cereali GM è il 35S promoter
del virus del mosaico del cavolfiore (CaMV 35S). Questo promotore viene scelto perché già presente in
natura con il compito di attivare la trascrizione in tutti i tipi cellulari vegetali. Il terminatore più usato nei
cereali GM è nopaline synthase (NOS), terminatore dell’Agrobacterium tumefaciens.
Uno o entrambi questi elementi regolatori sono presenti nel 85% circa di tutti i cereali GM prodotti nel mondo.
Una volta che il gene è ingegnerizzato con il promotore e il terminatore adeguati, bisogna introdurlo nella
pianta. Il gene non può essere inserito in tutte le cellule della pianta; piuttosto, singole cellule vegetali sono
trasformate inserendo questo gene, e quindi da queste cellule nasceranno nuove piante.
4° STEP. Il gene ingegnerizzato nel plasmide è quindi trasferito nelle cellule vegetali con vari metodi, ognuno
dei quali permette al DNA batterico di passare attraverso la parete cellulare, la membrana cellulare e quella
nucleare. Uno di questi metodi consiste nell’usare una versione GM di Agrobacterium tumefaciens. Questo
batterio causa la malformazione nota come “crown gall disease”, una volta inserito un po’ del suo DNA nel
genoma di cellule ospiti. Questa insolita capacità naturale è sfruttata per trasferire il gene ingegnerizzato
nel genoma della pianta.
Ma..non tutti i plasmidi di Agrobatterio portano
il costrutto CaMV 35S + Gene Bt + NOS !! Per riconoscere i plasmidi,
e quindi le cellule vegetali con il costrutto, bisogna inserire anche un “gene reporter”,
es. un gene di resistenza ad un antibiotico.
Questo gene entra in azione una volta che il plasmide è entrato nella cellula vegetale. Infatti, mettendo
l’antibiotico nel terreno di coltura dove si seminano le cellule vegetali, cresceranno solo le piantine che portano
il gene per la resistenza all’antibiotico, cioè quelle con il costrutto.
5° STEP. L’ultima tappa necessaria per fare un cereale GM consiste nel re-incrocio del cereale
ingegnerizzato con il genoma del cereale più comunemente coltivato. Questo passaggio può richiedere anni
perché solo il 50% del genoma coltivato viene trasferito ad ogni incrocio in quello geneticamente modificato.
Il processo di modificazione genetica è quindi poco efficiente, costoso e richiede molto tempo.
Un secondo metodo è l’elettroporazione nella quale, creando una corrente elettrica attraverso la membrana
cellulare, si permette l’ingresso del DNA plasmidico ingegnerizzato.
Un terzo metodo utilizza uno strumento chiamato "gene gun" che fisicamente spara particelle d’oro legate al
DNA ingegnerizzato all’interno delle cellule.
Nessuno di questi tre metodi è abbastanza efficiente e le poche cellule che vengono trasformate devono poi
12
essere sempre identificate e separate da quelle immodificate.
Oltre al gene di resistenza ad un antibiotico, si può usare come marcatore di selezione anche il gene per la
Proteina Green Fluorescent.
3. PERCHÉ SI FANNO GLI OGM?
Le piante vengono modificate per migliorarne la qualità da molti punti di vista:
• resistenza ad agenti patogeni
• tolleranza a stress ambientali
• attività insetticida
• resistenza a erbicidi
• vita più lunga o maturazione ritardata
• migliori qualità nutrizionali delle proteine del seme
• allungamento dei tempi di conservazione
• nuova strategia per la produzione di vaccini
Per secoli, l’uomo ha sviluppato migliori varietà di molte colture e di animali attraverso la selezione di tecniche
di incrocio. Sebbene queste tecniche abbiano sempre riscosso grande successo, esse richiedono tempi lunghi per
avere risultati. Inoltre, con queste tecniche possono essere selezionati solo i caratteri naturalmente espressi.
Con l’odierna tecnologia che permette iltrasferimento di DNA da un organismo ad un altro, si sono ottenuti più
velocemente nuovi incroci.
Esempi di colture geneticamente modificate oggi disponibili.
Sul mercato le piante transgeniche presenti sono la soia, il mais, il cotone e la colza ed i geni inseriti
sono solo di due tipologie, quelli che conferiscono resistenza agli erbicidi e quelli che danno resistenza agli
insetti.
Mais Starlink, prodotto dall’Aventis, è velenoso per un bruco ed altri insetti. Nel 1998 ne era stata
approvata la produzione per il solo uso animale. Nel 2000 ricerche effettuate in USA stabilirono che il mais
tradizionale era contaminato per il 25% di Starlink, nel 2001 la contaminazione passò al 75%.
Mais BT, questo mais grazie al gene di un batterio (Bacillus Thuringiensis) è capace si secernere naturalmente
una tossina, che lo rende resistente ad alcuni insetti.
Soia Roundup Ready, prodotto dalla Monsanto, è resistente ai diserbanti "Roundup" anch’essi prodotti dalla
stessa multinazionale. Questi speciali sementi permettono ai coltivatori di usare in maniera indiscriminata i
diserbanti prodotti dalla Monsanto, sicuri che essi elimineranno tutte le erbe infestanti, ma non la soia.
La coltivazione su larga scala di mais, cotone e
patate con geni Bt è iniziata nel 1997 in Australia,
Argentina e Canada.
La tossina prodotta dal gene Bt è stata sperimentata
anche su pioppo, melanzana, tabacco e soia
4. COME SI FA UN TEST DI IDENTIFICAZIONE
DI OGM ?
In questa attività di laboratorio, il test di identificazione del cibo modificato è basato sulla ricerca del
transgene in una serie di campioni di cibo. Il metodo di individuazione è in grado di identificare molte specie di
mais e soia geneticamente modificate.
Gli OGM sono spesso fenotipicamente identici al tipo tradizionale equivalente, nel senso che l’aspetto generale
non è diverso, anche se l’OGM ha acquisito una caratteristica ereditaria nuova, dovuta al transgene.
Ci sono due sistemi comuni di rilevazione della presenza di OGM nelle sementi. Uno è ELISA ( Enzyme Linked
ImmunoSorbent Assay): si usa un anticorpo per identificare e legare una specifica proteina del OGM. L’altro
test, quello che verrà eseguito in laboratorio, si basa su una reazione chiamata PCR (Polymerase chain
reaction).
13
…. Quindi o si ricerca il gene o il prodotto del gene……
Cibo
Cibo
Estrazione del DNA
Proteina
Amplificazione del DNA
Corsa elettroforetica
dei frammenti
su gel di agarosio
ELISA
Analisi dei risultati
Analisi dei risultati
La nostra analisi si basa sul primo metodo e comprende le seguenti fasi:
• campionamento
!
• estrazione del DNA
• amplificazione con PCR
• elettroforesi
• analisi dei risultati
Campionamento ed
estrazione del
DNA
PCR
elettroforesi
valutazione dei risultati
5. PERCHÈ FARE UN TEST PER EVIDENZIARE LA PRESENZA DI OGM ?
Gli USA e l’Europa hanno differenti politiche sui requisiti necessari ai prodotti alimentari. Come già detto
prima, negli USA, i prodotti alimentari contenenti OGM non devono portare una particolare etichetta. In
Europa invece non vengono accettate importazioni di sementi GM maggiori di 0,9%. In altri paesi, come il
Messico, gli OGM sono proibiti con lo scopo di tutelare il patrimonio agricolo del paese.
6. PERCHÈ C’È UN DIBATTITO SUGLI OGM ?
Si sono manifestate un certo numero di preoccupazioni sugli OGM a riguardo della salute umana e la
salvaguardia dell’ambiente. L’utilizzo di cibo geneticamente modificato può esporre un individuo a proteine che
il sistema immunitario non riconosce, innescando una reazione allergica. L’ambiente può “soffrire” di una
selezione operata sugli insetti dannosi per l’agricoltura con ripercussioni sulla catena alimentare.
Ci sono anche preoccupazioni che le colture geneticamente modificate possano diventare lo standard nella
produzione alimentare e i paesi in via di sviluppo pesantemente dipendenti da quelli industrializzati per
l’acquisto di sementi.
7. LEGISLAZIONE ITALIANA SUGLI OGM
L'Unione Europea (UE) attua una politica comune in materia di alimenti modificati geneticamente, e ha
elaborato una legislazione in tutto l'ambito della UE. Le differenti legislazioni nazionali rispecchiano questa
politica comune, con leggeri adattamenti.
In Italia gli OGM non sono coltivati, ma vengono importati per
destinarli ai mangimifici. Difatti, la soia ed il mais transgenici vengono utilizzati per nutrire gli animali,
14
!
tuttavia i prodotti alimentari che derivano da essi (latte, carne, uova ecc.) non riportano (perché non c'è
l'obbligo) indicazioni di eventuali tracce di OGM.
Il problema è controllare il fornitore, impresa ardua visto che la Comunità Europea non obbliga l'indicazione di
OGM nell’etichetta dei mangimi. L'Europa, a differenza degli Stati Uniti, ha fatto proprio il principio di
precauzione sugli OGM, cioè prodotti che potrebbero essere rischiosi per la salute devono essere evitati e non
immessi sul mercato in attesa di ulteriori ricerche e documentazione. Una legge europea porta la tollerabilità
ad un massimo di 0,9% di OGM negli alimenti, questo perché tracce possono sempre esserci.
Alimenti per bambini. DPR 128, 26 maggio 1999:
E’ stato sancito il divieto d’utilizzo di prodotti costituiti o contenenti OGM nei prodotti alimentari destinati ai
lattanti e bambini fini ai tre anni d’età (ad eccezione dei latti, compresi quelli vegetali, soia, per i quali si
applica un altro decreto). Maggio 2000 Modifica del DPR: " alcune modifiche in materia di alimenti a base di
cereali e di altri alimenti destinati ai bambini e ai lattanti….stabiliscono l’elenco degli antiparassitari il cui impiego,
rappresenta un rischio per la salute dei bambini, sarà vietato in assoluto nel trattamento dei prodotti agricoli
utilizzati come materia prima per la preparazione dei prodotti, fermo restando il divieto totale di prodotti
geneticamente modificati.
Latti animali e di soia. Per i latti artificiali compresi quelli di soia, è giunta a revisione la legge 500/94 che
prescrive il divieto di utilizzare materie prime transgeniche, in armonia con il DPR 128/99.
D.M. n.500, 6
aprile 1994: " vieta che organismi geneticamente modificati siano contenuti negli alimenti per lattanti e negli alimenti
di proseguimento. Dispone che gli alimenti per lattanti e gli alimenti di proseguimento non debbano contenere alcune
sostanze in quantità tale da poter nuocere alla salute dei lattanti e dei bambini….vieta la commercializzazione dei
prodotti non conformi alle disposizioni previste dal regolamento a decorrere dal 1 luglio 2002.
Tutti i cibi e mangimi che presentano elementi geneticamente modificati autorizzati in misura superiore allo
0,9% dovranno essere etichettati. Entro sei mesi dalla pubblicazione sulla Gazzetta Ufficiale dell'Unione
Europea, le aziende dovranno provvedere all'etichettatura. Gli OGM dovranno avere un proprio codice
identificativo che consenta di conoscere il tipo di modifica genetica a cui sono stati sottoposti. Per i 13 OGM
non ancora autorizzati è stata stabilita una soglia di tolleranza dello 0,5%. Se la soglia è superata il prodotto
viene ritirato dal mercato.
Ai sensi della articolo 12 della legge 1096/71, che stabilisce la produzione, commercializzazione e l'impiego di
materiale sementiero, qualunque semente, sia essa convenzionale o ottenuta mediante biotecnologie, può essere
commercializzata, posta in vendita o messa altrimenti in commercio solo se appartenente a varietà iscritte nei
registri e nel registro nazionale italiano. Inoltre le varietà geneticamente modificate, per poter essere
coltivate, sono soggette all'autorizzazione di cui all'articolo 1, comma 2, del Dlgs 212/2001.
Non vi sono attualmente varietà geneticamente modificate di mais e soia iscritte nel registro nazionale italiano
ovvero nel catalogo comune europeo. Pertanto, in attesa dell'emanazione di una specifica normativa europea e
in applicazione del principio di precauzione di cui al comma 14 dell'articolo 19 della legge 1096/71, non è
possibile autorizzare la semina di varietà OGM, in quanto non iscritte nel registro nazionale italiano né la
presenza di sementi geneticamente modificati in lotti di sementi convenzionali.
È invece possibile ottenere l'autorizzazione per colture OGM sperimentali.
In particolare, la circolare MIPAF sulla campagna semina 2003 stabilisce le modalità di controllo inerenti mais
e soia e per la presenza di organismi geneticamente modificati: definisce le analisi da effettuare, che sono di
tipo qualitativo, ed impone tolleranza zero.
Alcune normative a livello regionale prevedono l'esplicito divieto di coltivare e allevare su terreni di proprietà
pubblica organismi geneticamente modificati (Basilicata, Campania, Umbria, Toscana e Abruzzo), in alcuni casi
neanche a livello sperimentale. Alcune regioni hanno previsto forme di penalizzazione nei confronti delle
aziende che utilizzano OGM, tra cui l'esclusione da finanziamenti pubblici e dall'assegnazione di marchi di
qualità ai loro prodotti.
Non esiste attualmente una normativa relativa alla vendita di alimenti geneticamente modificati. Alcune regioni
e province hanno legiferato imponendo il divieto di somministrare cibi OGM nei luoghi di ristorazione collettiva.
15
ANALISI MOLECOLARE DEL DNA
TECNICHE UTILIZZATE IN LABORATORIO
1. ESTRAZIONE DEL DNA.
Il DNA può essere estratto da qualunque cellula nucleata. I tipi cellulari più utilizzati sono rappresentati dai
leucociti di sangue periferico, colture cellulari (fibroblasti, amniociti,villi coriali). L’isolamento del DNA richiede
l’utilizzo di enzimi capaci di distruggere le membrane cellulari e nucleari e di solventi organici in grado di
separare le proteine dagli acidi nucleici.
Nella procedura che seguiremo in laboratorio, la soluzione “IstaGene” utilizzata contiene sali che distruggono
le membrane e molecole cariche negativamente che hanno il compito di legare i cationi bivalenti, come il
Magnesio Mg2+, la cui presenza può attivare gli enzimi che degradano il DNA e. La determinazione quantitativa
della concentrazione del DNA estratto viene effettuata mediante corsa elettroforetica su gel di Agarosio.
2. LA TECNICA DELLA PCR
L’introduzione della PCR, la tecnica che consente di amplificare selettivamente un tratto di DNA, ha
rivoluzionato la Genetica Molecolare e le sue applicazioni sono praticamente infinite. Uno degli ambiti di
utilizzo è la diagnosi di malattie genetiche mediante analisi di RFLP. L’utilizzo della PCR semplifica molte cose.
Ad esempio, la PCR consente di analizzare uno specifico tratto di DNA, invece di dover lavorare su tutto il DNA
nucleare di una cellula, ossia sul DNA genomico. La PCR (Polymerase Chain Reaction) è una tecnica di
amplificazione in vitro di un frammento di DNA di cui si conosca la sequenza nucleotidica delle regioni terminali.
Il principio è molto semplice. Data una sequenza di DNA genomico a doppio filamento e due corte sequenze
oligonucleotidiche (primer), di cui una complementare ad un tratto di filamento a una estremità del DNA da
amplificare (forward primer), l’altra complementare ad un altro tratto posto all’altra estremità (reverse
primer), in presenza di una DNA polimerasi termostabile ( Taq polimerasi, isolata dal batterio Thermus
Aquaticus che vive nelle sorgenti termali ad alta temperatura) e di una miscela di desossinucleotidi
trifosfati (dNTPs), in appropriate condizioni di reazione, è possibile copiare numerosissime volte (30-40
volte) il tratto compreso tra i due primer, semplicemente facendo variare ciclicamente la temperatura di
reazione. Infatti, raggiunta la temperatura di denaturazione (92-95°C), la doppia elica si apre (fase di
denaturazione), rendendo disponibile lo stampo per la sintesi delle catene complementari. Se la temperatura
si abbassa, in virtù delle loro minori dimensioni e della loro concentrazione, i primer si legheranno (fase di
.appaiamento o annealing ) al DNA stampo prima che si rinaturi e in presenza di una DNA polimerasi con un
optimum di temperatura elevato (circa 72°C), inizierà la sintesi di DNA a partire dai primer (fase di sintesi
del DNA o extension ), procedendo lungo i filamenti singoli. Al termine del primo ciclo di PCR da una doppia
elica di DNA se ne ottengono due. Ripetendo il ciclo denaturazione – annealing – extension numerose volte (in
genere da 30 a 40 volte), si ottiene una massiccia amplificazione specifica di un dato tratto di DNA,
corrispondente a DNA in quantità tale da essere visualizzabile in un gel di agarosio mediante colorazione
specifica.
Scelta dei primer.
Per ogni PCR, è necessario usare due primer (forward e reverse). La scelta della coppia di primer è
critica per una buona riuscita della PCR, ovvero per ottenere l’amplificazione di un tratto di DNA in modo
specifico. I primer devono essere “disegnati” a monte e a valle dei siti di restrizione. Si tratta di
oligonucleotidi , con dimensioni comprese tra le 15 e le 30 basi che ibridano su filamenti opposti in posizioni
fiancheggianti la regione di interesse del DNA.
Per minimizzare la formazione di artefatti è importante che le loro sequenze non contengano basi
complementari (all’interno dello stesso primer o tra i due primer); inoltre la Temperatura di fusione dei due
oligonucleotidi deve essere identica o almeno molto vicina.
Il metodo di analisi del DNA mediante PCR presenta vantaggi molto evidenti:
1. è molto rapido
2. la manualità è semplicissima
3. è automatizzato
4. i risultati sono visualizzabili con facilità.
La PCR ha rivoluzionato la genetica molecolare. Le applicazioni della PCR sono praticamente infinite.
16
I termociclatori
Il successo della PCR è dovuto in gran parte alla possibilità di far avvenire l’intero processo in modo
automatico all’interno di strumenti detti termociclatori (thermal cyclers) in grado di variare ciclicamente la
temperatura tra le varie fasi di ogni ciclo di PCR. Un esempio di profilo di amplificazione standard impostato
mediante un termociclatore è il seguente:
- Denaturazione iniziale del DNA: 5 min. a 94°C
- Denaturazione: 30 sec. a 94°C
- Appaiamento (annealing) dei primer: 30 sec. a 50°-60°C
35 cicli
- Sintesi (extension): 30 sec-5 min. a 72°C
- Extension finale di DNA: 10 min. a 72°C
Il successo della PCR è stato possibile grazie anche all’uso di una DNA polimerasi termostabile estratta da
batteri termofili (che vivono ad elevate temperature), la Taq polimerasi, estratta dal batterio Thermus
aquaticus.
Nel protocollo di laboratorio dell’attività “Che DNA hai nel piatto?” verranno allestite due reazioni di PCR
per ogni campione di DNA, cioè si faranno in totale 6 PCR.
- 2 su DNA non OGM
- 2 su DNA del cibo Test
- 2 su DNA OGM
La prima PCR è il controllo di DNA vegetale, per essere certi che il DNA amplificato sia veramente di
vegetale. Contiene primers che amplificano una parte di un gene del cloroplasto (correlato al fotosistema II).
La seconda PCR definisce se si è in presenza di DNA GM, mediante identificazione di sequenze di DNA
comuni al ≈ 85% delle piante GM con primers specifici per queste sequenze presenti.
3.ELETTROFORESI SU GEL DI AGAROSIO
E’ una tecnica che consente di separare in base alle loro dimensioni (peso molecolare) molecole dotate di
carica, facendole migrare su un gel in presenza di un campo elettrico. Il gel può essere immaginato come una
rete tridimensionale attraverso le cui maglie migrano le molecole sotto l’azione di un campo elettrico. Il campo
elettrico è generato da un apparecchio, detto alimentatore. Per separare molecole di DNA si usano gel di
agarosio a varia concentrazione. Le molecole di DNA sono cariche negativamente per la presenza di gruppi
fosfato e migrano dal polo negativo (catodo) verso il polo positivo (anodo). Per un certo intervallo di pesi
molecolari, la velocità di migrazione è funzione del loro peso molecolare: tanto più grande è la molecola di
DNA, tanto minore è la velocità di migrazione. E, viceversa, tanto più piccola è la molecola di DNA, tanto più
velocemente migra. Le molecole di DNA di diversa lunghezza vengono pertanto separate in base alla diversa
velocità di migrazione. Per poter determinare la lunghezza delle molecole di DNA in esame separate mediante
elettroforesi, vengono “caricati” sul gel anche i cosiddetti marcatori di peso molecolare , ossia una miscela
di frammenti di DNA di cui è noto il peso molecolare. Confrontando la posizione dei frammenti a peso
molecolare noto con quella dei frammenti di DNA in esame, è possibile calcolarne il peso molecolare, ossia la
lunghezza. Dato che il peso molecolare di un frammento di DNA è proporzionale al numero di coppie di
nucleotidi (basi) che lo costituiscono, di solito esso viene espresso in paia di basi (bp). La separazione
elettroforetica dura circa 20 min. I frammenti di DNA, essendo incolori, possono essere visualizzati, con
particolari sistemi di colorazione. In questa procedura si utilizza Orange G Loading Dye (valutazione
cromatica occhiometrica). Come intercalante si utilizza EuroSafe che rende visibile il DNA all’UV sotto forma
di bande distinte.
17
BIOINFORMATICA
PREMESSA
Le Banche dati biologiche
Una banca dati biologica è una raccolta di informazioni e dati derivanti dalla letteratura e da analisi
effettuate sia in laboratorio (in vitro e in vivo) sia mediante strumenti bioinformatici (analisi detta in silico).
Ciascuna banca dati è organizzata attorno ad un elemento centrale (nelle banche dati di sequenze
nucleotidiche ad esempio questo elemento è rappresentato dalle sequenze di DNA o di RNA).
Attorno all’elemento centrale viene costruita la “entry” della banca dati, che comprende tutte le annotazioni
utili a classificare (ad esempio, il nome della sequenza, la specie di appartenenza, ecc) e a caratterizzare (ad
esempio, la funzione della sequenza, le referenze bibliografiche ecc.) l’elemento stesso.
Le informazioni contenute nelle voci di una banca dati vengono in genere scritte sotto forma di “flat file”
ovvero file di testo nei quali le informazioni sono scritte in maniera sequenziale in linee identificate da un
codice a sinistra che caratterizza gli attributi contenuti nella linea stessa. Il formato flat file è molto
utilizzato perchè analizzabile mediante programmi per estrarre dalla banca dati informazioni biologiche
specifiche. La diffusione di internet ha portato all’inserimento nelle voci delle banche dati di riferimenti
crociati mediante hypertext link che consentono di navigare fra le diverse banche dati in un sistema integrato
di informazioni.
Le banche di acidi nucleici (DNA e RNA) vengono spesso definite di primo livello in quanto
contengono solo informazioni molto generiche associate alla sequenza, necessarie per identificarla dal punto di
vista specie-funzione.
Le principali banche di acidi nucleici sono tre:
EMBL datalibrary (Europa)
GenBank (USA)
DDBJ (Giappone)
Fra le tre banche dati è stato stipulato un accordo internazionale per cui il contenuto dei dati di
sequenza presenti è quasi del tutto coincidente e le informazioni vengono scambiate fra le tre
banche dati giornalmente. Qualsiasi ricercatore può depositare (attraverso un apposito sistema on
line di invio dei dati) le proprie sequenze, che, dopo essere state controllate, vengono inserite
nella banca dati.
Le banche dati di secondo livello svolgono la funzione di integrare le informazioni contenute in
diverse banche dati rendendo ancora più veloce l’accesso alle informazioni.
Esistono banche dati specializzate, che raccolgono informazioni specifiche (ad esempio banche
dati di enzimi di restrizione, banche dati di sequenze di regolazione dei promotori, banche dati di
mutazioni ecc.). Alcune di queste possono essere estremamente specializzate (ad esempio una
banca dati che raccolga le informazioni su uno specifico gene), altre invece contengono
informazioni più ampie (ad esempio banche dati di strutture tridimensionali, banche dati di motivi
e domini proteici).
Alcune banche dati biologiche sono:
http://www.ncbi.nlm.nih.gov/
NCBI (National Biotechnology Institute, NIH) ha creato un database pubblico e ha sviluppato software per
analizzare i dati del genoma.
http://www.ensembl.org
Ensembl (il nome ricorda la parola francese “ensemble” e al contempo “EMBL” European Molecular Biology
Laboratory) è un database nato dalla collaborazione dell’ EMBL – European Bioinformatics Institute (EBI) e il
Wellcome Trust Sanger Institute (WTSI) per sviluppare un sistema di software che produce e gestisce in modo
automatico le annotazioni su alcuni genomi eucariotici.
18
http://www.expasy.org/sprot/sprot-top.html
Swiss Prot è un database di sequenze proteiche che contiene un gran numero di annotazioni (come la
descrizione della funzione di una proteina, I suoi domini, le modificazioni posttrascrizionali, le varianti,….), un
livello molto basso di ridondanza e un alto livello di integrazione con gli altri databese biologici.
http://smart.embl-heidelberg.de/
SMART (Simple Modular Architecture Research Tool) è basato sul principio che le proteine in natura sono
modulari, per esempio contengono moduli funzionali (I domini) che sono rintracciabili perchè si conservano
evolutivamente. SMART permette di identificare I domini proteici e di analizzarne la struttura; sono stati
classificati più di 500 famiglie di domini coinvolti in fattori di trascrizione, proteine associate alla cromatina o
extracellulari. Tutti questi domini sono annotati rispettando la distribuzione filogenetica, la classe funzionale,
la struttura terziaria e i residui funzionali più importanti
http://genome.ucsc.edu/cgi-bin/hgBlat?db=mm2
BLAT (BLAST-Like Alignment Tool), è un algoritmo ottimizzato per confrontare sequenze di cDNA (senza
introni) con sequenze genomiche (che contengono introni). BLAT on DNA è utile per trovare velocemente
sequenze simili per più del 95% della loro lunghezza.
http://arbl.cvmbs.colostate.edu/molkit/translate/index.html
Questo strumento permette di inserire sequenze di acidi (i cDNA o mRNA) per ottenere tutte le
possibili forme di traduzione in sequenze amminoacidiche.
Sistemi di interrogazione delle banche dati biologiche
La consultazione e l’analisi delle informazioni contenute nelle banche dati si realizza attraverso la
disponibilità di sistemi informatici avanzati disegnati per la ricerca e l’estrazione dei dati. I più conosciuti fra
questi strumenti sono SRS (banca dati europea) e Entrez (banca dati americana). Esistono differenze
sostanziali nell’uso dei due sistemi; per es. il numero di sequenze che si ottengono attraverso i due sistemi è
diverso a causa di un diverso aggiornamento delle banche dati utilizzate dai due sistemi di interrogazione.
L’interrogazione di una banca dati può essere effettuata in maniera molto semplice mediante l’utilizzo di una
finestra di ricerca in cui si immette un testo (similmente a quanto si effettua con i motori di ricerca) oppure
compilando apposite form (schede) organizzate secondo la struttura dei dati su cui si intende effettuare la
ricerca.
ALLINEAMENTI DI SEQUENZE
Gli acidi nucleici e le proteine sono costituiti, rispettivamente, da catene polimeriche di nucleotidi
(4 possibili A, C, G e T) e di amminoacidi (20 possibili).
Gli amminoacidi possono essere rappresentati con una nomenclatura a una lettera o con una
nomenclatura a tre lettere che corrispondono alle prime tre lettere del loro nome esteso (Tab.1).
Tab. 1: nomenclatura a 3 lettere e a 1 lettera dei venti amminoacidi esistenti
Queste macromolecole sono quindi in genere rappresentate come sequenze di lettere dove ogni lettera
rappresenta un residuo diverso. Le risultanti stringhe di caratteri possono essere facilmente analizzate
utilizzando metodi informatici che consentono, ad esempio, di identificare delle specifiche sequenze o di
effettuare allineamenti fra sequenze diverse.
L’allineamento di sequenze nucleotidiche o amminoacidiche di una stessa specie o di specie diverse (anche
molto distanti filogeneticamente) consente di mettere in luce l’esistenza di similarità di sequenza, che vengono
“misurate” in base alla percentuale di identità fra le due (o più) sequenze allineate. La percentuale di identità
non è altro che la frazione di residui identici in posizioni corrispondenti sul totale dei residui delle sequenze
allineate.
Ad esempio volendo allineare le due parole CANCELLO e PANNELLO
CANCELLO
:: ::::
PANNELLO
19
riscontreremo una percentuale di identità pari a 6/8 x 100 = 75%
Allineando le due parole PANNELLO e PENNELLO
PANNELLO
: ::::::
PENNELLO
riscontreremo una percentuale di identità pari a 7/8 x 100 = 87,5%
I metodi di allineamento delle sequenze nucleotidiche e amminoacidiche si distinguono essenzialmente in due
tipi:
• allineamenti globali
• allineamenti locali
Dal confronto di due o più sequenze si possono quindi ricavare più allineamenti locali significativi,
anche parzialmente sovrapposti fra di loro.
Esempio: nell'allineamento delle due sequenze amminoacidiche sotto riportate l’inserimento di gap
in una delle due sequenze porta a una sovrapposizione più significativa
TACSTWGCTAGTCTWSTGTAGTC
: : : : : : : :
:
:
:
CCGTACSTWGCWSCTCTTGTC
TACSTWGCTAGTCTWSTGTAGTC
::::: : : :
: ::::
11 sovrapposizioni
:::
TACSTWGC------ WSTGT-GTC
16 sovrapposizioni con gap
L’inserimento di gap è un’esigenza irrinunciabile in quanto nel corso dell’evoluzione si possono avere processi di
inserzione e/o delezione che comportano una diversa lunghezza di sequenze omologhe. Si possono inserire gap
in entrambe le sequenze: allineando le due sequenze originali sottoriportate si contano 10 appaiamenti esatti.
IPLMTRWDQE QESDFGHKLP IYTREWCTRG
||||||||||
CHKIPLMTRWDQ QESDFGHKLP VIYTREW
Inserimento di 1 gap per sequenza si contano 25 appaiamenti esatti.
IPLMTRWDQEQESDFGHKLP-IYTREWCTRG
|||||||||
|||||||||| ||||||
CHKIPLMTRWDQ-QESDFGHKLPVIYTREW
A cosa servono gli allineamenti di sequenza?
Gli scopi per cui è utile analizzare la similarità fra due sequenze nucleotidiche o amminoacidiche
sono molteplici:
1) identificazione di regioni conservate: sequenze di regolazione dell’espressione genica (ad esempio elementi
regolatori a funzione nota nei promotori); motivi funzionali nelle proteine (ad esempio il motivo legante gli ioni
calcio);
2) attribuzione di una funzione, identificazione di un nuovo gene/proteina;
3) homology modeling, ovvero elaborazione di una struttura tridimensionale per una proteina in base alla
omologia con proteine di cui sia già stata determinata la struttura 3D;
4) classificazione dei geni in famiglie ed identificazione di nuovi membri di famiglie multigeniche;
5) studi di filogenesi molecolare, per ricostruire le relazioni evolutive fra le specie;
6) studi di tassonomia molecolare (ad esempio classificazione tassonomica degli organismi
in base alle sequenze degli rRNA);
7) studi di genetica di popolazione (migrazioni delle popolazioni umane, relazioni fra le razze umane);
8) identificazione di mutazioni mediante confronto fra la sequenza mutata e la sequenza di riferimento wild
type
20
PERCORSO DI BIOINFORMATICA
“CHE DNA HAI NEL PIATTO?”
La costruzione di una pianta geneticamente modificata con gene Bt mediante
Agrobacterium tumefaciens
La creazione di piante transgeniche per un gene di nostro interesse implica due passi fondamentali:
(1) inserire la sequenza codificante per il nostro gene in un plasmide e quindi trasferire il costrutto in
Agrobatterio
(2) Utilizzare questo Agrobatterio modificato per trasferire il nostro gene in cellule vegetali, selezionando
le cellule trasformate da quelle normali e rigenerando da queste piante trasgeniche
I plasmidi Ti di Agrobacterium sono in grado di trasferire nel genoma delle cellule vegetali una porzione del
DNA - il T-DNA - attraverso un meccanismo di trasferimento che assomiglia a una coniugazione batterica.
Una volta inserito nella cellula vegetale, il T-DNA si integra nel genoma vegetale e si esprime nella cellula
alterandone gli schemi differenziativi. L’analisi molecolare del T-DNA integrato nelle cellule vegetali ha
rivelato sempre la presenza di almeno tre classi di geni:
- geni che codificano per l’ormone vegetale auxina
- il gene che codifica per l’ormone vegetale citochinina
- uno o più geni che sintetizzano degli zuccheri coniugati ad aminoacidi detti opine
L’analisi molecolare dei plasmidi Ti ha dimostrato, però, che mentre i “borders repeats” sono essenziali per il
trasferimento del T-DNA, paradossalmente il T-DNA stesso non lo è.
Infatti è stato possibile costruire un plasmide Ti “disarmato” - cioè incapace di indurre il tumoure - in cui
quasi tutto il T-DNA è stato deleto (lasciando solo il gene nos che codifica per la nopalina sintetasi)
Il gene che dobbiamo inserire nel plasmide è il gene Bt che codifica per la tossina di Bacillus thuringiensis. Il
più comune promotore utilizzato nelle sementi geneticamente modificate è il 35S del virus del mosaico del
cavolfiore (CaMV 35S).Si sceglie questo promotore perché già presente in natura per attivare la trascrizione
in tutti i tipi di piante. Il terminatore più comune utilizzato nelle piante geneticamente modificate è il
Nopaline synthase o NOS terminator (Agrobacterium tumefaciens)
1.
Andiamo sul sito del NCBI. Selezioniamo GeneBank. Scriviamo Bacillus thuringiensis
selezioniamo “Nucleotide”:Si aprirà la pagina :
Scorrendo questa pagina leggiamo molte informazioni…
CDS 141.. 3608
<< gene per endotossina
5'UTR ( 1..140)
1
<<gc actttgtgca
ttttttcata agatgagt ca
caaaaattga tatttagtaa aattagttgc actttgtgca ttttttcata agatgagtca
tatgtttt>>
61 tatgttttaa attgtagtaa tgaaaaacag tattatatca taatgaattg gtatcttaat
121 aaaagagatg gaggtaactt…………………………..
3601 …………… a tatgctttaa aatgtaaggt gtgcaaataa agaatgatta ctgacttgta
3661 ttgacagata aataaggaaa tttttatatg aataaaaaac gggcatcact cttaaaagaa
3721 tgatgtccgt tttttgtatg atttaacgag tgatatttaa atgttttttt gcgaaggctt
3781 tacttaacgg ggtaccgcca catgcccatc aacttaagaa tttgcactac ccccaagtgt
3841 caaaaaacgt tattctttct aaaaagctag ctagaaagga tgacattttt tatgaatctt
3901 tcaattcaag atgaattaca actattttct gaagagctgt atcgtcattt aaccccttct
3961 cttttggaag aactcgctaa agaattaggt tttgtaaaaa gaaaacgaaa gttt
3'UTR (3609..4015)
21
e
endotoxin [Bacillus thuringiensis]
43 bp
DNA
da 29 a 71 = 43 bp
1 gcactttgtg cattttttca taagatgagt catatgtttt aaa //
Clicchiamo su Graphics. Si apre questa pagina.
Il segmento grigio rappresenta il tratto di DNA. Se vogliamo ingrandirlo puntiamo su ATG posto sulla barra. Si può leggere
la sequenza dettagliata base per base.
2.
Cerchiamo il Promotore CaMV35S
Scrivi sulla home page del NCBI “Nucleotide” e Cauliflower mosaic virus
…….. scorrendo la pagina
Clicchiamo su Graphic e poi su ATG lungo la barra
3. Cerchiamo il Terminatore NOS Nopaline Synthase
Scriviamo sulla barra “Gene” e Nopaline synthase Agrobacterium tumefaciens
Sono 1242 bp. Nella stessa pagina:
Cliccando Graphics.
Per ingrandire e arrivare alla sequenza base per base cliccare su ATG o su Tools.
4. Nella stessa pagina, scorrendo….si trovano le Left and Right Border repeats
left border" 1….25
right border" 24812..24836
tggcaggata tattgtggtg taaac
tgacaggat atattggcgg gtaaac
22
PROTOCOLLO DI LABORATORIO (KIT BIORAD)
1°. ESTRAZIONE DI DNA
Materiale:
Quantità
•
Provette con tappo a vite con 500 µl InstaGene matrix
2
•
Becker di acqua distillata
1
•
micropipette + puntali
2
•
Mortaio e pestello
1
•
Cibo da testare*
1–8
•
penna vetrografica
1
N.B.
Trattare il
controllo non-OGM
SEMPRE prima del
cibo da testare per
evitare contaminazioni.
PROCEDURA:
I.
II.
III.
Scrivere sulle provette con tappo a vite, su una “ non OGM”, su un’altra “Test”
Pesare tra 0,5-2 g. di cibo non-OGM e metterlo nel mortaio. Macinare col pestello.
Aggiungere 5 ml. di acqua distillata per ogni g. di cibo. Quindi calcolare il Volume di acqua necessario
IV.
V.
VI.
VII.
Schiacciare col pestello per almeno 2 min. fino a formare una poltiglia.
Aggiungere ancora 5 volumi di acqua, mescolare.
Trasferire 50 µl. di poltiglia nella provetta segnata “non-GMO” contenente 500 µl.IstaGene.
Chiudere la provetta.
(Massa del cibo= ……..g. x 5 =
……..ml.)
LAVARE IL MORTAIO CON DETERGENTE E ASCIUGARE BENE.
VIII.
IX.
X.
XI.
Ripetere gli step da II-VI per preparare il campione del cibo “Test”
Pipettare 50 µl. di poltiglia nella provetta siglata “Test”contenente 500 µl.IstaGene.
Chiudere la provetta.
Mescolare agitando le due provette e/o dare qualche colpetto alle provette.
Mettere le provette a bagnomaria a 95°C per 5 minuti.
Mettere le provette in centrifuga per 5 minuti a velocità massima.
2. REAZIONE DI PCR
Materiale
•
Contenitore con ghiaccio
•
Master Mix OGM (red)
•
Master Mix Plant ( green)
•
Provette da PCR
•
DNA di controllo OGM-positivo
•
DNA di cibo Test
•
DNA di controllo di cibo non-OGM
•
Micropipette da 20 µl
•
Puntali da 20 µl , con filtro
Quantità
1
1
6
1
1 rack
PROCEDURA:
1.
Numerare 6 provette da PCR, da 1 a 6, siglarle con le iniziali e tenerle in ghiaccio.
N°
1
2
3
4
5
6
DNA
20 µl DNA di controllo di cibo non-OGM
20 µl DNA di controllo di cibo non-OGM
20 µl DNA di cibo Test
20 µl DNA di Cibo Test
20 µl DNA di controllo OGM-positivo
20 µl DNA di controllo OGM-positivo
MASTER MIX
20 µl Plant Master Mix (Green)
20 µl OGM Master Mix (Red)
20 µl Plant Master Mix (Green)
20 µl OGM Master Mix (Red)
20 µl Plant Master Mix (Green)
20 µl OGM Master Mix (Red)
2. Cambiando ogni volta puntale, aggiungere 20 µl della Master Mix indicata in ogni provetta.
3. Cambiando ogni volta puntale, aggiungere 20 µl. di DNA in ogni provetta come indicato sopra.
N.B. Fare attenzione a non trasferire il pellet dell’InstaGene nella provetta di PCR.
Se capita di toccare con il puntale il pellet fare una centrifugata veloce.
4. Mettere le provette nel termociclatore.
Programma del termociclatore
Step
Denaturazione
iniziale
PCR
Amplification
Funzione
Denatura
Temperature
Durata
Cicli
94°C
2 min
1
Denatura
Appaia
Allunga
94°C
59°C
72°C
1 min
1 min
2 min
40
Estensione
Finale
Allunga
72°C
10 min
1
Store
Store
4°C
Indefinito
23
1
3. ELETTROFORESI
Materiale
• Gel di Agarosio con intercalante
• campioni di amplificato
• Buffer TAE 1X
• Orange loading dye
• Marcatore di PM
• micropipette da 20 µl
• Puntali da 1–20 µl, con filtro
• Camera elettroforetica
• Power supply
• Intercalante Etidio Bromuro
• Forno a Microonde
Quantità
1
6
200 ml.
1 fiala
1 fiala
1
1 rack
1
PROCEDURA:
1. Predisporre l’apparato per l’elettroforesi
2. Per preparare una soluzione di Agarosio 2% aggiungere 2 g. di polvere di agarosio per 100 ml di buffer
TAE 1x in un cilindro di vetro sufficientemente capiente per far bollire la soluzione. Agitare bene per
sospendere la polvere di Agarosio. Aggiungere l’Etidio Bromuro. Colare nella slitta chiusa con lo scotch
e con il pettine. Lasciare solidifare il gel.
3. Fare 6 gocce di di Orange G loading dye di 10 µl ( su un pezzo di parafilm), 1 per ogni campione di
amplificato, e aggiungerlo alle 6 provette cambiando ogni volta puntale. Mescolare bene. Caricare i
pozzetti del gel con 20-25 µl., lasciandone sempre uno vuoto. In un pozzetto caricare 20 µl. del
Marcatore di PM.
Tempo di corsa, ≈ 20 min. Il voltaggio= 100 V
Typical Classroom Results
1. controllo Non-GMO con plant primers
455 bp
2: controllo Non-GMO con GMO primers
No band
3: cibo Test
con plant primers
455 bp
4: cibo Test
con GMO primers
200 bp o no band
5: controllo GMO-pos. con plant primers
455 bp
6: controllo GMO-pos. con GMO primers
200 bp
7: Marcatore di PM
1,000, 700, 500, 200, 100 bp
24
1,000 bp
700 bp
500 bp
200 bp
Nella corsa 4, la presenza o l’assenza della banda da 200 bp. indica se il 100
cibo bp
test contiene o non contiene GMOs.
Comunque, la validità di questo risultato dipende dall’esito della PCR.
Il controllo della PCR del gene del cloroplasto indica se il DNA estratto è effettivamente di un vegetale
Il controllo di cibo non-GM è indicatore di falso positivo, quindi deve sempre esserci.
Se il DNA di controllo non-GM risulta invece GM-positivo (mostrando una banda nella corsa 2) significa che la PCR
si è contaminata in qualche punto del processo. Se anche il cibo test risulta GM-positivo, non si può tenere conto
di questo risultato.
Il controllo GM-positivo è un indicatore di falso negativo. Se il controllo GM-positivo non si amplifica, vuol dire
che la reazione di PCR non è avvenuta e il risultato del test del cibo GM-negativo non è attendibile.
PUNTI CRITICI DI CONTROLLO NELL’ESPERIMENTO GUIDATO:
1. Controllo della efficacia dell’estrazione di DNA
2. Rischio di eventuali contaminazioni.
3. Controllo della reazione di PCR.
4. Test per una vasta gamma di cibi GM.
Con questo kit può essere identificato l’85% circa di cibi GM comunemente presenti sul mercato.
24
GUIDA PER LO STUDENTE
1.
UNITA’ DI MISURA
2. DILUIZIONI
Spesso quando si preparano soluzioni in laboratorio è conveniente preparare una soluzione madre o stock
più concentrata e diluirla al momento dell'uso. In questo modo non sarà necessario pesare ogni volta la polvere,
ma basterà diluire opportunamente lo stock per ottenere la concentrazione voluta. La concentrazione dello
stock può essere indicata nel suo valore assoluto (es. 2.5 M) oppure in modo relativo alla concentrazione d'uso,
indicando quante volte lo stock è più concentrato della concentrazione d'uso.
Ad es. 5X (leggi: "5 per") vuol dire che lo stock è 5 volte più concentrato del necessario. Per arrivare alla
concentrazione corretta (1X) si dovrà diluire 5 volte, o 1:5.
Questa notazione relativa è particolarmente utile quando si utilizzano soluzioni di più composti per cui non ha
senso definire la concentrazione assoluta. Ad esempio, non è possibile definire la molarità per una soluzione
come il PBS (Phosphate Buffered Saline), che contiene 137 mM NaCl, 10 mM fosfato e 2.7 mM KCl; si parlerà
invece di PBS 1X (concentrazione d'uso) o di PBS 3X, 5X, 10X in caso di soluzioni stock più concentrate.
Ovviamente è anche possibile ottenere, ad esempio, una soluzione 0.5X, diluendo 2 volte la soluzione 1X, anche
se in questo caso non si potrà più tornare alla soluzione 1X.
Ad esempio, se una soluzione viene utilizzata a 1mM e si parte da uno stock 10mM, si può dire che lo stock è
10X, cioè è 10 volte più concentrato. Lo stock andrà quindi diluito 1:10. Questo vuol dire prendere 1 parte della
soluzione di partenza per 10 parti di volume finale, ovvero 1 parte di iniziale più 9 di solvente.
(NON 1 parte di stock + 10 di solvente!!!).
NOTA: Per diluizioni più alte, ad esempio 1:1000 il volume di stock da aggiungere è trascurabile rispetto al
volume di soluto, quindi si può approssimare mettendo 1 parte di stock + 1000 di solvente (invece di 1 parte di
stock + 999 di solvente).
E' anche possibile diluire più volte lo stock per ottenere la soluzione finale.
Diluizioni seriali (scalari): sono diluizioni fatte in serie, si parte da una soluzione iniziale e la si diluisce poi
da questa si prende una parte e la si diluisce ulteriormente, e così via fino a formare una serie di diluizioni. Ad
es. posso fare diluizioni seriali 1:10, 1:5, 1:2...
Quando le diluizioni seriali vengono fatte diluendo sempre una parte della soluzione precedente in 2 parti di
soluzione totale (1 parte di soluzione + 1 parte di solvente) vengono dette diluizioni al raddoppio.
Esempi: diluizione seriale 1:1
N° Diluizione
1
Indiluita
2
1:10
preparata facendo una diluizione 1:10 dalla provetta 1
3
1:100
preparata facendo una diluizione 1:10 dalla provetta 2
25
Una formula comunemente usata in laboratorio è la seguente:
con :
Vi = volume iniziale
Ci = concentrazione iniziale
Vf = volume finale
Cf = concentrazione finale
Vi x Ci = Vf x Cf
In questo caso, conoscendo tre dei quattro parametri, è possibile ricavare il quarto.
Ad esempio:
Vogliamo ottenere 100 ml di una soluzione 50 mM a partire da una soluzione stock 1M. Quanto stock dobbiamo
usare?
Conosciamo Ci = 1M = 1000 mM, Cf = 50 mM e Vf = 100 ml
N.B. è importante utilizzare unità di misura coerenti. Ad esempio si devono esprimere i valori
o tutti in L. o tutti in ml. o in µl.
Troviamo Vi = Vf x Cf / Ci = 100 x 50 / 1000 = 5 ml
Dovremo quindi prendere 5 ml di stock e portarli a 100 ml di volume finale aggiungendo 95 ml di H2O
(o dell'opportuno solvente).
E' possibile applicare questa formula anche nel caso in cui le concentrazioni siano espresse in altro modo, ad
es. X (per), N (normale) o anche %v o %m.
3. SOLUZIONI DA PREPARARE
√ TAE BUFFER
Il buffer TAE a disposizione per l’elettroforesi è concentrato 50x. Per preparare il gel di Agarosio serve il
TAE 1x. Servono 3 L. di TAE 1x per riempire l’apparato e per preparare i gel.
Come si prepara la soluzione TAE 1x ? Bisogna fare una diluizione 1:50
60 ml. TAE 50x + 2,94 L. di Acqua distillata
√ GEL DI AGAROSIO AL 3%
Aggiungere 3 g. di polvere di Agarosio a 100 ml di Buffer TAE 1x in una beuta di vetro pyrex.
Sciogliere
bene l’Agarosio riscaldando in forno microonde per qualche min., agitando ogni tanto, fino a che la soluzione
non risulterà perfettamente trasparente. Far raffreddare un po’ ed aggiungere 5 µl di intercalante. Colare in
una “slitta” provvista del pettine, chiusa opportunamente con scotch di carta.
Se devi preparare 60 ml. di
una soluzione di Agarosio al 0,8%, quanti g. di Agarosio dovrai pesare?
√
SOLUZIONE Master MIX per PCR:
Vol. TOT = 25 µl
Buffer
2,5
Mg
?
dnTPs
0,5 (10nm)
Forward/Primer Reverse ?
H2 O
?
Taq polimerasi
0,15
Tot.
23
DNA
2 µl
Avendo a disposizione soluzioni stock calcola:
11. Quanti µl della stock di Mg2+ (50 mM) dovrai prelevare se la [Mg2+] deve essere 1,4 mM in un Vol. finale di
20 µl
12. Quanto deve essere diluita la stock di F/R [100 pmol/µl] se nella mix devono essere [10 pmol/µl] ? E della
soluzione diluita, quanti µl ne devo prendere per un Vol. Tot. di mix di 20 µl ?
26
4. TEST DI VALUTAZIONE DELLE CONOSCENZE E DELLE COMPETENZE
TEST di valutazione dei prerequisiti
1.
2.
3.
4.
5.
6.
7.
8.
9.
10.
11.
Come si chiama l'estremità di un cromosoma?
a.
Centromero
b.
Origine di replicazione
c.
Telomero
d.
Esomero
Il crossing over della meiosi avviene durante:
a.
Metafase II
b.
Profase I
c.
Anafase I
d.
Profase II
Dove si trovano le estremità 5’UTR e 3’UTR ?
a.
Intervallate tra gli esoni
b.
Nella regione del promotore
c.
Negli esoni
d.
All’inizio e alla fine del gene
Che cosa inducono i codoni di stop?
a.
Lo splicing del RNA
b.
La degradazione del mRNA
c.
La fine della traduzione
d.
L’aggiunta dell’ultimo aminoacido
Il codice genetico si dice "ridondante" o "degenerato" perché:
a.
Ad 1 tripletta di nucleotidi corrispondono 2 aminoacidi
b.
Ad 1 tripletta di nucleotidi corrispondono più aminoacidi
c.
Ad 1 aminoacido corrispondono più triplette di nucleotidi
d.
Ad un aminoacido corrisponde un solo tRNA
Il DNA dei cromosomi eucariotici che viene trasferito e non tradotto è stato trovato anche nel mezzo dei geni
strutturali. Tali sequenze sono dette:
a.
Esoni
b.
Introni
c.
Sequenze spaziatrici
d.
Promotori
Quali tra queste affermazioni sulla replicazione del DNA sono vere?
a.
La DNA polimerasi agisce in direzione 5’->3’
b.
La replicazione del DNA avviene nella fase S del ciclo cellulare
c.
La DNA polimerasi ha bisogno di un RNA primer per iniziare
d.
Sono vere tutte e tre
Quanti cromosomi ha una cellula umana diploide?
a.
Dipende dalla cellula.
b.
72
c.
46
d.
23
Cosa vuol dire “locus polimorfico”
a.
La posizione di un gene diverso
b.
Locus per il quale esistono più alleli
c.
Un allele dominante e uno recessivo
d.
Un gene
Indica quale tra le seguenti ti sembra essere la miglior definizione di "gene":
a.
Segmento di DNA che contiene l'informazione per la sintesi di una specifica molecola di RNA
b.
Entità di natura chimica sconosciuta, che dirige lo sviluppo delle strutture e delle funzioni dell'organismo
c.
L'insieme del DNA contenuto nel nucleo cellulare
d.
Segmento di RNA che contiene l'informazione per la sintesi di una specifica proteina
Gli autosomi umani sono:
a.
22 coppie
b.
22 cromosomi
c.
46 cromosomi
d.
23 cromosomi
27
12.
13.
14.
15.
16.
17.
18.
19.
20.
Indica quale dei seguenti processi biologici aumenta la variabilità genetica:
a.
Meiosi
b.
Mutazioni
c.
Mitosi
d.
Interazioni gene/ambiente
Che cosa richiede l’estrazione del DNA dalle cellule:
a.
La distruzione della sola membrana plasmatica
b.
La distruzione dei mitocondri
c.
La distruzione di tutte le membrane
d.
L’utilizzo di strumenti particolari
Si ha codominanza quando:
a.
Gli alleli dell’omozigote sono AA e aa
b.
Gli alleli dell’eterozigote sono entrambi espressi
c.
Un allele è dominante e l’altro è recessivo
d.
A livello fenotipico non si manifesta alcun carattere
In quali organelli è localizzato il DNA vegetale?
a.
Nucleo
b.
Ribosomi e nucleo
c.
Nucleo, cloroplasti e mitocondri
d.
Vacuoli
Le due emieliche di una molecola di DNA sono antiparallele. Questa affermazione significa che:
a.
Una emielica ha la direzione 5’P-> 3’OH e l’altra 3’OH ->5’P
b.
I legami chimici che tengono uniti i nucleotidi in ciascuna emielica sono diversi
c.
Le due emieliche sono complementari
d.
La replicazione del DNA è semiconservativa
Durante l’elettroforesi del DNA, le molecole vengono separate in base :
a.
Alla loro carica elettrica
b.
Al loro peso molecolare
c.
Alla loro sequenza nucleotidica
d.
Alla loro forma
Per ottenere l’amplificazione di un tratto di DNA quale tecnica usi?:
a.
Estrazione del DNA
b.
Digestione del DNA
c.
Reazione di polimerizzazione a catena
d.
Elettroforesi
La tendenza per due geni sullo stesso cromosoma a segregare insieme e' detta:
a.
Associazione
b.
Ricombinazione
c.
Crossing over
d.
Nessuna di queste
Aumentando la distanza tra due geni
a.
E’ più probabile che avvenga un crossing over
b.
C’è la stessa probabilità
c.
Non c’è crossing over
d.
Non c’è differenza
28
POST LAB TEST
1.
2.
3.
4.
5.
6.
7.
8.
9.
10.
In quali organelli è localizzato il DNA vegetale?
a.
Nucleo
b.
Ribosomi e nucleo
c.
Nucleo, cloroplasti e mitocondri
d.
Vacuoli
Quali molecole presenti nella cellula potrebbero interferire con l’estrazione del DNA ?
a.
Enzimi che degradano il DNA, ioni metallici, la cellulosa
b.
I sali, gli ioni e gli enzimi
c.
L’RNA, gli ioni metallic
d.
I lipidi, I sali e gli ioni metallici
Con quali test puoi valutare se un cibo contiene materiale geneticamente modificato?
a.
PCR
b.
ELISA
c.
PCR e ELISA
d.
PCR Quantitativa
Cibo di controllo non-OGM e campione di cibo da testare. Quale campione deve essere preparato per primo?
a.
Non-OGM
b.
Campione test
c.
Indifferente
La PCR viene utilizzata per:
a.
Ottenere rapidamente un gran numero di copie di un segmento specifico di DNA
b.
Moltiplicare determinati frammenti di restrizione mediante l’uso di DNA batterico
c.
Individuare la presenza di alleli difettosi duplicando l’intero corredo cromosomico
d.
Produrre in poco tempo una nuova colonia di cellule a partire da una cellula clonata
Nella PCR il primo passaggio di ogni ciclo è la denaturazione ad alta temperatura del DNA.
La denaturazione è necessaria per:
a.
Attivare la DNA polimerasi
b.
Permettere agli inneschi (primer) di ibridarsi al DNA-stampo
c.
Permettere ai deossiribonucleosidi trifosfati (dNTP) di accedere al DNA-stampo
d.
Aprire la molecola di DNA per consentire la sintesi
Nella reazione a catena della polimerasi (PCR), i primer utilizzati nella PCR:
a.
Sono sequenze ripetute di DNA
b.
Sono oligonucleotidi ritagliati dagli enzimi di restrizione
c.
Per essere utilizzabili devono essere presenti molte volte nel filamento di DNA
d.
Sono corte sequenze nucleotodiche artificiali complementari al DNA da amplificare
Perché hai allestito due PCR per ogni campione di DNA ?
a.
Una PCR è di controllo e l’altra identifica la sequenza con OGM
b.
Sono due PCR di controllo
c.
Una PCR amplifica il cibo da testare e l’altra il cibo non OGM
Indica quali sono i componenti necessari alla reazione di PCR. Indica a fianco la loro funzione
-
-
-
Esamina la sequenza di 150 basi riportata sotto:
5' TAGAAAAGGA AGGTGGCTCC TACAAATGCC ATCATTGCGA TAAAGGAAAG
GTATCATTC AAGATGCCTC TGCCGACAGT GGTCCCAAAG ATGGACCCCC
ACCCACGAGG AGCATCGTGG AAAAAGAAGA CGTTCCAACC ACGTCTTCAA 3'
a. Scrivi il filamento di sequenza complementare e segna l’estremità 3’ e 5’
b. Ricordando che la DNA polimerasi può solo aggiungere nucleotidi al 3’ del DNA, disegna un primer Forward e un
primer Reverse, di 10 basi ciascuno, necessari per amplificare una sequenza target di DNA lunga almeno 100 bp.
Scrivi la sequenza dei due primers sotto indicando le estremità 3’ e 5’.
Forward primer sequence:
Reverse primer sequence:
c. Indica anche il segmento a cui sono complementari ( e a cui si appaieranno).
29
11.
12.
13.
14.
15.
16.
17.
18.
19.
20.
I markers di peso molecolare usati nell’elettroforesi per individuare la lunghezza dei frammenti di DNA sono
miscele di:
a.
molecole proteiche, a peso molecolare noto, che vengono fatte migrare nella cella elettroforetica insieme
ai campioni da analizzare
b.
molecole di DNA, a peso molecolare noto, che vengono fatte migrare nella cella elettroforetica insieme ai
campioni da analizzare
c.
varie molecole di DNA e proteine, a peso molecolare noto, che vengono fatte migrare nella cella
elettroforetica insieme ai campioni da analizzare
d.
coloranti a peso molecolare noto che vengono fatte migrare nella cella elettroforetica insieme ai
campioni da analizzare
Quale delle seguenti affermazioni riguardo l’elettroforesi del DNA su gel di agarosio è corretta?
(Più di una risposta può essere corretta)
a.
l’elettroforesi su gel separa le singole basi azotate del DNA.
b.
nel corso dell’elettroforesi su gel i frammenti di DNA migrano verso l’elettrodo positivo a causa della
loro carica negativa.
c.
I frammenti più grandi di DNA copriranno, nello stesso tempo, distanze maggiori nel gel rispetto ai
frammenti più piccoli.
d.
I frammenti più grandi di DNA copriranno, nello stesso tempo, distanze minori nel gel rispetto ai
frammenti più piccoli.
Come si fa a capire se un alimento è transgenico? (Più di una risposta può essere corretta)
a.
Si fa la sequenza di tutto il DNA della pianta e la si confronta con quella di una pianta sicuramente
selvatica
b.
Si amplifica una sequenza di DNA specifica del cloroplasto
c.
Si usa la PCR
d.
Si guarda l’etichetta sul prodotto
Una pianta geneticamente modificata si produce trasferendo:
a.
Da una cellula ad un’altra il nucleo
b.
Geni in una cellula vegetale mediante un opportuno vettore
c.
Geni da una cellula vegetale ad un’altra
d.
Il genoma della pianta da modificare in un plasmide
Se il test sul tuo cibo campione ha prodotto una banda da 200 bp con il primer OGM quali sono le tue
conclusioni? (Più di una risposta può essere corretta)
a.
La banda indica che il cibo è GMO positivo
b.
La banda non dà indicazioni sufficienti per identificare l’OGM
c.
La banda indica la presenza in tracce di OGM
d.
La banda indica che c’è stata contaminazione
Gli enzimi di restrizione:
a.
Separano la doppia elica di DNA nei due singoli filamenti
b.
Copiano una porzione ristretta di DNA
c.
Introducono geni estranei nel DNA
d.
Tagliano il DNA a livello di sequenze nucleotidiche specifiche
I microsatelliti:
a.
Sono corte sequenze nucleotidiche ripetute in numero variabile nei diversi individui, che generano
polimorfismo
b.
Sono i punti di innesco della DNA polimerasi durante la replicazione del DNA
c.
Sono polimorfismi del DNA, facilmente identificabili dalle differenze nel fenotipo
d.
Non sono utilizzabili come marcatori genetici perché presenti diffusamente in tutti gli individui
Quanti diversi alleli di un singolo microsatellite è possibile identificare con il DNA profiling in
un individuo eterozigote?
a. 1
c. 4
b. 2
d. 8
Prepara un gel di Agarosio al 2%. Il Vol finale è di 150 ml. Quanti g. di Agarosio devi pesare?
a.
3g
b.
2 g.
c.
4,5 g
d.
2,5 g.
Devi preparare 20 μl di Mix per la PCR. La [Mg 2+] per la PCR è 1,4 mM. Avendo a disposizione una stock
sol. di Mg 50mM, quanti μl dovrai prelevare ?
30
5. GLOSSARIO
Annealing
Bt
Bacillus
thuringiensis
Cofattore
Denaturazione
DNA Genomico
DNase
dNTPs
Esoni
Extension –
Ingegneria
Genetica
GM
OGM
InstaGene™
matrix
Introne
Lisi
Master mix
Nucleotide
PCR
Primer
Taq DNA
polimerase
Templato
Appaiamento e legame dei primers Forward e Reverse a sequenze complementari su un filamento di DNA
Nelle colture GM Bt un gene che codifica per la proteina Cry del batterio del suolo Bacillus thuringiensis è inserito
nel DNA delle sementi. Il gene conferisce resistenza alla piralide.
Ione o altra piccola molecola necessaria ad un enzima per funzionare correttamente. Per esempio, Taq DNA
polImerasi richiede Mg2+ in modo per funzionare correttamente. Mg2+ è considerato un cofattore.
Il processo di separazione dei due filamenti di DNA è compiuta da enzimi; nella reazione di PCR (in vitro), la
denaturazione avviene grazie al calore.
L’insieme del DNA presente nel nucleo di una cellula
Enzima che degrada il DNA.
Comunemente usati con l’abbreviazione per indicare i 4 deossinucleotidi trifosfati (dATP, dTTP, dGTP, dCTP) necessari
per la sintesi di DNA.
Le regioni codificanti un mRNA trascritto che, legate insieme, lasciano il nucleo per la traduzione in una sequenza
proteica
Allungamento di un primer per aggiunta di dNTPs (dATP, dTTP, dCTP, or dGTP) per mezzo di una DNA polimerasi.
L’allungamento segue la regola dell’appaiamento per base e procede in direzione 5' to 3'
Il processo per il quale si cambia il genotipo di un organismo
Geneticamente modificato
organismo geneticamente modificato
Soluzione di lisi delle cellule
Regione di mRNA trascritto che è tagliato via e non tradotto in sequenza proteica
Il processo di rottura di una cellula e il conseguente rilascio di costituenti.
Una soluzione preparata per la reazione PCR, contenente tutto il necessario (dNTPs, primer, buffer, salts,
polymerase, Mg2+) per la reazione
L’unità fondamentale del DNA e del RNA. Consiste di uno zucchero (deossiribosio o ribosio), fosfato, e nase azotata
(adenina, citosina, guanina, timina, o uracile).
Polymerase chain reaction. Un processo che amplifica (sintetizza grandi quantità a partire da un campione piccolo) il
DNA in provetta
Una piccola catena di nucleotidi (solitamente 16–24 basi) che fornisce un’estremità libera alla DNA polimerasi per
l’allungamento. I primers per la PCR sono disegnati (sintetizzati in un laboratorio) per essere complementari a
sequenze specifiche vicino alla squenza target di DNA, in modo da ancorarsi al templato e fornire un punto d’inizio
alla DNA polimerasi.
DNA polymerase termo-stabile isolata dal batterio Thermus aquaticus termo-stabile. Questa DNA polimerasi è
comunemente usata nelle reazioni di PCR
Il DNA che contiene la sequenza da copiare. Il DNA a doppio filamento serve come templato per la replicazione di
copie di se stesso, poiché la sequenza di ogni filamento serve come templato per la duplicazione della sequenza
dell’altro filamento. Un DNA a singolo filamento, d’altra parte, può servire solo come templato per copie della sua
sequenza complementare, e non per copie di se stesso.
6. BIBLIOGRAFIA E LETTURE RACCOMANDATE
1. Barta, A., et al. The expression of a nopaline synthase-human growth hormone chimaeric gene in transformed tobacco and sunflower
callus tissue. Plant Molecular Biology 6, 347–357 (1986)
2. Beyer, P., et al. Golden rice: Introducing the β-carotene biosynthesis pathway into rice endosperm by genetic engineering to defeat
vitamin A deficiency. Journal of Nutrition 132, 506S–510S (2002)
3.Demont, M., et al. GM crops in Europe: How much value and for whom? EuroChoices 6, 46–53 (2007)
4.Devlin, R., et al. Extraordinary salmon growth. Nature 371, 209–210 (1994)
5. Devos, Y., et al. Ethics in the societal debate on genetically modified organisms: A (re)quest for sense and sensibility. Journal of
Agricultural and Environmental Ethics 21, 29–61 (2007) doi:10.1007/s10806-007-9057-6
6. Guerrero-Andrade, O., et al. Expression of the Newcastle disease virus fusion protein in transgenic maize and immunological studies.
Transgenic Research 15, 455–463(2006) doi:10.1007/s11248-006-0017-0
7. Hiatt, A., et al. Production of antibodies in transgenic plants. Nature 342, 76–79 (1989)
8. Hoban, T. Public attitudes towards agricultural biotechnology. ESA working papers nos. 4-9. Agricultural and Development Economics
Division, Food and Agricultural Organization of the United Nations (2004)
9. Jesse, H., & Obrycki, J. Field deposition of Bt transgenic corn pollen: Lethal effects on the monarch butterfly. Oecologia 125, 241–248
(2000)
10. Losey, J., et al. Transgenic pollen harms monarch larvae. Nature 399, 214 (1999) doi:10.1038/20338
11. Ma, J., et al. The production of recombinant pharmaceutical proteins in plants. Nature Reviews Genetics 4, 794–805 (2003)
doi:10.1038/nrg1177
12. Muir, W., & Howard, R. Possible ecological risks of transgenic organism release when transgenes affect mating success: Sexual
selection and the Trojan gene hypothesis. Proceedings of the National Academy of Sciences 96, 13853–13856 (1999)
31
13. Sears, M., et al. Impact of Bt corn on monarch butterfly populations: A risk assessment. Proceedings of the National Academy of
Sciences 98, 11937–11942 (2001)
14. Spurgeon, D. Call for tighter controls on transgenic foods. Nature 409, 749 (2001)
15. Takeda, S., & Matsuoka, M. Genetic approaches to crop improvement: Responding to environmental and population changes. Nature
Reviews Genetics 9, 444–457 (2008) doi:10.1038/nrg2342
WEBSITES:
United States Department of Energy, Office of Biological and Environmental Research, Human Genome Program. Human Genome Project
information: Genetically modified foods and organisms, http://www.ornl.gov/sci/techresources/Human_Genome/elsi/gmfood.shtml (2007)
Genetically Modified Organisms (GMOs): Transgenic Crops and Recombinant DNA Technology
Recombinant DNA Technology and Transgenic Animals
The Biotechnology Revolution: PCR and the Use of Reverse Transcriptase to Clone Expressed Genes
Agbios database of GMO crops http://www.agbios.com
Cornell University Public Issues Education Project http://www.geo-pie.cornell.edu
European Commission http://www.jrc.cec.eu.int
Pro-GMO web site with educational links http://www.monsanto.com
Anti-GMO web site http://www.greenpeace.org
UNA LETTURA INTERESSANTE
Genetically Modified Organisms (GMOs): Transgenic Crops and Recombinant DNA Technology By: Theresa Phillips,
Ph.D. (Write Science Right) © 2008 Nature Education Citation: Phillips, T. (2008) Genetically modified organisms (GMOs): Transgenic
crops and recombinant DNA technology. Nature Education 1(1)
If you could save lives by producing vaccines in transgenic bananas, would you? In the debate over large-scale commercialization and use
of GMOs, where should we draw the line?
People have been altering the genomes of plants and animals for many years using traditional breeding techniques. Artificial selection for
specific, desired traits has resulted in a variety of different organisms, ranging from sweet corn to hairless cats. But this artificial
selection, in which organisms that exhibit specific traits are chosen to breed subsequent generations, has been limited to naturally
occurring variations. In recent decades, however, advances in the field of genetic engineering have allowed for precise control over the
genetic changes introduced into an organism. Today, we can incorporate new genes from one species into a completely unrelated species
through genetic engineering, optimizing agricultural performance or facilitating the production of valuable pharmaceutical substances.
Crop plants, farm animals, and soil bacteria are some of the more prominent examples of organisms that have been subject to genetic
engineering.
Current Use of Genetically Modified Organisms
Agricultural plants are one of the most frequently cited examples of genetically modified organisms (GMOs). Some benefits of genetic
engineering in agriculture are increased crop yields, reduced costs for food or drug production, reduced need for pesticides, enhanced
nutrient composition and food quality, resistance to pests and disease, greater food security, and medical benefits to the world's growing
population. Advances have also been made in developing crops that mature faster and tolerate aluminum, boron, salt, drought, frost, and
other environmental stressors, allowing plants to grow in conditions where they might not otherwise flourish (Table 1; Takeda & Matsuoka,
2008). Other applications include the production of nonprotein (bioplastic) or nonindustrial (ornamental plant) products. A number of
animals have also been genetically engineered to increase yield and decrease susceptibility to disease. For example, salmon have been
engineered to grow larger (Figure 1) and mature faster (Table 1), and cattle have been enhanced to exhibit resistance to mad cow disease
(United States Department of Energy, 2007).
32
Table 1: Examples of GMOs Resulting from Agricultural Biotechnology
Genetically
Example
Genetic Change
Conferred Trait Organism
APPROVED COMMERCIAL PRODUCTS
Herbicide tolerance Soybean
Glyphosate herbicide (Roundup) tolerance conferred by expression of a glyphosate-tolerant form of the
plant enzyme 5-enolpyruvylshikimate-3-phosphate synthase (EPSPS) isolated from the soil bacterium
Agrobacterium tumefaciens, strain CP4
Insect resistance
Corn
Resistance to insect pests, specifically the European corn borer, through expression of the insecticidal
protein Cry1Ab from Bacillus thuringiensis
Altered fatty acid Canola
High laurate levels achieved by inserting the gene for ACP thioesterase from the California bay tree
composition
Umbellularia californica
Virus resistance
Plum
Resistance to plum pox virus conferred by insertion of a coat protein (CP) gene from the virus
PRODUCTS STILL IN DEVELOPMENT
Vitamin enrichment Rice
Vaccines
Tobacco
Oral vaccines
Maize
Faster maturation
Coho salmon
Three genes for the manufacture of beta-carotene, a precursor to vitamin A, in the endosperm of the
rice prevent its removal (from husks) during milling
Hepatitis B virus surface antigen (HBsAg) produced in transgenic tobacco induces immune response when
injected into mice
Fusion protein (F) from Newcastle disease virus (NDV) expressed in corn seeds induces an immune
response when fed to chickens
A type 1 growth hormone gene injected into fertilized fish eggs results in 6.2% retention of the vector
at one year of age, as well as significantly increased growth rates
The pharmaceutical industry is another frontier for the use of GMOs. In 1986, human growth hormone was the first protein
pharmaceutical made in plants (Barta et al., 1986), and in 1989, the first antibody was produced (Hiatt et al., 1989). Both research groups
used tobacco, which has since dominated the industry as the most intensively studied and utilized plant species for the expression of
foreign genes (Ma et al., 2003). As of 2003, several types of antibodies produced in plants had made it to clinical trials. The use of
genetically modified animals has also been indispensible in medical research. Transgenic animals are routinely bred to carry human genes,
or mutations in specific genes, thus allowing the study of the progression and genetic determinants of various diseases.
Potential GMO Applications
Many industries stand to benefit from additional GMO research. For instance, a number of microorganisms are being considered as future
clean fuel producers and biodegraders. In addition, genetically modified plants may someday be used to produce recombinant vaccines. In
fact, the concept of an oral vaccine expressed in plants (fruits and vegetables) for direct consumption by individuals is being examined as
a possible solution to the spread of disease in underdeveloped countries, one that would greatly reduce the costs associated with
conducting large-scale vaccination campaigns. Work is currently underway to develop plant-derived vaccine candidates in potatoes and
lettuce for hepatitis B virus (HBV), enterotoxigenic Escherichia coli (ETEC), and Norwalk virus. Scientists are also looking into the
production of other commercially valuable proteins in plants, such as spider silk protein and polymers that are used in surgery or tissue
replacement (Ma et al., 2003). Genetically modified animals have even been used to grow transplant tissues and human transplant organs,
a concept called xenotransplantation. The rich variety of uses for GMOs provides a number of valuable benefits to humans, but many
people also worry about potential risks.
Risks and Controversies Surrounding the Use of GMOs
Despite the fact that the genes being transferred occur naturally in other species, there are unknown consequences to altering the
natural state of an organism through foreign gene expression. After all, such alterations can change the organism's metabolism, growth
rate, and/or response to external environmental factors. These consequences influence not only the GMO itself, but also the natural
environment in which that organism is allowed to proliferate. Potential health risks to humans include the possibility of exposure to new
allergens in genetically modified foods, as well as the transfer of antibiotic-resistant genes to gut flora.
Horizontal gene transfer of pesticide, herbicide, or antibiotic resistance to other organisms would not only put humans at risk, but it
would also cause ecological imbalances, allowing previously innocuous plants to grow uncontrolled, thus promoting the spread of disease
among both plants and animals. Although the possibility of horizontal gene transfer between GMOs and other organisms cannot be denied,
in reality, this risk is considered to be quite low. Horizontal gene transfer occurs naturally at a very low rate and, in most cases, cannot
be simulated in an optimized laboratory environment without active modification of the target genome to increase susceptibility (Ma et
al., 2003).
In contrast, the alarming consequences of vertical gene transfer between GMOs and their wild-type counterparts have been highlighted
by studying transgenic fish released into wild populations of the same species (Muir & Howard, 1999). The enhanced mating advantages of
the genetically modified fish led to a reduction in the viability of their offspring. Thus, when a new transgene is introduced into a wild
fish population, it propagates and may eventually threaten the viability of both the wild-type and the genetically modified organisms.
Unintended Impacts on Other Species: The Bt Corn Controversy
One example of public debate over the use of a genetically modified plant involves the case of Bt corn. Bt corn expresses a protein from
the bacterium Bacillus thuringiensis. Prior to construction of the recombinant corn, the protein had long been known to be toxic to a
number of pestiferous insects, including the monarch caterpillar, and it had been successfully used as an environmentally friendly
insecticide for several years. The benefit of the expression of this protein by corn plants is a reduction in the amount of insecticide that
farmers must apply to their crops. Unfortunately, seeds containing genes for recombinant proteins can cause unintentional spread of
recombinant genes or exposure of non-target organisms to new toxic compounds in the environment.
33
The now-famous Bt corn controversy started with a laboratory study by Losey et al. (1999) in which the mortality of monarch larvae was
reportedly higher when fed with milkweed (their natural food supply) covered in pollen from transgenic corn than when fed milkweed
covered with pollen from regular corn. The report by Losey et al. was followed by another publication (Jesse & Obrycki, 2000) suggesting
that natural levels of Bt corn pollen in the field were harmful to monarchs.
Debate ensued when scientists from other laboratories disputed the study, citing the extremely high concentration of pollen used in the
laboratory study as unrealistic, and concluding that migratory patterns of monarchs do not place them in the vicinity of corn during the
time it sheds pollen. For the next two years, six teams of researchers from government, academia, and industry investigated the issue and
concluded that the risk of Bt corn to monarchs was "very low" (Sears et al., 2001), providing the basis for the U.S. Environmental
Protection Agency to approve Bt corn for an additional seven years.
Unintended Economic Consequences
Another concern associated with GMOs is that private companies will claim ownership of the organisms they create and not share them at
a reasonable cost with the public. If these claims are correct, it is argued that use of genetically modified crops will hurt the economy
and environment, because monoculture practices by large-scale farm production centers (who can afford the costly seeds) will dominate
over the diversity contributed by small farmers who can't afford the technology. However, a recent meta-analysis of 15 studies reveals
that, on average, two-thirds of the benefits of first-generation genetically modified crops are shared downstream, whereas only one-third
accrues upstream (Demont et al., 2007). These benefit shares are exhibited in both industrial and developing countries. Therefore, the
argument that private companies will not share ownership of GMOs is not supported by evidence from first-generation genetically
modified crops.
GMOs and the General Public: Philosophical and Religious Concerns
In a 2007 survey of 1,000 American adults conducted by the International Food Information Council (IFIC), 33% of respondents believed
that biotech food products would benefit them or their families, but 23% of respondents did not know biotech foods had already reached
the market. In addition, only 5% of those polled said they would take action by altering their purchasing habits as a result of concerns
associated with using biotech products.
According to the Food and Agriculture Organization of the United Nations, public acceptance trends in Europe and Asia are mixed
depending on the country and current mood at the time of the survey (Hoban, 2004). Attitudes toward cloning, biotechnology, and
genetically modified products differ depending upon people's level of education and interpretations of what each of these terms mean.
Support varies for different types of biotechnology; however, it is consistently lower when animals are mentioned.
Furthermore, even if the technologies are shared fairly, there are people who would still resist consumable GMOs, even with thorough
testing for safety, because of personal or religious beliefs. The ethical issues surrounding GMOs include debate over our right to "play
God," as well as the introduction of foreign material into foods that are abstained from for religious reasons. Some people believe that
tampering with nature is intrinsically wrong, and others maintain that inserting plant genes in animals, or vice versa, is immoral. When it
comes to genetically modified foods, those who feel strongly that the development of GMOs is against nature or religion have called for
clear labeling rules so they can make informed selections when choosing which items to purchase. Respect for consumer choice and
assumed risk is as important as having safeguards to prevent mixing of genetically modified products with non-genetically modified foods.
In order to determine the requirements for such safeguards, there must be a definitive assessment of what constitutes a GMO and
universal agreement on how products should be labeled.
These issues are increasingly important to consider as the number of GMOs continues to increase due to improved laboratory techniques
and tools for sequencing whole genomes, better processes for cloning and transferring genes, and improved understanding of gene
expression systems. Thus, legislative practices that regulate this research have to keep pace. Prior to permitting commercial use of
GMOs, governments perform risk assessments to determine the possible consequences of their use, but difficulties in estimating the
impact of commercial GMO use makes regulation of these organisms a challenge.
History of International Regulations for GMO Research and Development
In 1971, the first debate over the risks to humans of exposure to GMOs began when a common intestinal microorganism, E. coli, was
infected with DNA from a tumor-inducing virus (Devos et al., 2007). Initially, safety issues were a concern to individuals working in
laboratories with GMOs, as well as nearby residents. However, later debate arose over concerns that recombinant organisms might be
used as weapons. The growing debate, initially restricted to scientists, eventually spread to the public, and in 1974, the National
Institutes of Health (NIH) established the Recombinant DNA Advisory Committee to begin to address some of these issues.
In the 1980s, when deliberate releases of GMOs to the environment were beginning to occur, the U.S. had very few regulations in place.
Adherence to the guidelines provided by the NIH was voluntary for industry. Also during the 1980s, the use of transgenic plants was
becoming a valuable endeavor for production of new pharmaceuticals, and individual companies, institutions, and whole countries were
beginning to view biotechnology as a lucrative means of making money (Devos et al., 2007). Worldwide commercialization of biotech
products sparked new debate over the patentability of living organisms, the adverse effects of exposure to recombinant proteins,
confidentiality issues, the morality and credibility of scientists, the role of government in regulating science, and other issues. In the U.S.,
the Congressional Office of Technology Assessment initiatives were developed, and they were eventually adopted worldwide as a top-down
approach to advising policymakers by forecasting the societal impacts of GMOs.
Then, in 1986, a publication by the Organization for Economic Cooperation and Development (OECD), called "Recombinant DNA Safety
Considerations," became the first intergovernmental document to address issues surrounding the use of GMOs. This document recommended
that risk assessments be performed on a case-by-case basis. Since then, the case-by-case approach to risk assessment for genetically
modified products has been widely accepted; however, the U.S. has generally taken a product-based approach to assessment, whereas the
European approach is more process based (Devos et al., 2007). Although in the past, thorough regulation was lacking in many countries,
governments worldwide are now meeting the demands of the public and implementing stricter testing and labeling requirements for
genetically modified crops.
Increased Research and Improved Safety Go Hand in Hand
Proponents of the use of GMOs believe that, with adequate research, these organisms can be safely commercialized. There are many
experimental variations for expression and control of engineered genes that can be applied to minimize potential risks. Some of these
practices are already necessary as a result of new legislation, such as avoiding superfluous DNA transfer (vector sequences) and replacing
selectable marker genes commonly used in the lab (antibiotic resistance) with innocuous plant-derived markers (Ma et al., 2003). Issues
34
such as the risk of vaccine-expressing plants being mixed in with normal foodstuffs might be overcome by having built-in identification
factors, such as pigmentation, that facilitate monitoring and separation of genetically modified products from non-GMOs. Other built-in
control techniques include having inducible promoters (e.g., induced by stress, chemicals, etc.), geographic isolation, using male-sterile
plants, and separate growing seasons.
GMOs benefit mankind when used for purposes such as increasing the availability and quality of food and medical care, and contributing to
a cleaner environment. If used wisely, they could result in an improved economy without doing more harm than good, and they could also
make the most of their potential to alleviate hunger and disease worldwide. However, the full potential of GMOs cannot be realized
without due diligence and thorough attention to the risks associated with each new GMO on a case-by-case basis.
7. STRUMENTAZIONE E MATERIALE A DISPOSIZIONE
8. NORME GENERALI DI SICUREZZA IN LABORATORIO
Operazioni preliminari
√ per chi ha i capelli lunghi: legarsi i capelli con un elastico
√ prima di cominciare a lavorare, lavarsi le mani
√ prima di cominciare l’esperimento, lo studente verrà familiarizzato con la strumentazione che dovrà utilizzare, in
modo particolare con le micropipette
Qui di seguito sono elencate alcune norme elementari di sicurezza, che devono essere tassativamente rispettate:
•
•
•
•
•
•
•
•
•
•
•
•
Entrando in laboratorio, individuare le vie di fuga, indicate dalla segnaletica verde.
In laboratorio indossare sempre il camice.
Non introdurre in laboratorio borse, zaini o altro materiale non necessario.
Indossare guanti monouso. I guanti si sfilano rovesciandoli e vanno gettati negli appositi contenitori. I guanti vanno
tolti, quando si usino strumenti di qualsiasi natura (telefono, tastiera, strumenti scientifici, maniglie, ecc.).
Lavare le mani routinariamente. Lavare sempre le mani prima di lasciare il laboratorio.
In laboratorio è vietato mangiare, bere, fumare, portare oggetti alla bocca ed applicare cosmetici.
Non pipettare mai con la bocca, ma utilizzare le apposite propipette.
Seguire scrupolosamente le indicazioni di sicurezza riportate nei protocolli di esperimento.
Decontaminare e pulire sempre, al termine del loro utilizzo, le apparecchiature scientifiche e, al termine della
attività, i piani di lavoro.
Mettere il materiale disposable (pipette, fiasche ecc.) venuto a contatto con materiale biologico in un sacco
apposito, il biobox.
Stante i costi elevati dello smaltimento, ridurre il più possibile l’uso del materiale disposable.
Segnalare immediatamente al personale docente qualsiasi incidente o la mancanza di materiale di protezione
35
Author
Document
Category
Uncategorized
Views
0
File Size
8 980 KB
Tags
1/--pages
Report inappropriate content